NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012300

Metagenome / Metatranscriptome Family F012300

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012300
Family Type Metagenome / Metatranscriptome
Number of Sequences 282
Average Sequence Length 42 residues
Representative Sequence RYRLFDIGGAIGLAGMLLMLVVVTLKNTARLYREERIR
Number of Associated Samples 237
Number of Associated Scaffolds 282

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.08 %
% of genes near scaffold ends (potentially truncated) 96.81 %
% of genes from short scaffolds (< 2000 bps) 85.11 %
Associated GOLD sequencing projects 221
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.518 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds
(8.865 % of family members)
Environment Ontology (ENVO) Unclassified
(20.567 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.426 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 282 Family Scaffolds
PF04138GtrA 79.43
PF00202Aminotran_3 3.55
PF14310Fn3-like 1.77
PF13602ADH_zinc_N_2 1.42
PF00107ADH_zinc_N 1.06
PF01593Amino_oxidase 0.71
PF00762Ferrochelatase 0.71
PF00106adh_short 0.35
PF01555N6_N4_Mtase 0.35
PF00149Metallophos 0.35
PF04993TfoX_N 0.35
PF08281Sigma70_r4_2 0.35
PF13620CarboxypepD_reg 0.35
PF00005ABC_tran 0.35
PF01850PIN 0.35
PF00919UPF0004 0.35
PF00004AAA 0.35
PF01053Cys_Met_Meta_PP 0.35
PF01208URO-D 0.35
PF01066CDP-OH_P_transf 0.35
PF01087GalP_UDP_transf 0.35
PF12762DDE_Tnp_IS1595 0.35
PF02518HATPase_c 0.35
PF04519Bactofilin 0.35
PF00857Isochorismatase 0.35
PF04014MazE_antitoxin 0.35
PF04384Fe-S_assembly 0.35
PF13353Fer4_12 0.35
PF07977FabA 0.35
PF00817IMS 0.35
PF01230HIT 0.35

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 282 Family Scaffolds
COG0276Protoheme ferro-lyase (ferrochelatase)Coenzyme transport and metabolism [H] 0.71
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.35
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.35
COG0389Nucleotidyltransferase/DNA polymerase DinP involved in DNA repairReplication, recombination and repair [L] 0.35
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.35
COG0407Uroporphyrinogen-III decarboxylase HemECoenzyme transport and metabolism [H] 0.35
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.35
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.35
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.35
COG0621tRNA A37 methylthiotransferase MiaBTranslation, ribosomal structure and biogenesis [J] 0.35
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.35
COG07643-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydrataseLipid transport and metabolism [I] 0.35
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.35
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.35
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.35
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.35
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.35
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 0.35
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.35
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.35
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.35
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.35
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.35
COG2975Fe-S-cluster formation regulator IscX/YfhJPosttranslational modification, protein turnover, chaperones [O] 0.35
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 0.35
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.35
COG4706Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domainLipid transport and metabolism [I] 0.35
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.35


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.52 %
UnclassifiedrootN/A2.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001471|JGI12712J15308_10085684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus798Open in IMG/M
3300001593|JGI12635J15846_10212150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1271Open in IMG/M
3300001686|C688J18823_10596903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus705Open in IMG/M
3300001867|JGI12627J18819_10248756All Organisms → cellular organisms → Bacteria → Acidobacteria715Open in IMG/M
3300001976|JGI24752J21851_1029767All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter720Open in IMG/M
3300002245|JGIcombinedJ26739_100276215All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1566Open in IMG/M
3300004091|Ga0062387_100111981All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300004092|Ga0062389_102003776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae756Open in IMG/M
3300004156|Ga0062589_101081272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae757Open in IMG/M
3300004635|Ga0062388_100180362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1643Open in IMG/M
3300005335|Ga0070666_10153776All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300005345|Ga0070692_11005656All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae583Open in IMG/M
3300005356|Ga0070674_100811386All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae809Open in IMG/M
3300005435|Ga0070714_101329890All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae701Open in IMG/M
3300005445|Ga0070708_100028852All Organisms → cellular organisms → Bacteria4778Open in IMG/M
3300005451|Ga0066681_10291196All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae997Open in IMG/M
3300005526|Ga0073909_10260353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae774Open in IMG/M
3300005555|Ga0066692_10561862All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae720Open in IMG/M
3300005557|Ga0066704_10825370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae575Open in IMG/M
3300005568|Ga0066703_10146797All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1416Open in IMG/M
3300005575|Ga0066702_10018778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3322Open in IMG/M
3300005841|Ga0068863_101891717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae607Open in IMG/M
3300005921|Ga0070766_10367536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae937Open in IMG/M
3300005921|Ga0070766_10655127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae708Open in IMG/M
3300005921|Ga0070766_10767354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae655Open in IMG/M
3300005938|Ga0066795_10226998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae554Open in IMG/M
3300005995|Ga0066790_10536504All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae500Open in IMG/M
3300006041|Ga0075023_100076138All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1112Open in IMG/M
3300006041|Ga0075023_100544408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae530Open in IMG/M
3300006050|Ga0075028_100700899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae609Open in IMG/M
3300006052|Ga0075029_100070444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2055Open in IMG/M
3300006052|Ga0075029_100072012All Organisms → cellular organisms → Bacteria2033Open in IMG/M
3300006052|Ga0075029_100214927All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300006059|Ga0075017_100275322All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1237Open in IMG/M
3300006059|Ga0075017_100570934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7863Open in IMG/M
3300006059|Ga0075017_101156113All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae605Open in IMG/M
3300006086|Ga0075019_10266366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1025Open in IMG/M
3300006086|Ga0075019_10293730All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae977Open in IMG/M
3300006086|Ga0075019_10451566All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300006086|Ga0075019_10469671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7777Open in IMG/M
3300006102|Ga0075015_100390312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae784Open in IMG/M
3300006162|Ga0075030_100248063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1427Open in IMG/M
3300006162|Ga0075030_100446283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71030Open in IMG/M
3300006162|Ga0075030_100966566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae671Open in IMG/M
3300006163|Ga0070715_10206063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1002Open in IMG/M
3300006172|Ga0075018_10408611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae692Open in IMG/M
3300006173|Ga0070716_100018042All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3671Open in IMG/M
3300006174|Ga0075014_100047410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71829Open in IMG/M
3300006174|Ga0075014_100455430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae708Open in IMG/M
3300006175|Ga0070712_101553943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae578Open in IMG/M
3300006176|Ga0070765_100033872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4013Open in IMG/M
3300006237|Ga0097621_100096544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2480Open in IMG/M
3300006237|Ga0097621_102184220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae529Open in IMG/M
3300006354|Ga0075021_10065391All Organisms → cellular organisms → Bacteria2121Open in IMG/M
3300006354|Ga0075021_10548312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae735Open in IMG/M
3300006358|Ga0068871_101362562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae668Open in IMG/M
3300006755|Ga0079222_10668979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae813Open in IMG/M
3300006791|Ga0066653_10207633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae994Open in IMG/M
3300006800|Ga0066660_11066398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068643Open in IMG/M
3300006854|Ga0075425_102119431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae627Open in IMG/M
3300006904|Ga0075424_102812950All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae507Open in IMG/M
3300006914|Ga0075436_100278423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1196Open in IMG/M
3300007076|Ga0075435_100403400All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1176Open in IMG/M
3300007255|Ga0099791_10283064Not Available789Open in IMG/M
3300007788|Ga0099795_10091015All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300007982|Ga0102924_1345951All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300009038|Ga0099829_10497298All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71012Open in IMG/M
3300009094|Ga0111539_10466341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71471Open in IMG/M
3300009137|Ga0066709_100267559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2300Open in IMG/M
3300009524|Ga0116225_1350519All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300009547|Ga0116136_1111399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7707Open in IMG/M
3300009551|Ga0105238_11010281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7853Open in IMG/M
3300009629|Ga0116119_1093556All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300009638|Ga0116113_1156121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae573Open in IMG/M
3300009645|Ga0116106_1071132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1140Open in IMG/M
3300009665|Ga0116135_1051696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71429Open in IMG/M
3300009683|Ga0116224_10243515All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae858Open in IMG/M
3300009700|Ga0116217_10819523All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300009762|Ga0116130_1162566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae705Open in IMG/M
3300009792|Ga0126374_10777204All Organisms → cellular organisms → Bacteria → Acidobacteria729Open in IMG/M
3300010043|Ga0126380_11879520All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300010048|Ga0126373_10855111All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300010343|Ga0074044_10654855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7685Open in IMG/M
3300010359|Ga0126376_12829921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7535Open in IMG/M
3300010360|Ga0126372_10685772All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300010361|Ga0126378_11140771All Organisms → cellular organisms → Bacteria → Acidobacteria879Open in IMG/M
3300010366|Ga0126379_10486706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1303Open in IMG/M
3300010371|Ga0134125_12808022All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300010373|Ga0134128_12804934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300010376|Ga0126381_102193776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7794Open in IMG/M
3300010379|Ga0136449_100816705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1537Open in IMG/M
3300010379|Ga0136449_102909316All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7672Open in IMG/M
3300010397|Ga0134124_11378209All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300011003|Ga0138514_100038291All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300011271|Ga0137393_10044250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3451Open in IMG/M
3300011271|Ga0137393_10236717All Organisms → cellular organisms → Bacteria → Acidobacteria1547Open in IMG/M
3300011271|Ga0137393_11257396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7628Open in IMG/M
3300012189|Ga0137388_10705365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7937Open in IMG/M
3300012189|Ga0137388_11216946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7691Open in IMG/M
3300012203|Ga0137399_10789192All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300012208|Ga0137376_10715113All Organisms → cellular organisms → Bacteria → Acidobacteria864Open in IMG/M
3300012208|Ga0137376_11007318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia713Open in IMG/M
3300012210|Ga0137378_11740527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7529Open in IMG/M
3300012212|Ga0150985_122982041All Organisms → cellular organisms → Bacteria → Acidobacteria1327Open in IMG/M
3300012351|Ga0137386_10513172All Organisms → cellular organisms → Bacteria → Acidobacteria863Open in IMG/M
3300012357|Ga0137384_11549844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7512Open in IMG/M
3300012362|Ga0137361_10532914All Organisms → cellular organisms → Bacteria → Acidobacteria1078Open in IMG/M
3300012363|Ga0137390_10602118All Organisms → cellular organisms → Bacteria → Acidobacteria1067Open in IMG/M
3300012582|Ga0137358_10842047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7606Open in IMG/M
3300012917|Ga0137395_10410181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium971Open in IMG/M
3300012923|Ga0137359_10631026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7938Open in IMG/M
3300012925|Ga0137419_11184026All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium639Open in IMG/M
3300012930|Ga0137407_10380565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1304Open in IMG/M
3300012958|Ga0164299_10206371All Organisms → cellular organisms → Bacteria → Acidobacteria1140Open in IMG/M
3300014155|Ga0181524_10056663All Organisms → cellular organisms → Bacteria → Acidobacteria2435Open in IMG/M
3300014155|Ga0181524_10386261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7614Open in IMG/M
3300014155|Ga0181524_10458066All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7547Open in IMG/M
3300014159|Ga0181530_10266127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7912Open in IMG/M
3300014162|Ga0181538_10230287All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71028Open in IMG/M
3300014162|Ga0181538_10249965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7978Open in IMG/M
3300014164|Ga0181532_10327288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7863Open in IMG/M
3300014169|Ga0181531_10577687All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300014201|Ga0181537_10013542All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5946Open in IMG/M
3300014490|Ga0182010_10073007All Organisms → cellular organisms → Bacteria → Acidobacteria1676Open in IMG/M
3300014492|Ga0182013_10061342All Organisms → cellular organisms → Bacteria → Acidobacteria2765Open in IMG/M
3300014501|Ga0182024_11754212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7697Open in IMG/M
3300014638|Ga0181536_10349695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7673Open in IMG/M
3300014654|Ga0181525_10049172All Organisms → cellular organisms → Bacteria → Acidobacteria2415Open in IMG/M
3300014657|Ga0181522_10098334All Organisms → cellular organisms → Bacteria → Acidobacteria1688Open in IMG/M
3300014657|Ga0181522_10776387All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae587Open in IMG/M
3300015168|Ga0167631_1007784All Organisms → cellular organisms → Bacteria → Acidobacteria1569Open in IMG/M
3300015373|Ga0132257_102995857All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300015374|Ga0132255_100068567All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4702Open in IMG/M
3300016341|Ga0182035_10606452All Organisms → cellular organisms → Bacteria → Acidobacteria946Open in IMG/M
3300017823|Ga0187818_10584278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7504Open in IMG/M
3300017925|Ga0187856_1151726All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7872Open in IMG/M
3300017927|Ga0187824_10061341All Organisms → cellular organisms → Bacteria → Acidobacteria1170Open in IMG/M
3300017931|Ga0187877_1364890All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7547Open in IMG/M
3300017936|Ga0187821_10280914All Organisms → cellular organisms → Bacteria → Acidobacteria657Open in IMG/M
3300017937|Ga0187809_10296424All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300017946|Ga0187879_10057010All Organisms → cellular organisms → Bacteria → Acidobacteria2291Open in IMG/M
3300017946|Ga0187879_10123061All Organisms → cellular organisms → Bacteria → Acidobacteria1478Open in IMG/M
3300017948|Ga0187847_10475653All Organisms → cellular organisms → Bacteria → Acidobacteria691Open in IMG/M
3300017972|Ga0187781_11338781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7529Open in IMG/M
3300017995|Ga0187816_10538979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7526Open in IMG/M
3300018006|Ga0187804_10010767All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3135Open in IMG/M
3300018006|Ga0187804_10349108All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300018008|Ga0187888_1379894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7535Open in IMG/M
3300018019|Ga0187874_10265885All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7701Open in IMG/M
3300018020|Ga0187861_10136227All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71146Open in IMG/M
3300018038|Ga0187855_10032741All Organisms → cellular organisms → Bacteria → Acidobacteria3318Open in IMG/M
3300018042|Ga0187871_10860398All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300018047|Ga0187859_10613085All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300018062|Ga0187784_10487555All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300018085|Ga0187772_10154258All Organisms → cellular organisms → Bacteria → Acidobacteria1521Open in IMG/M
3300018085|Ga0187772_11350156All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae528Open in IMG/M
3300018086|Ga0187769_11199976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7574Open in IMG/M
3300018086|Ga0187769_11543680All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300018090|Ga0187770_10318888All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1212Open in IMG/M
3300018090|Ga0187770_11193331All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300018090|Ga0187770_11512617All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7546Open in IMG/M
3300018090|Ga0187770_11547975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae540Open in IMG/M
3300018468|Ga0066662_10240291All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1471Open in IMG/M
3300020010|Ga0193749_1099881All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300020579|Ga0210407_10539185All Organisms → cellular organisms → Bacteria → Acidobacteria911Open in IMG/M
3300020580|Ga0210403_11238691All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300020581|Ga0210399_10083442All Organisms → cellular organisms → Bacteria → Acidobacteria2599Open in IMG/M
3300020581|Ga0210399_10507982All Organisms → cellular organisms → Bacteria → Acidobacteria1002Open in IMG/M
3300020582|Ga0210395_11343892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300020582|Ga0210395_11348792All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300021178|Ga0210408_11459293All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300021180|Ga0210396_11358700All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300021181|Ga0210388_10142014All Organisms → cellular organisms → Bacteria → Acidobacteria2082Open in IMG/M
3300021181|Ga0210388_10149043All Organisms → cellular organisms → Bacteria → Acidobacteria2032Open in IMG/M
3300021181|Ga0210388_10645194All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300021181|Ga0210388_10936912All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300021405|Ga0210387_11824666All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300021407|Ga0210383_10776279All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300021420|Ga0210394_10662443All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300021474|Ga0210390_10043356All Organisms → cellular organisms → Bacteria → Acidobacteria3684Open in IMG/M
3300021474|Ga0210390_10732531All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300021474|Ga0210390_10759546All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7805Open in IMG/M
3300021475|Ga0210392_11290692All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300021477|Ga0210398_11020048All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300021478|Ga0210402_11381462All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300021560|Ga0126371_12897494All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300022731|Ga0224563_1009053All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300022734|Ga0224571_103708All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300024331|Ga0247668_1078137All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300025412|Ga0208194_1046362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7674Open in IMG/M
3300025432|Ga0208821_1030352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71095Open in IMG/M
3300025453|Ga0208455_1046687All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7934Open in IMG/M
3300025898|Ga0207692_10490755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300025903|Ga0207680_10071682All Organisms → cellular organisms → Bacteria → Acidobacteria2148Open in IMG/M
3300025905|Ga0207685_10170910All Organisms → cellular organisms → Bacteria → Acidobacteria1000Open in IMG/M
3300025910|Ga0207684_11617452All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300025916|Ga0207663_11550910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300025934|Ga0207686_10951493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae695Open in IMG/M
3300026023|Ga0207677_11174562All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300026067|Ga0207678_11295034All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300026116|Ga0207674_10555256All Organisms → cellular organisms → Bacteria → Acidobacteria1109Open in IMG/M
3300026294|Ga0209839_10288633All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300026328|Ga0209802_1305597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300026334|Ga0209377_1027523All Organisms → cellular organisms → Bacteria2772Open in IMG/M
3300026514|Ga0257168_1022927All Organisms → cellular organisms → Bacteria → Acidobacteria1301Open in IMG/M
3300026532|Ga0209160_1350667All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300026552|Ga0209577_10723846All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300027011|Ga0207740_1040401All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300027050|Ga0209325_1050638All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300027370|Ga0209010_1004585All Organisms → cellular organisms → Bacteria2880Open in IMG/M
3300027439|Ga0209332_1067934All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300027587|Ga0209220_1143902All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300027604|Ga0208324_1143379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7653Open in IMG/M
3300027641|Ga0208827_1079809All Organisms → cellular organisms → Bacteria → Acidobacteria1015Open in IMG/M
3300027660|Ga0209736_1115990All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300027669|Ga0208981_1156464All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300027745|Ga0209908_10120177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7667Open in IMG/M
3300027812|Ga0209656_10258695All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300027824|Ga0209040_10437976All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300027825|Ga0209039_10330376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7596Open in IMG/M
3300027826|Ga0209060_10396847All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300027855|Ga0209693_10281547All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300027889|Ga0209380_10480341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7726Open in IMG/M
3300027898|Ga0209067_10375637All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300027905|Ga0209415_10955104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7576Open in IMG/M
3300027908|Ga0209006_11143065All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300027911|Ga0209698_10083448All Organisms → cellular organisms → Bacteria2705Open in IMG/M
3300027911|Ga0209698_10452318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7999Open in IMG/M
3300028800|Ga0265338_10979471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7573Open in IMG/M
3300028828|Ga0307312_10719690All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300028906|Ga0308309_11244511All Organisms → cellular organisms → Bacteria → Acidobacteria641Open in IMG/M
3300029916|Ga0302148_1187267All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300029943|Ga0311340_10015643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9592Open in IMG/M
3300029943|Ga0311340_10949588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7711Open in IMG/M
3300029951|Ga0311371_10120646All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4107Open in IMG/M
3300029987|Ga0311334_11156515All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300030007|Ga0311338_10185096All Organisms → cellular organisms → Bacteria → Acidobacteria2423Open in IMG/M
3300030041|Ga0302274_10190727All Organisms → cellular organisms → Bacteria → Acidobacteria1019Open in IMG/M
3300030044|Ga0302281_10246785All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7730Open in IMG/M
3300030045|Ga0302282_1109702All Organisms → cellular organisms → Bacteria → Acidobacteria1129Open in IMG/M
3300030051|Ga0302195_10186171All Organisms → cellular organisms → Bacteria → Acidobacteria967Open in IMG/M
3300030058|Ga0302179_10034089All Organisms → cellular organisms → Bacteria → Acidobacteria2357Open in IMG/M
3300030503|Ga0311370_10017267All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae11160Open in IMG/M
3300030520|Ga0311372_12124441All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300030524|Ga0311357_10713273All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7910Open in IMG/M
3300030659|Ga0316363_10363977All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300030760|Ga0265762_1042756All Organisms → cellular organisms → Bacteria → Acidobacteria891Open in IMG/M
3300030815|Ga0265746_1062019Not Available537Open in IMG/M
3300031057|Ga0170834_105348521All Organisms → cellular organisms → Bacteria → Acidobacteria3651Open in IMG/M
3300031233|Ga0302307_10707670All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7505Open in IMG/M
3300031234|Ga0302325_10332321All Organisms → cellular organisms → Bacteria2433Open in IMG/M
3300031235|Ga0265330_10512156All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300031236|Ga0302324_103569887All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7503Open in IMG/M
3300031250|Ga0265331_10489798All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7553Open in IMG/M
3300031344|Ga0265316_11200858All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae525Open in IMG/M
3300031708|Ga0310686_118089107All Organisms → cellular organisms → Bacteria → Acidobacteria966Open in IMG/M
3300031715|Ga0307476_10480174All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300031718|Ga0307474_11343522All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7564Open in IMG/M
3300031740|Ga0307468_100657935All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300031753|Ga0307477_10148353All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1636Open in IMG/M
3300031753|Ga0307477_10831681All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300031754|Ga0307475_10786177All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300031823|Ga0307478_10010139All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6457Open in IMG/M
3300031823|Ga0307478_11269888All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300032180|Ga0307471_100020554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4821Open in IMG/M
3300032180|Ga0307471_103052797All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300032205|Ga0307472_100321470All Organisms → cellular organisms → Bacteria → Acidobacteria1255Open in IMG/M
3300032205|Ga0307472_101610806All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300032805|Ga0335078_11584478All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7726Open in IMG/M
3300032828|Ga0335080_11404222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7694Open in IMG/M
3300032898|Ga0335072_10798459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae903Open in IMG/M
3300033158|Ga0335077_11963995All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300033433|Ga0326726_11215368All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7733Open in IMG/M
3300033433|Ga0326726_11956255All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7571Open in IMG/M
3300033805|Ga0314864_0004420All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA72555Open in IMG/M
3300033983|Ga0371488_0037403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3177Open in IMG/M
3300034820|Ga0373959_0131485All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds8.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.16%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.45%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog4.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.26%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.90%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.90%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.55%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.19%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.19%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.19%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.48%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.13%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.77%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.06%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.06%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.06%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.06%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.06%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.06%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.71%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.35%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.35%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.35%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.35%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.35%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.35%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.35%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.35%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.35%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.35%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.35%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.35%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.35%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.35%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.35%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.35%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.35%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.35%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.35%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011003Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022731Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4EnvironmentalOpen in IMG/M
3300022734Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3Host-AssociatedOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027011Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes)EnvironmentalOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027669Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030045Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12712J15308_1008568423300001471Forest SoilYRLFDVGGTIGLAGMGLVVIVFSLKNTVRLYCEERIAQ*
JGI12635J15846_1021215033300001593Forest SoilPRVHVLGGYYKLFDVGGAIGLAGMTVTLIFFTAQNTVRLYCEERIAK*
C688J18823_1059690313300001686SoilRLFDVGGMIGLLGMSITVIFFTMQNTLRLYREERISR*
JGI12627J18819_1024875633300001867Forest SoilYRLFDIGGAIGLAGMTLMLIAFTAKNGXRLYREERIP*
JGI24752J21851_102976713300001976Corn, Switchgrass And Miscanthus RhizosphereHPMVFHGRYRLFDVGGAIGLVGMAMMLIAVTAKNTARLYGEERIG*
JGIcombinedJ26739_10027621533300002245Forest SoilDIGGAIGLAGMSLIVVFFTLQNTARLYREEKIPQ*
Ga0062387_10011198133300004091Bog Forest SoilLGILGGEYRLFDVGGTIGLAGMGLMVLFFTLQNTRRLYREERITR*
Ga0062389_10200377623300004092Bog Forest SoilVFGDEYRLFDMGGAIGLAGMGLMLVVFTIENTVRLYREERIPQ*
Ga0062589_10108127233300004156SoilWHPMVFHGRYRLFDVGGAIGLVGMAMMLIAVTAKNTARLYGEERIG*
Ga0062388_10018036213300004635Bog Forest SoilGDEYRLFDMGGAIGLAGMGLMLVVFTIENTVRLYREERIPQ*
Ga0070666_1015377613300005335Switchgrass RhizosphereHGRYRLFDVGGAVGLAGMAAMLIFFTVRNTRRLYAEERIR*
Ga0070661_10055079633300005344Corn RhizosphereFRWQTILHGHYRLFDFGGAIGIAGMSAMLIFFTIKNIVRLYQEERIA*
Ga0070692_1100565623300005345Corn, Switchgrass And Miscanthus RhizosphereHGRYRLFDVGGAIGLAGMSTMLIFFTAKNTYRLYQEEKLP*
Ga0070674_10081138613300005356Miscanthus RhizospherePMIFHGRYRLFDVGGAVGLAGMAAMLIFFTVRNTRRLYAEERIR*
Ga0070714_10132989023300005435Agricultural SoilLGGQYRLFDVGGVIGLAGMTIMLGFFTAQNTVRLYREERISQ*
Ga0070710_1014013953300005437Corn, Switchgrass And Miscanthus RhizosphereTILHGHYRLFDFGGAIGIAGMSAMLVFFTIKNIVRLYQEERIA*
Ga0070708_10002885213300005445Corn, Switchgrass And Miscanthus RhizosphereMVLAGRYRLFDVGGAIGLTGMSLMLVTLTARNTYRLYLEERIP*
Ga0066681_1029119633300005451SoilHFVGGQYRLFDVGGVIGLAGMTIMLVFFTLQNTVRLYREERISQ*
Ga0073909_1026035313300005526Surface SoilERFRLFDVGGAAGIAGMAAMLVFFTVRNTIRLYNEERIQ*
Ga0066692_1056186223300005555SoilFRWAWVIHGRYRLFDVGGGIGLAVMIVMLVAVSLKNTVRLYREERIG*
Ga0066704_1082537013300005557SoilVHFVGGQYRLFDVGGVIGLAGMTIMLVFFTLQNTVRLYREERISQ*
Ga0066703_1014679733300005568SoilRLFRLFDIGGAIGLAGMGLMVVVFTMQNTIRLYREERIPQ*
Ga0066702_1001877813300005575SoilLFDVGGVIGLAGMTIMLVFFTLQNTVRLYREERISQ*
Ga0068863_10189171713300005841Switchgrass RhizosphereLFDIGGAIGLVGMSAMVIFFTIRNTRRLYAEERIR*
Ga0070766_1036753623300005921SoilYRLFDIGGAIGLAVMLLLLVAVSLKNTVRLYREERIS*
Ga0070766_1065512713300005921SoilVIHGRYRLFDIGGAIGLALMLLMLIVVCVKNTVRLYGEERVS*
Ga0070766_1076735413300005921SoilYRLFDLGGAIGLAGMALMVFIFTAQNTVRLYREERIAK*
Ga0066795_1022699823300005938SoilRWAWVIHGRYRLFDIGGAIGLAVMLLMLLVVSLKNTVRLYREERVS*
Ga0066790_1053650423300005995SoilGGRYRLFDVGGSIGLAGMALMVVAFTLQNTVRLYREERLPQ*
Ga0075023_10007613833300006041WatershedsYHPMVFHGQYRLFDVGGSVGLIGMGAMLIFFTVRNTRRLYREERIR*
Ga0075023_10054440823300006041WatershedsVLKGHYRLFDIGGTCGLVGMGLMVVFFTARNTYRLYQQERVQ*
Ga0075028_10070089913300006050WatershedsLFRWAWVIHGHYRLFDIGGAIGLAGMTAMLIAVSLKNTIRLYREERIG*
Ga0075029_10007044443300006052WatershedsLYHPMVFHGHYRLFDVGGAVGLVGMSAMLIFFTVRNACRLYAEERIR*
Ga0075029_10007201213300006052WatershedsWKPMVHFLGGIYRLFDVGGAIGLAGMGLMVVVFTLQNTIRLYREDRIPQ*
Ga0075029_10021492733300006052WatershedsLRLFDIGGAIGLAGMSLMLLVFTGQNTARLYREERIPQ*
Ga0075017_10027532233300006059WatershedsIHGHYRLFDIGGAIGLAGMTAMLIFFSLKNTVCLYREERIE*
Ga0075017_10057093433300006059WatershedsFDIAGAIGLAGMTAMLIVFSLKNTVRLYREERIG*
Ga0075017_10115611323300006059WatershedsHRRFRLFDVGGVIGLAGMALMLVVVCVKNTVRLYREERI*
Ga0075019_1026636623300006086WatershedsLAIGNLAVFRWAWVIHGRYRLFDVGGAVGLVVMVLMLIVVTLKNTVRLYREERIR*
Ga0075019_1029373013300006086WatershedsLFDVGGAIGIAGMAAMVIFATAQNTARLYREERIAR*
Ga0075019_1045156633300006086WatershedsFDIGGAIGLAGMSLMLLVFTGQNTARLYREERIPQ*
Ga0075019_1046967113300006086WatershedsIGNLALFRWAWVIHGRYRLFDIAGAIGLAGMTAMLIVFSLKNTVRLYREERIG*
Ga0075015_10039031233300006102WatershedsPMVFHGQYRLFDVGGTVGLIGMSAMLIFFTVRNTTRLYREERIR*
Ga0075030_10024806313300006162WatershedsHYRLFDVGGAIGLGGMLLMFVVVTLKNTVRLYREERIR*
Ga0075030_10044628333300006162WatershedsFDIGGAIGLAGMLLMLVVVSLKNTVRLYREERIS*
Ga0075030_10096656633300006162WatershedsVVGNLALFRWDWVIHGGYRLFDVGGAIGLAGMVLMLAVVCVKNTLRLYREERIV*
Ga0070715_1020606333300006163Corn, Switchgrass And Miscanthus RhizospherePMVFHGHFRLFDVGGAIGLVGMTAMLIFFTVRNTRRLYLEERIR*
Ga0075018_1040861113300006172WatershedsLLYHPMVFHGHYRLFDIGGAVGLVGMAAMLIFFTVRNTRRLYMEERIR*
Ga0070716_10001804243300006173Corn, Switchgrass And Miscanthus RhizosphereLINTILPGHYRLFDMGGVIGLAGMSTMLVFFTVRNTRRLYLQERIR*
Ga0075014_10004741013300006174WatershedsLVIGNLALFRWAWVIHGRYRLFDIAGAIGLAGMTAMLIVFSLKNTVRLYREERIG*
Ga0075014_10045543013300006174WatershedsIGNVALLYRPMVFHGRYRLFDAGGAVGLAGMSAMLIFFTAHNIRRLYLTERIR*
Ga0070712_10155394313300006175Corn, Switchgrass And Miscanthus RhizosphereVHFLGGQYRLFDVGGVIGLAGMTMMLGFFTAQNTLRLYREERISQ*
Ga0070765_10003387253300006176SoilYRLFDIGGIIGLIGMSMMLTYFTGRNTYRLYMEEWIS*
Ga0097621_10009654443300006237Miscanthus RhizosphereHYRLFDIGGAIGLVGMSAMVIFFTIRNTRRLYAEERIR*
Ga0097621_10218422023300006237Miscanthus RhizosphereRLFDVGGVIGLAGMAVMVVFFTLQNTARLYREERISK*
Ga0075021_1006539113300006354WatershedsFDVGGVVGLIGMSVMLIFFTARNTRRLYFAELIR*
Ga0075021_1054831213300006354WatershedsGNLALFRWAWVIHGRYRLFDIGGAIGLAGMAAMLIAVSLKNTSRLYREERIG*
Ga0068871_10136256233300006358Miscanthus RhizosphereSRYRLFDIGGAIGLIGMGLMVVVFTLQNTIRLYREERIPQ*
Ga0079222_1066897913300006755Agricultural SoilIHGQYRLFDVGGAIGLIGMAAMLLAVTTKNTVRLYREERIR*
Ga0066653_1020763333300006791SoilGRYRLFDVGGLVGLAGMTVILLFFTARNTRRLYVEERLS*
Ga0066660_1106639813300006800SoilLFDIGGAIAIAGMAAMAIIAATRHGARLYREERV*
Ga0075425_10211943123300006854Populus RhizosphereGKYRLFDVGGAIGLAGMSLMLVFFTAQNTMRLYREERISR*
Ga0075424_10281295013300006904Populus RhizosphereHGHYRLFDVGGVIGFIGMSAMLIFFTARNTRRLYLAERIQ*
Ga0075436_10027842333300006914Populus RhizosphereGRYRLFDVGGAVGLAGMAAMLIFFTVRNTRRLYVEERIR*
Ga0075435_10040340013300007076Populus RhizosphereHGKYRLFDVGGTIGLLGMSAMLVFFTARNAYRLYVEERIK*
Ga0099791_1028306413300007255Vadose Zone SoilVGNLAMFRWAWVIHGRYRLFDIGGAIGLAVMPLMLVAVSLKNTVRLYREERI*
Ga0099795_1009101533300007788Vadose Zone SoilLFDVGGTIGLTGMALILICFTLQNAERLYREERIAR*
Ga0102924_134595113300007982Iron-Sulfur Acid SpringRLFDVGGAIGLAGMDVMVAVFSLQNPIRLYREERISQ*
Ga0099829_1049729823300009038Vadose Zone SoilGILAMFRWAWVIHGRYRLFDIGGAIGLAVMLLMLVAVSLKNTVRLYREERIS*
Ga0111539_1046634153300009094Populus RhizosphereFDVGGAIGLVGMAMMLIAVTAKNTARLYGEERIG*
Ga0066709_10026755913300009137Grasslands SoilRLFDFGGAIGIAGMTAMLLFFTAKNTTRLYREERIR*
Ga0105242_1128752533300009176Miscanthus RhizosphereFDVGGIVGIVGMSGMLVFFTARNIRRLYCEEQVR*
Ga0116225_135051913300009524Peatlands SoilPTVPFPGRHFRLFDGGGAIGLPGMALILICFTVQNTLRLYREEKVHQ*
Ga0116136_111139913300009547PeatlandRWAWVIHARYRLFDIGGAIGLAGMLLMLVVVSLKNTVRLYRAERIR*
Ga0105238_1101028133300009551Corn RhizosphereALMLHPMVFHGRYRLFDVGGAIGLVGMAMMLIAVTAKNTARLYGEERIG*
Ga0116119_109355633300009629PeatlandFDIGGAIGLAGMTLMLICFTLQNTLRLYREEKVTP*
Ga0116113_115612123300009638PeatlandHFIGGKYRLFDMGGAIGLAGMGSMVVVFTAQNTVRLYREERIAQ*
Ga0116106_107113223300009645PeatlandVAGNLALFRWAWVIHGRYRLFDIGGAIGLAGMLLMLVVVSLKNTVRLYREERIR*
Ga0116135_105169633300009665PeatlandYRLFDIGGAIGLAVMLLMLIVVCAKNTARLYREERIS*
Ga0116224_1024351523300009683Peatlands SoilRYRLFDIGGAIGLAGMLLMLVVVTLKNTARLYREERIR*
Ga0116217_1081952323300009700Peatlands SoilYYKLFDLGGTIGLAGMALIVVFFTAQNTLRLYREEKVHQ*
Ga0116130_116256613300009762PeatlandLFDIGGAIGLAGMLLMLVVVTLKNTARLYREERIS*
Ga0126374_1077720433300009792Tropical Forest SoilHFRLFDVGGAIAIVGMVTMLTFFTARNIVRLYREEPLT*
Ga0126380_1187952023300010043Tropical Forest SoilGGKQRLFDVGGAIGLAGMGLMLVFFTTRNTIRLYREERISR*
Ga0126373_1085511133300010048Tropical Forest SoilCGGKYRLFDVGGAIGLAGMSLMLVVFTVQNTIRLYREERISR*
Ga0074044_1065485523300010343Bog Forest SoilGRYRLFDIGGAIGLVGMVLMLIVASIKNTVRLYREERIR*
Ga0126376_1282992123300010359Tropical Forest SoilLFDIGGAVGLAGMILIFVVFTLKNTARLYREERLP*
Ga0126372_1068577233300010360Tropical Forest SoilFDIGGAIGLVGMLLMLIFFSLKNTVRLYREERIP*
Ga0126378_1114077133300010361Tropical Forest SoilVVLEHRYRLFDVGGSIGVLGMAGMLLAVTVRNTYRLYQEERLQ*
Ga0126379_1048670633300010366Tropical Forest SoilVLHHQYRLFDIGGAIGLAGMTLMLIAFTLKNGYRLYQEERIS*
Ga0134125_1280802223300010371Terrestrial SoilLYRPMIFHGRYRLFDVGGAVGLAGMAAMLIFFTVRNTRRLYVEERIR*
Ga0134128_1280493413300010373Terrestrial SoilAHYRLFDIGGVIGLIGMTAMLIFFTARNTYRLYHEEKVQ*
Ga0126381_10219377623300010376Tropical Forest SoilGRYRLFDFGGAVGIAGMAAMLLFFTAKNIARLYREERIR*
Ga0136449_10081670513300010379Peatlands SoilPTVHFLGGHYRLFDVGGAIGLSGMALILICFTLQNTLRLYREEKAPSDR*
Ga0136449_10290931613300010379Peatlands SoilGRYRLFDIGGAIGLAGMLLMLAVVTLKNTVRLYREERIL*
Ga0134124_1137820913300010397Terrestrial SoilRYRLFDIGGVIGLIGMTAVLIFFTARNTYRLYHEEKVQ*
Ga0138514_10003829113300011003SoilVLFNPVFRGPYRLFDVGGCIGLVGMLAMLIFFTMRNTRRLYMQERIR*
Ga0137393_1004425063300011271Vadose Zone SoilWKPRVHLPGGDYKLFDVGGAIGLAGMAVMVVFFTTQNTVRLYREERIAK*
Ga0137393_1023671713300011271Vadose Zone SoilRVVFLGEQYRLFDVGGTIGLIGMTLILVFFTAQNTVRLYRQARIEP*
Ga0137393_1125739613300011271Vadose Zone SoilLAILRWAWVIHGRYRLFDIGGAIGLAVMLLMLVVVSLKNTVRLYREERIG*
Ga0137388_1070536513300012189Vadose Zone SoilGRYRPFDIGGAIGLAVMLLMLVVVSLKNTVRLYREERMG*
Ga0137388_1121694623300012189Vadose Zone SoilYRLFDVGGAIGLAVMLLMLVVLSAKNTVRLYREERMG*
Ga0137399_1078919243300012203Vadose Zone SoilFDVGGVIGLIGMSAMVIFFTARNTRRLYLEEKIR*
Ga0137376_1071511333300012208Vadose Zone SoilFLGGQYRLFDVGGTIGLIGMTLILVFFTAHNTVRLYRQASIEP*
Ga0137376_1100731813300012208Vadose Zone SoilGHYRLFDVGGVIGLIGMSAMLIFFTARNTRRLYLAERIQ*
Ga0137378_1174052723300012210Vadose Zone SoilHERYRLFDIGGAIGLAGMAVMLIFFSLKNTIRLYREERVG*
Ga0150985_12298204133300012212Avena Fatua RhizosphereFGGKYRLFDVGGASGLAGMSLMLLVFTVQNTMRLYREERISQ*
Ga0137386_1051317213300012351Vadose Zone SoilAVHLFGSGYRLFDIGGAIGLIGMGLMVVVFTLQNTIRLYREERIPQ*
Ga0137384_1154984423300012357Vadose Zone SoilWAWVIHGRYRLFDIGGAIGSAVMIVMLVAVSLKNTVRLYREERIG*
Ga0137361_1053291413300012362Vadose Zone SoilWVIHGHYRLFDVGGAVGLAGMVLTLIFVTTKNILRLYREERIG*
Ga0137390_1060211813300012363Vadose Zone SoilRLFDVGGAIGLAGMALILVFFTAQNTLRLYRQERISK*
Ga0137358_1084204723300012582Vadose Zone SoilHYRLFDVGGVIGLAVMLLMLVVVSLKNTIRLYREEKIS*
Ga0137395_1041018113300012917Vadose Zone SoilGRQYRLFDVGGTIGLTGMALILICFTLQNAERLYREERIAR*
Ga0137359_1063102623300012923Vadose Zone SoilRWAWVIHGRYRLLDIGGAIGLAVMLLMLVVVSVKNTVRLYREERIR*
Ga0137419_1118402623300012925Vadose Zone SoilFDVGGAVGLAGMTAMLLFFTAQNTARLYREERIAR*
Ga0137407_1038056533300012930Vadose Zone SoilHRPYRLFDVGGMIGLAGMAVMLLWITATNTARLYREERIS*
Ga0164299_1020637133300012958SoilGHFRLFDVGGAIGIAGMAAMLLVFTVKNTVRLYNEERIR*
Ga0181524_1005666313300014155BogRYRLFDIGGAIGLAAMLLMLVVVTLKNTVRLYREERIG*
Ga0181524_1038626123300014155BogLFDIGGAIGLAVMMLMLVVVSVKNTVRLYREERIL*
Ga0181524_1045806613300014155BogRLFDIGGAIGLAGMLLMLVVVSLKNTVRLYREERIL*
Ga0181530_1026612723300014159BogWAWVIHGRYRLFDIGGAIGLGGMLLMLVVVALKNTVRLYREERIS*
Ga0181538_1023028713300014162BogGRFRLFDVGGAIGLAVMTLMLVVVSVKNTIRLYREERIL*
Ga0181538_1024996513300014162BogWVIHGRYRLFDIGGAIGLAGMLLMLVVATLKNTFRLYREERIR*
Ga0181532_1032728823300014164BogRLFDIGGAIGLAGMLLMLAVVTLKNTVRLYREERIR*
Ga0181531_1057768723300014169BogKYRVFDVGGGIGLGGMTLMAIVFTAQNTVRLYREERIPQ*
Ga0181537_1001354273300014201BogWVIHGRYRLFDIGGAIGLAGMVLMLFVVTLKNTIRLYREERIR*
Ga0182010_1007300713300014490FenLALFRWAWVIHGRYRLFDIGGAIGLAGMLLMLVVVTLKNTVRLYREERIR*
Ga0182013_1006134243300014492BogLALFRWAWVIHGRYRLFDIGGAIGLAGMLLMLVVVAMKNTVRLYREERIG*
Ga0182024_1175421213300014501PermafrostRYRLFDIAGVIGLAGMVVMLVVVCVRNTARLYREERIL*
Ga0181536_1034969523300014638BogRYRVFDIGGAIGLAGMVLMLLAVTLKNTVRLYREERIV*
Ga0181525_1004917243300014654BogHFLGGEYRLFDVGGASGLAGMGLMLVVFTIENTVRLYREERIAQ*
Ga0181522_1009833413300014657BogRVHFLGGEYRLFDVGGAIGLAGMALMLICFTLQNTQRLYRDERVSE*
Ga0181522_1077638723300014657BogEYRLFDVGGAVGLAGMGLMLVVFTIKNTVRLFREERITP*
Ga0167631_100778413300015168Glacier Forefield SoilHGHYRLFDIGGAIGLVGMGVMLIFFTAKNTYRLYQEEKL*
Ga0132257_10299585723300015373Arabidopsis RhizosphereFDVGGVIGLIGMSAMLVFFTVRNTRRLYVAERIR*
Ga0132255_10006856763300015374Arabidopsis RhizosphereALLYHPMIFHGRYRLFDVGGAVGLAGMAAMLIFFTVRNTWRLYAEERIR*
Ga0182035_1060645213300016341SoilPTVHLWGGQYRLFDVGGAIGLAGMGLMVVVFTLQNTRRLYCEERIAQ
Ga0187818_1058427823300017823Freshwater SedimentYRLFDIGGAIGLAGMLLMLAVVSVKNTVRLYREERIL
Ga0187856_115172623300017925PeatlandGNLALFRWAWVIHARYRLFDIGGAIGLAGMLLMLVVVSLKNTVRLYRAERIR
Ga0187824_1006134133300017927Freshwater SedimentYRLFDIGGAIGLIGMGLMVVVFTLQNTIRLYREEKFLE
Ga0187877_136489013300017931PeatlandWVIHGRYRLFDIGGAIGLAGMLLMLEVVTLRNAVRLYRDERIR
Ga0187821_1028091413300017936Freshwater SedimentMVHVFGRIYPLFDVGGAIGLAGMAAMVVVFTVQNSIRLYREERIRR
Ga0187809_1029642423300017937Freshwater SedimentLFDIGGAIGIAGMTLMILAFTAQNTLRLYREEGIRR
Ga0187879_1005701033300017946PeatlandRLFDIGGAIGLAVMMLMLVVVSVKNTVRLYREERIL
Ga0187879_1012306113300017946PeatlandAGNLAMFRWAWVIHGRFRLFDVGGAIGLAVMTLMLVVVSVKNTIRLYREERIL
Ga0187847_1047565333300017948PeatlandGAYYRLFDIGGIVGLAGMALMLVFFTAQNTVRLYREERIAK
Ga0187781_1133878113300017972Tropical PeatlandKYRLFDIGGAVGIAGMVAMLVFFSMKNTFRLYREERIG
Ga0187816_1053897923300017995Freshwater SedimentWAWVIHGRYRLFDIGGAIGLAGMLLMLAVVSVKNTVRLYREERIL
Ga0187804_1001076743300018006Freshwater SedimentYRLFDVGGAMGLAGMGLMVVVFTVQNTTRLYREERISQ
Ga0187804_1034910823300018006Freshwater SedimentTFRLLDVGGAVGLAGMSLMVMAFTLQNTIRLYREERIPQ
Ga0187888_137989423300018008PeatlandWVIHGRYRLFDIGGAIGLAGMLLMLVVATLKNTFRLYREERIR
Ga0187874_1026588513300018019PeatlandLFRWAWVIHGRYRLFDIGGAIGLAGMLLMLVVVSLKNTVRLYRAERIR
Ga0187861_1013622733300018020PeatlandGNLALFRWAWVIHGRYRLFDIGGAIGLAGMLLMLVVVTLKNTVRLYREERIR
Ga0187855_1003274123300018038PeatlandLFDVGGAIGLAGMALMPTCFTLQNTLRLSREEQVSE
Ga0187871_1086039823300018042PeatlandIHGRYRLFDIGGAIGLAGMLLMLVVVTLKNTARLYREERIS
Ga0187859_1061308523300018047PeatlandFDIGGIVGLASMALMLVFFTAQNTVRLYREERIAK
Ga0187784_1048755533300018062Tropical PeatlandFGGPHRLFDVGGAVGLAGMGLMLVTFTTQNIVRLYREERIPQ
Ga0187772_1015425833300018085Tropical PeatlandLFDIGGAIGLVGMVAMLIFFSLKNTARLYREERIG
Ga0187772_1135015613300018085Tropical PeatlandLFDVGGAIGLAGMTLMLVVFTVQNTARLYREERIEE
Ga0187769_1119997613300018086Tropical PeatlandRWAWVIHGKYRLFDIGGMIALVGMALMLAFFSLKNTVRLYREDRDCSLPSE
Ga0187769_1154368023300018086Tropical PeatlandGRVYRLFDVGGVIGIIGMIAMVIAFTIKNTIRLYREDRIAE
Ga0187770_1031888813300018090Tropical PeatlandFRLFDVGGGIGLAGMTLMVIFFTLKNTLRLYREERLPE
Ga0187770_1119333113300018090Tropical PeatlandQYRLFDVGGTIGLAGMGLMLVAVTVQNTVRLYREERIPQ
Ga0187770_1151261723300018090Tropical PeatlandRWARVIHGRYRLFDIGGAIGLAGMVLMLIVFSLKNTLRLYREERIG
Ga0187770_1154797523300018090Tropical PeatlandFDVGGAIGLAGMSLMVIFFTIKNTARLYREERISR
Ga0066662_1024029133300018468Grasslands SoilVALWHGSGLVHGHFRLFDVGGAIGIAGMTAMLVFFTARNTIRLYDQERIR
Ga0193749_109988113300020010SoilVLFLGGQYRLFDVGGTIGLIGMTLILVFFTAQNTVRLYRQASIEP
Ga0210407_1053918513300020579SoilPYRLFDVGGTVGLIGMTLILVFFTAQNTVRLYREASIEP
Ga0210403_1123869113300020580SoilIYRLFDVGGAIGLAGMGLMVFVFTLENTIRLYREERIPQ
Ga0210399_1008344213300020581SoilFWKPRVHFLGGYYKLFDVGGAVGLVGMAAMLVFFTGQNGLRLYREERVVQ
Ga0210399_1050798233300020581SoilGAHYKLFDVGGAIGLAGMALMVVFFTAQNTLRLYREERIAK
Ga0210395_1134389213300020582SoilHGNYRLFDIGGAIGLIGMSAMLIFFSVRNTYRLYMQERIP
Ga0210395_1134879223300020582SoilDGQYRLFDVGGAIGLAGMGLMVVVFTLQNTVRLYREERIPQ
Ga0210408_1145929313300021178SoilFHGHYRLFDVGGLVGLIGMFAMLIFFTQRNTRRLYLQERIQ
Ga0210396_1135870013300021180SoilFDVGGAIGLAGMGLMLVAFTLQNTIRLYREERIPQ
Ga0210388_1014201413300021181SoilTTLFRSGAIGLVGMSLMLIVQTAKNTLRLYREERIK
Ga0210388_1014904333300021181SoilWVIHGRYRLFDIGGAIGLAVMLLMLVVVCVKNTVRLYREERIS
Ga0210388_1064519433300021181SoilLKGHYRLFDIGGIVGLIGMSMMLTYFTGRNTYRLYMEEWIS
Ga0210388_1093691213300021181SoilKPQVHFLGGYYRLFDLGGAIGLAGMALMVFLFTVQNTVRLYREERIAK
Ga0210387_1182466613300021405SoilYRLFDVGGAIGLAGMGLMVVAFSLQNTIRLYREERIPQ
Ga0210383_1077627933300021407SoilLLWKPSVHFIGREYRLFDVGGTIGLGGMGLMLTCFTLENALRLYREEKVSE
Ga0210394_1066244313300021420SoilFGESYRLFDIGGAIGLAGMASMAVVFTVQNTIRLYREERIPQ
Ga0210390_1004335673300021474SoilMFHFFGGEYRLFDVGGAIGLAGMGLMLMVFTIESTGRLYREERITQ
Ga0210390_1073253133300021474SoilFDLGGAIGLAGMALMVVFFTAQNTVRLYREERIPK
Ga0210390_1075954623300021474SoilAFGWAWVIHGRYRLFDIGGAIGLAVMLLMLVVVCVKNTVRLYREEKIQ
Ga0210392_1129069223300021475SoilREGQYRLFDIGGAIGLVGMAAMLVWFTLKNGYRLYCEERV
Ga0210398_1102004813300021477SoilFDVGGASGLAGMGLMLVVFTIENTVRLYREERIAQ
Ga0210402_1138146223300021478SoilSVHFLGAHYRLFDMGGAIGLAGMAVMVVFFTAQNALRLAREERISR
Ga0126371_1289749413300021560Tropical Forest SoilLFDIGGAIGIVGMAAMLIFFTARNIVRLYREERLV
Ga0224563_100905313300022731SoilWKPMFHFLGGEYRLFDVGGAIGLAGMGLMLMVFTIESTGRLYREERITQ
Ga0224571_10370813300022734RhizosphereGGQCKLFDVGGAIGLAGMALIVIFFTGQNTLRLYREERIAR
Ga0247668_107813723300024331SoilYRLFDVGGAIGLAGMGLMLVVFTLQNTGRLYREERIPQ
Ga0208194_104636213300025412PeatlandILLATGTLFVFRWPSVIHDRYRLLDIGGAIGLAIMLVMLVVCTLQNTIRLYKAERIL
Ga0208821_103035213300025432PeatlandIHGRYRLFDIGGAIGLAGMLLMLVVVSLKNTVRLYREERIR
Ga0208455_104668713300025453PeatlandHRRYRLFDIGGAIGLAVMMLMLVVVSVKNTVRLYREERIL
Ga0207692_1049075533300025898Corn, Switchgrass And Miscanthus RhizosphereRLFDVGGAIGFIGMSAMLIFFTARNTVRLYRQEPILEEQI
Ga0207680_1007168243300025903Switchgrass RhizosphereHGRYRLFDVGGAVGLAGMAAMLIFFTVRNTRRLYAEERIR
Ga0207685_1017091033300025905Corn, Switchgrass And Miscanthus RhizospherePMVFHGHFRLFDVGGAIGLVGMTAMLIFFTVRNTRRLYLEERIR
Ga0207684_1161745213300025910Corn, Switchgrass And Miscanthus RhizosphereIWNGRYRLFDVGGIAGLIGMCAMLIFFTARNTYRLYEEERIPW
Ga0207663_1155091023300025916Corn, Switchgrass And Miscanthus RhizosphereERFRLFDVGGAAGIAGMAAMLVFFTVRNTIRLYNEERIQ
Ga0207686_1095149313300025934Miscanthus RhizosphereYRPMIFHGRYRLFDVGGAVGLAGMAAMLIFFTVRNTRRLYVEERIR
Ga0207667_1073321033300025949Corn RhizosphereFRWQTILHGHYRLFDFGGAIGIAGMSAMLVFFTIKNIVRLYQEERIA
Ga0207677_1117456213300026023Miscanthus RhizosphereHGRYRLFDVGGAIGLAGMSTMLIFFTAKNTYRLYQEEKLP
Ga0207678_1129503423300026067Corn RhizosphereVFHGQFRLFDVGGAIGLIGMAAMLIAVTAKNTVRLYCEERIR
Ga0207674_1055525633300026116Corn RhizosphereFHGRYRLFDVGGAVGLAGMAAMLIFFTVRNTRRLYVEERIR
Ga0209839_1028863323300026294SoilGGRYRLFDVGGSIGLAGMALMVVAFTLQNTVRLYREERLPQ
Ga0209802_130559713300026328SoilYRLFDVGGAIGLTGMSLMLVILTARNTYRLYLEERIQ
Ga0209377_102752313300026334SoilWAWVIHGRYRLFDVGGGIGLAVMIVMLVAVSLKNTVRLYREERIG
Ga0257168_102292713300026514SoilGNLAILRWAWVIHGRYRLFDIGGAIGLAVMLLMLVVVSLKNTVRLYREERIG
Ga0209160_135066723300026532SoilMVLGGRYRLFDVGGAIGLTGMSLMLVILAARNTYRLYLEERIP
Ga0209577_1072384613300026552SoilQYRLFDIGGTIGLAGMTLMVIFFTIKNGYRLYCEERIR
Ga0207740_104040123300027011Tropical Forest SoilLFGGRYRLFDVGGAIGLAGMSLMAVAFTLQNTIRLYREERIPQ
Ga0209325_105063813300027050Forest SoilRYRIFDVGGTIGLLGMCLMIIFFTMRNSYRLYREEHLR
Ga0209010_100458553300027370Forest SoilFWKPLVHLFGKQFRLFDIGGAIGALGMALMIVFFTLQNTVRLYCEERIA
Ga0209332_106793423300027439Forest SoilRYRLFDVGGAIGLAGMALMVVVFTLQNTVRLYREERIPQ
Ga0209220_114390213300027587Forest SoilFDVGGAIGLAGMASMAVVFTVKNTLRLYREERIPQ
Ga0208324_114337923300027604Peatlands SoilLFDIGGAIGLAGMLLMLAVVTLKNTVRLYREERIR
Ga0208827_107980913300027641Peatlands SoilRLFDVGGAIGLTGMMSMVIFFTAQNTAQLYREERVSR
Ga0209736_111599013300027660Forest SoilRKARVHLVGGDYKLFDVGGAIGLVGMAAMLLFFTAQNAARLYREERIIK
Ga0208981_115646433300027669Forest SoilLFDIGGAIGLAVMLLMLVAVSLKNTVRLYREERIS
Ga0209908_1012017723300027745Thawing PermafrostMCIRDRAWVMHGRYRLFDVGGATGLVGMAAMLAVVTVKNTVRLHREERIR
Ga0209656_1025869533300027812Bog Forest SoilFDVGGAIGLAGMGLMTVVFTVQNTVRLYREERIPQ
Ga0209040_1043797623300027824Bog Forest SoilGNYRLFDLGGAIGLAGMALMVVFFTAQNTMRLYREERIAEERIAK
Ga0209039_1033037623300027825Bog Forest SoilRLFDIGGAIGLAGMLLMLVVVSLKNTVRLYREERIG
Ga0209060_1039684713300027826Surface SoilHFLGGYYRLFDVGGVIGLIGMSAMVVFFTVQNTIRLYREERISNGE
Ga0209693_1028154733300027855SoilWKPQVHFLGGYYKLFDLGGTIAMAGMSLMFLFFTAQTTVRLYREERIDEQIARERMAK
Ga0209380_1048034113300027889SoilWVMHERYRLFDVGGATGLVGMAAMLVVVTAKNTVRLYREERV
Ga0209067_1037563733300027898WatershedsFDIGGAIGLAGMSLMLLVFTGQNTARLYREERIPQ
Ga0209415_1095510413300027905Peatlands SoilLALFRWAWVIHGRYRLFDIGGAIGLAGMLLMLAVVTLKNTVRLYREERIR
Ga0209006_1114306513300027908Forest SoilRVHFLGEDYRLFDLGGAVGLAGMALMVVFFTAQNTVRLYREERIAK
Ga0209698_1008344813300027911WatershedsLFDIGGAIGLAGMLLMLVVVSLKNTVRLYREERIS
Ga0209698_1045231813300027911WatershedsLVVGNLALFRWDWVIHGGYRLFDVGGAIGLAGMVLMLAVVCVKNTLRLYREERIV
Ga0265338_1097947113300028800RhizosphereLFDIGGAIGLAGMGLMLAVVCVKNTVRLYREERIL
Ga0307312_1071969013300028828SoilLFDLGGIVGLLGMTGMIAFFTVKNGRRLYREERIR
Ga0308309_1124451113300028906SoilHPMVFHGHFRLFDVGGAVGLVGMAVMLIFFTVRNTRRLYMEEQIR
Ga0302148_118726713300029916BogLALLWKPRAHFLGGEYKLFDIGGTIGLAGMAAMLLVFTAQNTIRLCREERITK
Ga0311340_1001564313300029943PalsaVHFLGSEYRLFDVGGAIGLAAMALILVFFTGQNTVRLYCEERIPK
Ga0311340_1094958823300029943PalsaGRYRLFDIGGAIGLAGMALMLAAVSLKNTVRLYREERIS
Ga0311371_1012064613300029951PalsaLLSVGSVAAFRWAWVMHGRYRLFDVGGATGLVGMAAMLAVVTVKNTVRLHREERIR
Ga0311334_1115651513300029987FenLFDVGGTIAIAGMTAMLIFFTARNTWRLYHEEPIR
Ga0311338_1018509633300030007PalsaVGNVAAFRWAWVMHGRYRLFDVGGATGLVGMAAMLAVVTVKNTVRLYREERIR
Ga0302274_1019072713300030041BogLFDIGGIVGLAGMALMLVFFTAQNTVRLYREERIAK
Ga0302281_1024678513300030044FenGRFRVFDLGGAIGLAVMAVMLLIVCLKNTVRLYREERI
Ga0302282_110970213300030045FenLWKPRVHFLGGFYKLFDVGGAIGLAGMALMLVFFTGQNTVRLYREEGINR
Ga0302195_1018617133300030051BogEYKLFDIGGTIGLAGMAAMLLVFTAQNTIRLCREERITK
Ga0302179_1003408913300030058PalsaLWKPQVHFLGSEYRLFDVGGAIGLAAMALILVFFTGQNTVRLYCEERIPK
Ga0311370_10017267143300030503PalsaWVLLSVGNVAAFRWAWVMHGRYRLFDVGGATGLVGMAAMLAVVTVKNTVRLHREERIR
Ga0311372_1212444113300030520PalsaWKPQVHFLGSEYRLFDVGGAIGLAAMALILVFFTGQNTVRLYREERIPK
Ga0311357_1071327323300030524PalsaLSVGNVAAFRWAWVMHGRYRLFDVGGATGLVGMAAMLAVVTVKNTVRLHREERIR
Ga0316363_1036397723300030659Peatlands SoilLWKPTVHFLGGHYRLFDVGGAIGLSGMALILICFTLQNTLRLYREEKAPSDR
Ga0265762_104275623300030760SoilFLGGEYRLFDVGGASGLAGMGLMLLVFTIENTVRLYREERIAQ
Ga0265746_106201923300030815SoilFDVGGEIGLAGMGLMLVVFTIENTVRLYREERIAQ
Ga0170834_10534852113300031057Forest SoilRLFDVGGAIGLVGMGLMVVAFTVENTIRLYREERIAQ
Ga0302307_1070767013300031233PalsaGNVAAFRWAWVMHGRYRLFDVGGATGLVGMAAMLAVVTVKNTVRLHREERIR
Ga0302325_1033232113300031234PalsaLFDVGGAIGLAGMTLMLIFFTGQNTARLYGEERIAQ
Ga0265330_1051215623300031235RhizosphereIYRLFDVGGAIGLAGMGLMVVVFTLQNTIRLYREERIPQ
Ga0302324_10356988723300031236PalsaLAAFHWAWVMGGRFRLFDLGGAIGLAVMAVMLLVVCWKNTVRLYREERIL
Ga0265331_1048979813300031250RhizosphereVLRWAWVIHGRYRLFDIGGAIGLAGMGLMLAVVCVKNTVRLYREERIL
Ga0265316_1120085813300031344RhizosphereFDVGGAIGLAGMGLMVVVFTLQNTIRLYREERIPQ
Ga0310686_11808910713300031708SoilQPRPFPLGVVIHGRYRLFDIGGAIGLAGMLLMLVVATLKNTIRLYREERIR
Ga0307476_1048017413300031715Hardwood Forest SoilFLLFDVGGVIGLAGMGLMVVAFTVQNTMRLYREERVVQ
Ga0307474_1134352223300031718Hardwood Forest SoilVGNLAMFRWAWVIHGRHRLFDIGGAIGLAVMLLMLVAVSLKNTIRLYREERIS
Ga0307468_10065793533300031740Hardwood Forest SoilVFHGHFSLFDVGGAIGLFGMTAMLMFFSVRNTRRLYLEERIR
Ga0307477_1014835313300031753Hardwood Forest SoilWKPMVSFQGERYRLFDLAGAIGLIGMGITLIFFTLQNTVRLYGEDRISPS
Ga0307477_1083168113300031753Hardwood Forest SoilARFRLFDVGGAVGLAGMGLIIVVFTLRNTLRLYREESLPR
Ga0307475_1078617713300031754Hardwood Forest SoilFLGAHYRLFDVGGAIGLAGMTLILIFFTAQNTARLYREERIVE
Ga0307478_1001013983300031823Hardwood Forest SoilRYRLCDIGGAIGLVGMSLMLIVSSLRNTIRLYREERIG
Ga0307478_1126988823300031823Hardwood Forest SoilMHFIGGEYRLFDVGGAIGLGGMGLMLTCFTLENALRLYREEKVSE
Ga0306926_1008022963300031954SoilQLFDIGGVIGLAGMSLMVVYFTAKNGYRLYCEERIR
Ga0307471_10002055413300032180Hardwood Forest SoilHHQYRLFDIGGVIGLAGMTLMLIAFTLKNGYRLYQEERI
Ga0307471_10305279723300032180Hardwood Forest SoilPMVHFVGGIYRLFDVGGAIGLSGMSLMVVVFTVQNTLRLYREERIAQ
Ga0307472_10032147013300032205Hardwood Forest SoilHGHYRLFDVGGAVGLIGMSVMLIFFTARNTRRLYAEERIR
Ga0307472_10161080613300032205Hardwood Forest SoilLVDISGICGRVGMSLMLVFFTARNTYRLYVQERIS
Ga0335078_1158447813300032805SoilALFRWAWVIHGRYRLFDIGGAIGLVGMSLMLIAASLKNTIRLYREERIK
Ga0335080_1140422213300032828SoilGRHRLFDIAGSVGLAGMVVMLGVVCVRNTARLYREERIG
Ga0335072_1079845913300032898SoilFDVGGAIGLAGMALMVIVFTLQNTIRLYREERIPQ
Ga0335077_1196399513300033158SoilYRLFDVGGTIGLVGMGFMVVFFTVKNTIRLYREERIPQ
Ga0326726_1121536813300033433Peat SoilAWVIHGRYRLFDVGGAIGLAGMAAMLIFFSLKNTVRLYREERIG
Ga0326726_1195625513300033433Peat SoilRLFDIGGAIGLAGMILMLIVFTLKNTVRLYREERIG
Ga0314864_0004420_2_1093300033805PeatlandLFDIGGAIGLAGMALMLAVFALKNTVRLYREERVG
Ga0371488_0037403_3044_31723300033983Peat SoilVIHGRFRLFDVGGAIGLAGMLTMLIVVSVKNTVRLYREERIG
Ga0373959_0131485_11_1423300034820Rhizosphere SoilMIFHGRYRLFDVGGAVGLAGMAAMLIFFTVRNTRRLYVEERIR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.