Basic Information | |
---|---|
Family ID | F012004 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 284 |
Average Sequence Length | 39 residues |
Representative Sequence | MPETVPQNGGYMIAAYIVAGVILLGYALSLYLRARRSLRA |
Number of Associated Samples | 194 |
Number of Associated Scaffolds | 284 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 85.16 % |
% of genes near scaffold ends (potentially truncated) | 11.62 % |
% of genes from short scaffolds (< 2000 bps) | 67.25 % |
Associated GOLD sequencing projects | 168 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.648 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (21.831 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.380 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.831 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 284 Family Scaffolds |
---|---|---|
PF01578 | Cytochrom_C_asm | 36.62 |
PF02602 | HEM4 | 9.51 |
PF03379 | CcmB | 6.69 |
PF01379 | Porphobil_deam | 3.52 |
PF00005 | ABC_tran | 3.17 |
PF00072 | Response_reg | 2.11 |
PF13432 | TPR_16 | 2.11 |
PF02801 | Ketoacyl-synt_C | 2.11 |
PF00490 | ALAD | 1.76 |
PF07719 | TPR_2 | 1.41 |
PF13466 | STAS_2 | 1.06 |
PF03900 | Porphobil_deamC | 1.06 |
PF16177 | ACAS_N | 0.70 |
PF00230 | MIP | 0.70 |
PF00515 | TPR_1 | 0.70 |
PF03364 | Polyketide_cyc | 0.35 |
PF02922 | CBM_48 | 0.35 |
PF02080 | TrkA_C | 0.35 |
PF00486 | Trans_reg_C | 0.35 |
PF01494 | FAD_binding_3 | 0.35 |
PF00557 | Peptidase_M24 | 0.35 |
PF00528 | BPD_transp_1 | 0.35 |
PF01940 | DUF92 | 0.35 |
PF01613 | Flavin_Reduct | 0.35 |
PF13193 | AMP-binding_C | 0.35 |
PF13490 | zf-HC2 | 0.35 |
COG ID | Name | Functional Category | % Frequency in 284 Family Scaffolds |
---|---|---|---|
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 9.51 |
COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 6.69 |
COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 4.58 |
COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 1.76 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.70 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.70 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.35 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.35 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.35 |
COG1836 | Cytidylyltransferase family enzyme | General function prediction only [R] | 0.35 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.35 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.65 % |
Unclassified | root | N/A | 0.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002557|JGI25381J37097_1009730 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
3300002558|JGI25385J37094_10002268 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 6372 | Open in IMG/M |
3300002560|JGI25383J37093_10030978 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
3300002561|JGI25384J37096_10101914 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300002561|JGI25384J37096_10237436 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
3300002568|C688J35102_119297627 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 669 | Open in IMG/M |
3300002886|JGI25612J43240_1003639 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
3300002907|JGI25613J43889_10009834 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 2643 | Open in IMG/M |
3300002908|JGI25382J43887_10005201 | All Organisms → cellular organisms → Bacteria | 6173 | Open in IMG/M |
3300003319|soilL2_10012253 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300003319|soilL2_10012254 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300003319|soilL2_10072476 | All Organisms → cellular organisms → Bacteria | 4761 | Open in IMG/M |
3300004062|Ga0055500_10026620 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300004114|Ga0062593_103339136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 515 | Open in IMG/M |
3300004463|Ga0063356_100357538 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
3300005166|Ga0066674_10061750 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
3300005166|Ga0066674_10139621 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300005167|Ga0066672_10087803 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
3300005171|Ga0066677_10418126 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300005171|Ga0066677_10631004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 605 | Open in IMG/M |
3300005172|Ga0066683_10000398 | All Organisms → cellular organisms → Bacteria | 13438 | Open in IMG/M |
3300005175|Ga0066673_10036219 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
3300005175|Ga0066673_10493502 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005176|Ga0066679_10015643 | All Organisms → cellular organisms → Bacteria | 3897 | Open in IMG/M |
3300005178|Ga0066688_10957677 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005180|Ga0066685_10018989 | All Organisms → cellular organisms → Bacteria | 4078 | Open in IMG/M |
3300005184|Ga0066671_10198381 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300005186|Ga0066676_10102708 | All Organisms → cellular organisms → Bacteria | 1737 | Open in IMG/M |
3300005336|Ga0070680_100010997 | All Organisms → cellular organisms → Bacteria | 6995 | Open in IMG/M |
3300005341|Ga0070691_10577156 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300005440|Ga0070705_100249784 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
3300005440|Ga0070705_101117605 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300005444|Ga0070694_100003891 | All Organisms → cellular organisms → Bacteria | 8924 | Open in IMG/M |
3300005444|Ga0070694_100329426 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1177 | Open in IMG/M |
3300005445|Ga0070708_100088869 | All Organisms → cellular organisms → Bacteria | 2810 | Open in IMG/M |
3300005445|Ga0070708_100667946 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300005446|Ga0066686_10015181 | All Organisms → cellular organisms → Bacteria | 4154 | Open in IMG/M |
3300005450|Ga0066682_10141590 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300005451|Ga0066681_10553021 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300005454|Ga0066687_10059745 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
3300005526|Ga0073909_10140851 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300005526|Ga0073909_10600235 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005536|Ga0070697_100348291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1279 | Open in IMG/M |
3300005537|Ga0070730_10001187 | All Organisms → cellular organisms → Bacteria | 25613 | Open in IMG/M |
3300005549|Ga0070704_100087430 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
3300005552|Ga0066701_10671336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 625 | Open in IMG/M |
3300005553|Ga0066695_10032586 | All Organisms → cellular organisms → Bacteria | 3022 | Open in IMG/M |
3300005553|Ga0066695_10048099 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
3300005553|Ga0066695_10664182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
3300005554|Ga0066661_10058986 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2215 | Open in IMG/M |
3300005555|Ga0066692_10054693 | All Organisms → cellular organisms → Bacteria | 2232 | Open in IMG/M |
3300005556|Ga0066707_10002029 | All Organisms → cellular organisms → Bacteria | 8036 | Open in IMG/M |
3300005556|Ga0066707_10002742 | All Organisms → cellular organisms → Bacteria | 7236 | Open in IMG/M |
3300005556|Ga0066707_10016424 | All Organisms → cellular organisms → Bacteria | 3820 | Open in IMG/M |
3300005558|Ga0066698_10146628 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
3300005559|Ga0066700_10455750 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300005561|Ga0066699_10210899 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300005566|Ga0066693_10479716 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
3300005569|Ga0066705_10084226 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1862 | Open in IMG/M |
3300005569|Ga0066705_10332259 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300005569|Ga0066705_10345779 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300005574|Ga0066694_10343248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 708 | Open in IMG/M |
3300005575|Ga0066702_10361821 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300005576|Ga0066708_10156748 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
3300005576|Ga0066708_10255525 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300005586|Ga0066691_10173579 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
3300005598|Ga0066706_11520112 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
3300005713|Ga0066905_100004455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5738 | Open in IMG/M |
3300005713|Ga0066905_101015755 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300005842|Ga0068858_101790081 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300005876|Ga0075300_1047595 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300006031|Ga0066651_10012778 | All Organisms → cellular organisms → Bacteria | 3451 | Open in IMG/M |
3300006031|Ga0066651_10447625 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300006034|Ga0066656_10021894 | All Organisms → cellular organisms → Bacteria | 3435 | Open in IMG/M |
3300006046|Ga0066652_100223003 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
3300006046|Ga0066652_100451573 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300006794|Ga0066658_10309706 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300006796|Ga0066665_11178024 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 584 | Open in IMG/M |
3300006797|Ga0066659_10054402 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
3300006844|Ga0075428_100001087 | All Organisms → cellular organisms → Bacteria | 28949 | Open in IMG/M |
3300006844|Ga0075428_100089585 | All Organisms → cellular organisms → Bacteria | 3356 | Open in IMG/M |
3300006845|Ga0075421_100054738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5046 | Open in IMG/M |
3300006845|Ga0075421_100274840 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
3300006845|Ga0075421_100519302 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
3300006846|Ga0075430_100883650 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300006852|Ga0075433_10036325 | All Organisms → cellular organisms → Bacteria | 4243 | Open in IMG/M |
3300006852|Ga0075433_10053470 | All Organisms → cellular organisms → Bacteria | 3521 | Open in IMG/M |
3300006852|Ga0075433_10170730 | All Organisms → cellular organisms → Bacteria | 1935 | Open in IMG/M |
3300006852|Ga0075433_11945173 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
3300006854|Ga0075425_100012128 | All Organisms → cellular organisms → Bacteria | 9226 | Open in IMG/M |
3300006854|Ga0075425_100367134 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
3300006854|Ga0075425_102782885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
3300006865|Ga0073934_10103199 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
3300006871|Ga0075434_100763775 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300006914|Ga0075436_100371483 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300006918|Ga0079216_10151779 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300007255|Ga0099791_10021282 | All Organisms → cellular organisms → Bacteria | 2790 | Open in IMG/M |
3300007265|Ga0099794_10028155 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300009012|Ga0066710_100027074 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 6561 | Open in IMG/M |
3300009012|Ga0066710_100317917 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
3300009089|Ga0099828_10003737 | All Organisms → cellular organisms → Bacteria | 10664 | Open in IMG/M |
3300009090|Ga0099827_10009751 | All Organisms → cellular organisms → Bacteria | 6120 | Open in IMG/M |
3300009090|Ga0099827_11503152 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300009094|Ga0111539_10330195 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
3300009156|Ga0111538_10060491 | All Organisms → cellular organisms → Bacteria | 4833 | Open in IMG/M |
3300009156|Ga0111538_11678454 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300009597|Ga0105259_1043569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 989 | Open in IMG/M |
3300009678|Ga0105252_10003372 | All Organisms → cellular organisms → Bacteria | 6172 | Open in IMG/M |
3300009804|Ga0105063_1012696 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300010043|Ga0126380_11634698 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
3300010047|Ga0126382_12048149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
3300010159|Ga0099796_10516882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
3300010301|Ga0134070_10184448 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300010320|Ga0134109_10013519 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
3300010320|Ga0134109_10220857 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300010325|Ga0134064_10086124 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1015 | Open in IMG/M |
3300011443|Ga0137457_1052401 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300012096|Ga0137389_10270124 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1433 | Open in IMG/M |
3300012096|Ga0137389_10626353 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300012198|Ga0137364_10632394 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300012199|Ga0137383_10135891 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
3300012199|Ga0137383_10693347 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300012199|Ga0137383_11022624 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
3300012200|Ga0137382_10023646 | All Organisms → cellular organisms → Bacteria | 3571 | Open in IMG/M |
3300012200|Ga0137382_10118414 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
3300012200|Ga0137382_10622626 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300012201|Ga0137365_10151806 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
3300012202|Ga0137363_10194999 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1621 | Open in IMG/M |
3300012203|Ga0137399_10145859 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
3300012203|Ga0137399_10572872 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300012203|Ga0137399_10995053 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300012204|Ga0137374_10902830 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300012206|Ga0137380_10156764 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
3300012208|Ga0137376_10874046 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300012208|Ga0137376_10995509 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300012208|Ga0137376_11125071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 671 | Open in IMG/M |
3300012211|Ga0137377_11912843 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
3300012285|Ga0137370_10004597 | All Organisms → cellular organisms → Bacteria | 6180 | Open in IMG/M |
3300012351|Ga0137386_10858409 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300012358|Ga0137368_10032337 | All Organisms → cellular organisms → Bacteria | 4712 | Open in IMG/M |
3300012360|Ga0137375_10121291 | All Organisms → cellular organisms → Bacteria | 2611 | Open in IMG/M |
3300012361|Ga0137360_10416087 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300012362|Ga0137361_10481477 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300012685|Ga0137397_10017928 | All Organisms → cellular organisms → Bacteria | 4950 | Open in IMG/M |
3300012917|Ga0137395_10692635 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300012918|Ga0137396_10220750 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300012923|Ga0137359_11029226 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300012924|Ga0137413_11224514 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
3300012944|Ga0137410_10735476 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300012976|Ga0134076_10169431 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300012976|Ga0134076_10341857 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300014157|Ga0134078_10034163 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300015054|Ga0137420_1268189 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300015245|Ga0137409_10311514 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
3300015254|Ga0180089_1042593 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300015357|Ga0134072_10321293 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300017656|Ga0134112_10015318 | All Organisms → cellular organisms → Bacteria | 2585 | Open in IMG/M |
3300017656|Ga0134112_10251586 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 701 | Open in IMG/M |
3300017656|Ga0134112_10266632 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300017659|Ga0134083_10334186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 649 | Open in IMG/M |
3300017997|Ga0184610_1012694 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
3300017997|Ga0184610_1027442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1575 | Open in IMG/M |
3300018028|Ga0184608_10045201 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1715 | Open in IMG/M |
3300018054|Ga0184621_10018160 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
3300018056|Ga0184623_10059008 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
3300018071|Ga0184618_10063831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1371 | Open in IMG/M |
3300018076|Ga0184609_10014772 | All Organisms → cellular organisms → Bacteria | 2993 | Open in IMG/M |
3300018084|Ga0184629_10070966 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1645 | Open in IMG/M |
3300018084|Ga0184629_10492266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 639 | Open in IMG/M |
3300018431|Ga0066655_10034696 | All Organisms → cellular organisms → Bacteria | 2490 | Open in IMG/M |
3300018433|Ga0066667_10018071 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3662 | Open in IMG/M |
3300018433|Ga0066667_11191573 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300018433|Ga0066667_11774151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
3300018433|Ga0066667_11774993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 557 | Open in IMG/M |
3300018468|Ga0066662_10050319 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2650 | Open in IMG/M |
3300018468|Ga0066662_10111403 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
3300018482|Ga0066669_10041726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2821 | Open in IMG/M |
3300018482|Ga0066669_10074120 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
3300018482|Ga0066669_10079459 | All Organisms → cellular organisms → Bacteria | 2202 | Open in IMG/M |
3300018482|Ga0066669_10135902 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1781 | Open in IMG/M |
3300018482|Ga0066669_10207175 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300018482|Ga0066669_10233741 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1439 | Open in IMG/M |
3300018482|Ga0066669_10448212 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1107 | Open in IMG/M |
3300018482|Ga0066669_11038144 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300018482|Ga0066669_11555741 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 602 | Open in IMG/M |
3300019360|Ga0187894_10523719 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300019877|Ga0193722_1003498 | All Organisms → cellular organisms → Bacteria | 3843 | Open in IMG/M |
3300019879|Ga0193723_1000275 | All Organisms → cellular organisms → Bacteria | 19621 | Open in IMG/M |
3300019879|Ga0193723_1000513 | All Organisms → cellular organisms → Bacteria | 15294 | Open in IMG/M |
3300019883|Ga0193725_1056571 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 991 | Open in IMG/M |
3300020022|Ga0193733_1174631 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 567 | Open in IMG/M |
3300021081|Ga0210379_10391793 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300021086|Ga0179596_10171793 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300021344|Ga0193719_10153449 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300021418|Ga0193695_1028164 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
3300024330|Ga0137417_1070594 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300025325|Ga0209341_10266516 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300025885|Ga0207653_10000060 | All Organisms → cellular organisms → Bacteria | 84774 | Open in IMG/M |
3300025885|Ga0207653_10098359 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1032 | Open in IMG/M |
3300025910|Ga0207684_10259360 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1500 | Open in IMG/M |
3300025910|Ga0207684_10917350 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 736 | Open in IMG/M |
3300025912|Ga0207707_11259043 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300025917|Ga0207660_10205708 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
3300025917|Ga0207660_10259671 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300025917|Ga0207660_11698324 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300025918|Ga0207662_10109980 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
3300025942|Ga0207689_10844706 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 773 | Open in IMG/M |
3300025965|Ga0210090_1063405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
3300025988|Ga0208141_1014102 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300026285|Ga0209438_1000769 | All Organisms → cellular organisms → Bacteria | 10176 | Open in IMG/M |
3300026285|Ga0209438_1121918 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 727 | Open in IMG/M |
3300026295|Ga0209234_1017361 | All Organisms → cellular organisms → Bacteria | 2725 | Open in IMG/M |
3300026296|Ga0209235_1000338 | All Organisms → cellular organisms → Bacteria | 23022 | Open in IMG/M |
3300026296|Ga0209235_1009313 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5457 | Open in IMG/M |
3300026296|Ga0209235_1226299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
3300026296|Ga0209235_1256046 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
3300026300|Ga0209027_1044096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1678 | Open in IMG/M |
3300026305|Ga0209688_1094310 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300026312|Ga0209153_1037362 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
3300026324|Ga0209470_1018900 | All Organisms → cellular organisms → Bacteria | 3781 | Open in IMG/M |
3300026324|Ga0209470_1159377 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 987 | Open in IMG/M |
3300026327|Ga0209266_1002522 | All Organisms → cellular organisms → Bacteria | 11466 | Open in IMG/M |
3300026327|Ga0209266_1087974 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1392 | Open in IMG/M |
3300026335|Ga0209804_1247122 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 674 | Open in IMG/M |
3300026528|Ga0209378_1009501 | All Organisms → cellular organisms → Bacteria | 5971 | Open in IMG/M |
3300026528|Ga0209378_1013683 | All Organisms → cellular organisms → Bacteria | 4769 | Open in IMG/M |
3300026528|Ga0209378_1256960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
3300026530|Ga0209807_1020890 | All Organisms → cellular organisms → Bacteria | 3188 | Open in IMG/M |
3300026530|Ga0209807_1122456 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300026530|Ga0209807_1162668 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300026536|Ga0209058_1003493 | All Organisms → cellular organisms → Bacteria | 12691 | Open in IMG/M |
3300026537|Ga0209157_1022095 | All Organisms → cellular organisms → Bacteria | 3882 | Open in IMG/M |
3300026538|Ga0209056_10008537 | All Organisms → cellular organisms → Bacteria | 10497 | Open in IMG/M |
3300026538|Ga0209056_10037144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4517 | Open in IMG/M |
3300026540|Ga0209376_1202499 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300026548|Ga0209161_10575462 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
3300027573|Ga0208454_1001021 | All Organisms → cellular organisms → Bacteria | 12697 | Open in IMG/M |
3300027573|Ga0208454_1015335 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
3300027643|Ga0209076_1109913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 780 | Open in IMG/M |
3300027655|Ga0209388_1078083 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300027671|Ga0209588_1000470 | All Organisms → cellular organisms → Bacteria | 10352 | Open in IMG/M |
3300027691|Ga0209485_1105961 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300027738|Ga0208989_10245405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 584 | Open in IMG/M |
3300027857|Ga0209166_10005249 | All Organisms → cellular organisms → Bacteria | 8866 | Open in IMG/M |
3300027875|Ga0209283_10005070 | All Organisms → cellular organisms → Bacteria | 7548 | Open in IMG/M |
3300027882|Ga0209590_10001297 | All Organisms → cellular organisms → Bacteria | 9372 | Open in IMG/M |
3300027882|Ga0209590_10046593 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
3300027882|Ga0209590_10290024 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1049 | Open in IMG/M |
3300027903|Ga0209488_10044274 | All Organisms → cellular organisms → Bacteria | 3269 | Open in IMG/M |
3300027909|Ga0209382_10099752 | All Organisms → cellular organisms → Bacteria | 3404 | Open in IMG/M |
3300027909|Ga0209382_10128371 | All Organisms → cellular organisms → Bacteria | 2952 | Open in IMG/M |
3300027909|Ga0209382_10414522 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300027909|Ga0209382_10880804 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300028145|Ga0247663_1080769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
3300028536|Ga0137415_10028764 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5475 | Open in IMG/M |
3300028536|Ga0137415_10208422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1772 | Open in IMG/M |
3300028536|Ga0137415_10376007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1224 | Open in IMG/M |
3300028718|Ga0307307_10137312 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300028819|Ga0307296_10440535 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300028884|Ga0307308_10095030 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1418 | Open in IMG/M |
3300028884|Ga0307308_10232112 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300030997|Ga0073997_10719414 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300031170|Ga0307498_10051559 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300031199|Ga0307495_10166814 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 582 | Open in IMG/M |
3300031455|Ga0307505_10016897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3449 | Open in IMG/M |
3300031716|Ga0310813_10005383 | All Organisms → cellular organisms → Bacteria | 7911 | Open in IMG/M |
3300031720|Ga0307469_10012544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4247 | Open in IMG/M |
3300031720|Ga0307469_11214206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 713 | Open in IMG/M |
3300031740|Ga0307468_100968182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 745 | Open in IMG/M |
3300031820|Ga0307473_10389196 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300031820|Ga0307473_10852335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
3300031820|Ga0307473_11267258 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 550 | Open in IMG/M |
3300031965|Ga0326597_10129778 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3034 | Open in IMG/M |
3300031965|Ga0326597_10401081 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300032180|Ga0307471_101482273 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300032180|Ga0307471_101712004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 782 | Open in IMG/M |
3300032180|Ga0307471_101911845 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300032180|Ga0307471_103303138 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300032205|Ga0307472_100893517 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300032770|Ga0335085_10022001 | All Organisms → cellular organisms → Bacteria | 9071 | Open in IMG/M |
3300033407|Ga0214472_10014215 | All Organisms → cellular organisms → Bacteria | 8272 | Open in IMG/M |
3300033813|Ga0364928_0009579 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1773 | Open in IMG/M |
3300034178|Ga0364934_0070339 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.83% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.01% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.97% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.99% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.58% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.23% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.87% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.17% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.11% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.76% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.76% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.41% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.06% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.70% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.70% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.70% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.35% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.35% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.35% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.35% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.35% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.35% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.35% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.35% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.35% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.35% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025965 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025988 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030997 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10097302 | 3300002557 | Grasslands Soil | MPEAVPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP* |
JGI25385J37094_100022683 | 3300002558 | Grasslands Soil | MLEQVPQNGGYMIAAYSVAAGILIGYAVSLYLRARRSLRA* |
JGI25383J37093_100309782 | 3300002560 | Grasslands Soil | MPETIPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA* |
JGI25384J37096_101019142 | 3300002561 | Grasslands Soil | MPETVPQNGGYLVAAYIVVAVILIGYALSLYLRARRSLRA* |
JGI25384J37096_102374362 | 3300002561 | Grasslands Soil | RSDMPETVPQNGGYLVAAYIVVAVILIGYALSLYLRARRSLRA* |
C688J35102_1192976272 | 3300002568 | Soil | MEAWVMPEVPPQNAGYMIAAYIIVAALVAGYALSLYLRARRSLRA* |
JGI25612J43240_10036394 | 3300002886 | Grasslands Soil | MPETVPQNGGYMVAAYIIVAVITVGYTLSLYLRARRSFRA* |
JGI25613J43889_100098345 | 3300002907 | Grasslands Soil | MPETVPQNGGYMVAAYIIVAVIILGYALSLYLRTRRSFRA* |
JGI25382J43887_100052013 | 3300002908 | Grasslands Soil | MPETVPQNGNYMIAAYILVGVILVGYAVSLYLRARRSLRP* |
soilL2_100122532 | 3300003319 | Sugarcane Root And Bulk Soil | MPETVPQNAGYMIAAYVITGTILIGYAVSLYLRARRALRP* |
soilL2_100122542 | 3300003319 | Sugarcane Root And Bulk Soil | MPESIPQNAGYMIAAYIVTGTILVSYAVSLYLRARRALRP* |
soilL2_100724766 | 3300003319 | Sugarcane Root And Bulk Soil | MPETVPQNAGYMIAAYIVTGTIMVAYAVSLYLRARRALRP* |
Ga0055500_100266202 | 3300004062 | Natural And Restored Wetlands | MQSVPQNAGYMIAAYILTGAILLGYTLSLYLRARRSLRS* |
Ga0062593_1033391361 | 3300004114 | Soil | MQTVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP* |
Ga0063356_1003575382 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MQTVPENAGYMIAAYIITGTILIGYAVSLYLRARRALRP* |
Ga0066674_100617503 | 3300005166 | Soil | MPETIPQNGSFMIAAYIVAAVILIGYSLSLYLRARRSLRA* |
Ga0066674_101396213 | 3300005166 | Soil | MPQSIPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA* |
Ga0066672_100878034 | 3300005167 | Soil | MPETVPQNGGYMIAAYIVAGAILVSYALSLYLRARRSLRP* |
Ga0066677_104181262 | 3300005171 | Soil | MPQTPAPPQNGDYMIAAYCIVGAIFILYTLSLYLRARRSLRP* |
Ga0066677_106310042 | 3300005171 | Soil | MPDTVPQNGSYMIAAYILVGVILAGYALLLYLRARRSLRP* |
Ga0066683_1000039811 | 3300005172 | Soil | MPDTVPQNGGYMVGAYVVAAVILISYALSLYLRTRRSLRA* |
Ga0066673_100362195 | 3300005175 | Soil | MPETVPQNGGYMVAAYVVAAVILISYAVSLYLRTRRTLRP* |
Ga0066673_104935022 | 3300005175 | Soil | MPETVPQNGSYMIAAYILVGVILAGYALLLYLRARRSLRP* |
Ga0066679_100156433 | 3300005176 | Soil | MLEQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA* |
Ga0066688_109576772 | 3300005178 | Soil | MPDTVPQNGGYMVAAYVVAAVILISYAVSLYLRTRRSLRP* |
Ga0066685_100189893 | 3300005180 | Soil | MPETIPQNGSFMLAAYIVAAVILIGYSLSLYLRARRSLRA* |
Ga0066671_101983813 | 3300005184 | Soil | MPQTPAPPQNGGYMIAAYCIVGAIFILYTLSLYLRARRSLRP* |
Ga0066676_101027082 | 3300005186 | Soil | MRDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA* |
Ga0070680_10001099711 | 3300005336 | Corn Rhizosphere | MQAPVPQNGGYMIAAYIVTGVIVVGYAVSLYLRARRALRP* |
Ga0070691_105771562 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRALRP* |
Ga0070705_1002497842 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP* |
Ga0070705_1011176052 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEAVPQNAGYMIAAYIIVAVILGGYALSLYLRTRRSLRA* |
Ga0070694_10000389112 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQAAPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA* |
Ga0070694_1003294262 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MQPVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRALRP* |
Ga0070708_1000888694 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEQVPQNGGYLVAAYIVAAGILIGYAVSLYLRARRSLRA* |
Ga0070708_1006679463 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETVPQNGGYMVAAYIVAAVIVISYAVSLYLRTRRSLRP* |
Ga0066686_100151815 | 3300005446 | Soil | MPETIPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA* |
Ga0066682_101415903 | 3300005450 | Soil | MHDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA* |
Ga0066681_105530212 | 3300005451 | Soil | MPQTPAPPQNGGYMIAAYCIVGAIFIVYTLSLYLRARRSLRP* |
Ga0066687_100597453 | 3300005454 | Soil | MPETVPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP* |
Ga0073909_101408512 | 3300005526 | Surface Soil | MPETVPQNAGYMIAAYIIVAVIVGGYALSLYLRARRSLRP* |
Ga0073909_106002352 | 3300005526 | Surface Soil | MPETVPQNASYMIAAYIIAGTILVGYAVSLYLRARRAL |
Ga0070697_1003482912 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEAVPQNAGYMIAAYIIVAVILGGYALSLYLHTRRSLRA* |
Ga0070730_1000118730 | 3300005537 | Surface Soil | MLSDTPQNGGYMIAAYVVAAVILLGYTLSLYLRARRSLRP* |
Ga0070704_1000874302 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPETVPQNAGYMIAAYVITGAILFGYALSLYLRARRSLRP* |
Ga0066701_106713362 | 3300005552 | Soil | MHETVPQNGGYMIAAYIVVAPILIGYALSLYLRARRSLRA* |
Ga0066695_100325864 | 3300005553 | Soil | MPENGTYMIAAYILVGVILVGYALSLYLRTRRSLRP* |
Ga0066695_100480994 | 3300005553 | Soil | MQDVPQNGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP* |
Ga0066695_106641822 | 3300005553 | Soil | MPENGNYMIAAYILVGVILSGYALSLYLRARRSLRP* |
Ga0066661_100589862 | 3300005554 | Soil | MPETVPQNGGYMVAAYVVAAVILLSYAVSLYLRTRRTLRP* |
Ga0066692_100546932 | 3300005555 | Soil | MPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRP* |
Ga0066707_100020297 | 3300005556 | Soil | MPQSIPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA* |
Ga0066707_100027427 | 3300005556 | Soil | MHETVPQNGGYMIAAYIVVAAILIGYALSLYLRARRSLRA* |
Ga0066707_100164242 | 3300005556 | Soil | MPESVPQNGGYMIAAYIVAGAILVSYALSLYLRARRSLRP* |
Ga0066698_101466283 | 3300005558 | Soil | MPENGNYMIAAYILVGVILAGYALSLYLRARRSLRP* |
Ga0066700_104557502 | 3300005559 | Soil | MPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRA* |
Ga0066699_102108993 | 3300005561 | Soil | MPETLPQNGSYMIAAYILVGVILGGYALLLYLRARRSLRP* |
Ga0066693_104797162 | 3300005566 | Soil | MPETVPQNGSYMIAAYILVGLILGGYALLLYLRARRSLRP* |
Ga0066705_100842264 | 3300005569 | Soil | MPETVPQNGGYMVAAYVVAAVILLSYAVSLYLRTRR |
Ga0066705_103322592 | 3300005569 | Soil | MLEQVPQNGGYMVAAYIVAAGILIGYAVSLYLRARRSLRA* |
Ga0066705_103457793 | 3300005569 | Soil | MPETFPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP* |
Ga0066694_103432481 | 3300005574 | Soil | NNWRLWEERSAMHDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA* |
Ga0066702_103618212 | 3300005575 | Soil | MPETVPQNGGYMIAAYIVAAVILISYAVSLYLRTRRTLRP* |
Ga0066708_101567482 | 3300005576 | Soil | MPQSIPQNGGYMIAAYIVAAVILVGYGLSLYLRARRSLRA* |
Ga0066708_102555252 | 3300005576 | Soil | MPETLPQNAGYMIAAYIVVAVIMVGYAASLFQRGRKL* |
Ga0066691_101735793 | 3300005586 | Soil | GMPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRA* |
Ga0066706_115201121 | 3300005598 | Soil | MHETVPQNGGYMIAAYIVVAAILSGYALSLYLRARRSLRA* |
Ga0066905_1000044557 | 3300005713 | Tropical Forest Soil | MPDAVPQNGGFMIAAYVIAAVILGGYALSLYLRARRSLRP* |
Ga0066905_1010157552 | 3300005713 | Tropical Forest Soil | MQAVPQNAGYMIAAYVITGAILLGYTLSLYLRARRSLRP* |
Ga0068858_1017900811 | 3300005842 | Switchgrass Rhizosphere | GGRVMQTVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP* |
Ga0075300_10475952 | 3300005876 | Rice Paddy Soil | MMLPQTPPQNSGYMIAAYVIAGAILLGYTLSLYLRARRSLRP* |
Ga0066651_100127784 | 3300006031 | Soil | MTTQGPPPNSGYMIAAYILVGVILIGYTLSLYLRARRSLRP* |
Ga0066651_104476252 | 3300006031 | Soil | MTPQNGGYMIAAYVVVAAILVGYTLSLYLRARRSLR |
Ga0066656_100218945 | 3300006034 | Soil | MPENGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP* |
Ga0066652_1002230032 | 3300006046 | Soil | MPENGGYMIAAYVVVGAILIGYTLSLYLRARRSFRA* |
Ga0066652_1004515732 | 3300006046 | Soil | MTPQNGGYMIAAYVVVAAILVGYTLSLYLRARRSLRS* |
Ga0066658_103097062 | 3300006794 | Soil | MLQAPAPPQNGGYMIAAYSVAAGILIGYAVSLYLRARRSLRA* |
Ga0066665_111780242 | 3300006796 | Soil | MYDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA* |
Ga0066659_100544025 | 3300006797 | Soil | MPDTVPQNGGYMVGAYVVAAVILISYALSLYLRTRRTLRP* |
Ga0075428_10000108722 | 3300006844 | Populus Rhizosphere | MPESIPQNGGYMIAAYVIVAVILAGYALSLYLRTRRSLRA* |
Ga0075428_1000895855 | 3300006844 | Populus Rhizosphere | MQTVPQNAGYMIAAYVVAGAIVLGYALSLYLRTRRSLRP* |
Ga0075421_1000547384 | 3300006845 | Populus Rhizosphere | MQVPEAVPQNGGYMVAAYIVVAVVILGYALSLYLRTRRSLRP* |
Ga0075421_1002748403 | 3300006845 | Populus Rhizosphere | VPETVPQNAGYMIAAYVIAGAIVLGYALSLYLRARRSLRP* |
Ga0075421_1005193022 | 3300006845 | Populus Rhizosphere | MPESVPQNGGYLIAAYVIVAVILAGYALSLYLRARRSLRA* |
Ga0075430_1008836501 | 3300006846 | Populus Rhizosphere | VPQNAGYMIAAYVIAGAIVLGYALSLYLRARRSLRP* |
Ga0075433_100363252 | 3300006852 | Populus Rhizosphere | MPENGSYMIAAYVLVGVILTGYALSLYLRARRSLRP* |
Ga0075433_100534704 | 3300006852 | Populus Rhizosphere | MHDVPQNGGYMVAAYITVAVILIGYALSLYLRARRSLRA* |
Ga0075433_101707302 | 3300006852 | Populus Rhizosphere | MQAAPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA* |
Ga0075433_119451731 | 3300006852 | Populus Rhizosphere | MPENGSYMIAAYIAVAVIVSGYTLSLYLRTRRSLRP* |
Ga0075425_1000121284 | 3300006854 | Populus Rhizosphere | MLVQTPPPPQNGGYMIAAYILVGAILIGYTVSLYLRARRSLRP* |
Ga0075425_1003671343 | 3300006854 | Populus Rhizosphere | MPENGGYMIAAYIVVGAILSGYTLSLYLRARRSLRA* |
Ga0075425_1027828852 | 3300006854 | Populus Rhizosphere | MPENGGYMIAAYIVVGAILGGYTLSLYLRARRSLRA* |
Ga0073934_101031992 | 3300006865 | Hot Spring Sediment | MPETVPQNAGYMVAAYVVATALLLGYALTLYLRIRKLR* |
Ga0075434_1007637752 | 3300006871 | Populus Rhizosphere | MQATPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA* |
Ga0075436_1003714831 | 3300006914 | Populus Rhizosphere | PQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA* |
Ga0079216_101517792 | 3300006918 | Agricultural Soil | MPETIPQNAGFMIAAYVVAGAIILGYALSLYLRSRKL* |
Ga0099791_100212822 | 3300007255 | Vadose Zone Soil | MPENGNYMIAAYILVGVILVGYALSLYLRARRSLRP* |
Ga0099794_100281555 | 3300007265 | Vadose Zone Soil | MPESVPQNGGYMIAAYILVGVILVGYALSLYLRARRSLRP* |
Ga0066710_1000270743 | 3300009012 | Grasslands Soil | MQDVPQNGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP |
Ga0066710_1003179173 | 3300009012 | Grasslands Soil | MPETIAQNGSFMIAAYIVAAVILIGYSLSLYLRARRSLRA |
Ga0099830_105267351 | 3300009088 | Vadose Zone Soil | MPETVPQNAPYMVAAYVVAAVILLLYTVTLWLRGPKPP |
Ga0099828_100037373 | 3300009089 | Vadose Zone Soil | MPETIPQNGGYMIAAYIVAAVILVGYAISLHLRARRSLRP* |
Ga0099827_100097517 | 3300009090 | Vadose Zone Soil | MPETIPQNGGYMIAAYIVAAVILIGYALSLYLRARRSLRA* |
Ga0099827_115031522 | 3300009090 | Vadose Zone Soil | MPETVPQNGGYLVAAYIVVAVILIGYALSLYLRARRSLRP* |
Ga0111539_103301952 | 3300009094 | Populus Rhizosphere | MQTVPQNAGYMIAAYVIAGAIVLGYALSLYLRTRRSLRP* |
Ga0111538_100604911 | 3300009156 | Populus Rhizosphere | RVMQTVPQNAGYMIAAYVIAGAIVLGYALSLYLRTRRSLRP* |
Ga0111538_116784542 | 3300009156 | Populus Rhizosphere | MQPVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP* |
Ga0105259_10435692 | 3300009597 | Soil | MQAPVPQNAGYMIAAYVITGAILLGYALSLYLRARRSLRS* |
Ga0105252_100033725 | 3300009678 | Soil | MPETVPQNAGYMIAAYVITGVILIGYTLSLYLRARRSLRP* |
Ga0105063_10126961 | 3300009804 | Groundwater Sand | MPETVPQNAGYMVAAYIVAGAILIGYALSLYLRARRSLRA* |
Ga0126380_116346981 | 3300010043 | Tropical Forest Soil | VIQTPPQNGGYMIAAYILVGAILIGYTLSLYLRARRSLRS* |
Ga0126382_120481492 | 3300010047 | Tropical Forest Soil | MPDAVPQNGGFMIAAYVIAAVILGGYALSLYLRARRSLRPQS |
Ga0099796_105168822 | 3300010159 | Vadose Zone Soil | MPETVPQNGSYMIAAYILVGVILVGYALSLYLRARRSLRP* |
Ga0134070_101844482 | 3300010301 | Grasslands Soil | MHDVPQNGGFMIAAYITVALILIGYALSLYLRARRSLRA* |
Ga0134109_100135193 | 3300010320 | Grasslands Soil | MPETVPQNGGYMIAAYIVVAAILIGYTVSLYLRARRSLRA* |
Ga0134109_102208571 | 3300010320 | Grasslands Soil | MPENGGYMIAAYVVVAAILIGYTLSLYLRARRSFRA* |
Ga0134064_100861243 | 3300010325 | Grasslands Soil | MTTQGPPPNSGYMIAAYILVGVILIGYTVSLYLRARRSLRA* |
Ga0137457_10524012 | 3300011443 | Soil | MPETVPPNGGYMIAAYIVTAVILAGYALSLYLRARRSLRA* |
Ga0137389_102701242 | 3300012096 | Vadose Zone Soil | MPETVPQNGNYMIVAYILVGVILVGYAVSLYLRARRSLRP* |
Ga0137389_106263531 | 3300012096 | Vadose Zone Soil | MLEQVPRNGGYMVAAYIVAAGILIGYAVSLYLRARRGLRA* |
Ga0137364_106323942 | 3300012198 | Vadose Zone Soil | MTPQNGGYMIAAYVVVAAILIGYTLSLYLRARRSLRS* |
Ga0137383_101358911 | 3300012199 | Vadose Zone Soil | MPENGNYMIAAYILVGAILSGYALSLYLRARRSLRP* |
Ga0137383_106933471 | 3300012199 | Vadose Zone Soil | MPDTVPQNGGYMVAAYVVAAGILISYAVSLYLRTRRSLRP* |
Ga0137383_110226241 | 3300012199 | Vadose Zone Soil | MPNTVPQNGGYMIAAYVAAAVILIGYTLSLYLRARRSFRA* |
Ga0137382_100236467 | 3300012200 | Vadose Zone Soil | MPENGNYMIAAYILVGVILVGYALSLYLRARRSLRA* |
Ga0137382_101184144 | 3300012200 | Vadose Zone Soil | MPENGNYMIAAYIMTAVILVGYALSLYLRTRRSLRP* |
Ga0137382_106226262 | 3300012200 | Vadose Zone Soil | MPENGNYMIAAYILVGVILVGYGLSLYLRTRRSLRP* |
Ga0137365_101518064 | 3300012201 | Vadose Zone Soil | MPEQIPQNGGYMVAAYVVAAVILIGYTLSLYLRARRSFRA* |
Ga0137363_101949994 | 3300012202 | Vadose Zone Soil | MPENGGYMIAAYVVVAAILIGYALSLYLRARRSFRA* |
Ga0137399_101458591 | 3300012203 | Vadose Zone Soil | MPENGGYMVAAYVVVAVIMLGYALSLYLRTRRSFRA* |
Ga0137399_105728722 | 3300012203 | Vadose Zone Soil | MPENGNYMIAAYILVGIILGGYALSLYLRARRSLRP* |
Ga0137399_109950532 | 3300012203 | Vadose Zone Soil | MPDNGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP* |
Ga0137374_109028301 | 3300012204 | Vadose Zone Soil | MLETVPQTGGYMIAAYIVVAVILVGYTLSLYLRARRSLRA* |
Ga0137380_101567643 | 3300012206 | Vadose Zone Soil | MPENGNYMIAAYILVGVILVGYALSLHLRARRSLRP* |
Ga0137376_108740462 | 3300012208 | Vadose Zone Soil | MPETLPQNAGYMIAAYIVVAVIMLGYAASLFQRGRKL* |
Ga0137376_109955092 | 3300012208 | Vadose Zone Soil | MTEAVPQNGNYMIAAYILVGVILVGYALSLYLRTRRSLRP* |
Ga0137376_111250712 | 3300012208 | Vadose Zone Soil | MPETVPQNGGYMIAAYIVVAAILIGYTLSLYLRARRSLRA* |
Ga0137377_119128431 | 3300012211 | Vadose Zone Soil | MPQSIPQNGGYMIAAYIVAAVILVAYALALYLRARRSLRA* |
Ga0137370_100045975 | 3300012285 | Vadose Zone Soil | MPENGNYMIAAYILVGVILGGYALSLYLRARRSLRP* |
Ga0137386_108584091 | 3300012351 | Vadose Zone Soil | RRWEKWGRGMPENGGYMIAAYIVVGVILVGYALSLYLRARRSLRA* |
Ga0137368_100323374 | 3300012358 | Vadose Zone Soil | MLENGGYMIAAYIVVGVILVGYALSLYLRARRSLRA* |
Ga0137375_101212913 | 3300012360 | Vadose Zone Soil | MPENGGYMIAAYIVVGVILVGYALSLYLRARRSLRA* |
Ga0137360_104160873 | 3300012361 | Vadose Zone Soil | MTQTVPQNGGYMIAAYIVVAVILIGYTLSLYLRARRSLRA* |
Ga0137361_104814773 | 3300012362 | Vadose Zone Soil | MPETVPQNGGYLVAAYIVVAVILIGYTLSLYLRARRSLRA* |
Ga0137397_100179283 | 3300012685 | Vadose Zone Soil | MPENGGYMIAAYIVAAVIIVGYALSLYLRARRSLRP* |
Ga0137395_106926352 | 3300012917 | Vadose Zone Soil | MPENGNYMIAAYILGGVILVGYALSLYLRTRRSLR |
Ga0137396_102207503 | 3300012918 | Vadose Zone Soil | MPETVPQNGGYMIAAYVLVGVILVGYALSLYLRARRSLRA* |
Ga0137359_110292261 | 3300012923 | Vadose Zone Soil | MPENGNYMIAAYILVGIILSGYALSLYLRARRNLRP* |
Ga0137413_112245142 | 3300012924 | Vadose Zone Soil | MQNVPQNGGYMVAAYILVAVIIAGYALSLYLRARRSLRP* |
Ga0137410_107354761 | 3300012944 | Vadose Zone Soil | MPENGGYMIAAYVVAAVIILGYALSLYLRARRSLRP* |
Ga0134076_101694312 | 3300012976 | Grasslands Soil | MPENGNYMIAAYILVGIILVGYALSLYLRARRSLRP* |
Ga0134076_103418571 | 3300012976 | Grasslands Soil | MPETIPQNGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP* |
Ga0134078_100341634 | 3300014157 | Grasslands Soil | MPETVPQNGGYMIAAYIVVAAILIGYTVSLYLRARRSLRA |
Ga0137420_12681893 | 3300015054 | Vadose Zone Soil | MPENGNYMIAAYILVGVILVGYALSLYLRARRSLRP |
Ga0137409_103115143 | 3300015245 | Vadose Zone Soil | MPDAVPQNGGYMIAAYVVAAIILIGYTLSLYLRARRSFRA* |
Ga0180089_10425932 | 3300015254 | Soil | MTETVPQNAGYMIAAYIVTGVILIGYALSLYLRARRSLRA* |
Ga0134072_103212932 | 3300015357 | Grasslands Soil | MPETLPQNAGYMIAAYIVVAVIMLGYAASLFQRGRK |
Ga0134112_100153182 | 3300017656 | Grasslands Soil | MPETIPQNGSFMIAAYIVAAVILIGYSLSLYLRARRSLRA |
Ga0134112_102515862 | 3300017656 | Grasslands Soil | MPENGNYMIAAYILVGIILVGYALSLYLRARRSLRP |
Ga0134112_102666322 | 3300017656 | Grasslands Soil | MPQSMPQNGGYMVAAYIVAGAILIGYAVSLYLRTRRSLRA |
Ga0134083_103341862 | 3300017659 | Grasslands Soil | MPENGGYMIAAYIVVGVILVGYALSLYLRARRSLRA |
Ga0184610_10126944 | 3300017997 | Groundwater Sediment | MPETVPQNAGYMIAAYIVAGVILIGYALSLYLRARRSLRA |
Ga0184610_10274423 | 3300017997 | Groundwater Sediment | MTETVPQNAGYMIAAYIVTGVILIGYALSLYLRARRSLRA |
Ga0184608_100452013 | 3300018028 | Groundwater Sediment | MPENGNYMSAAYILGGVILVGYALSLYLRTRRSLRP |
Ga0184621_100181604 | 3300018054 | Groundwater Sediment | MPENGNYMIAAYILVGVILAGYALSLYLRTRRSLRP |
Ga0184623_100590082 | 3300018056 | Groundwater Sediment | MPETVPQNAGYMIAAYMVAGAILIGYALSLYLRARRSLRA |
Ga0184618_100638313 | 3300018071 | Groundwater Sediment | MPETVPQNGGYMIAAYILVGVILAGYALSLYLRARRSLRP |
Ga0184609_100147725 | 3300018076 | Groundwater Sediment | MPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRP |
Ga0184629_100709663 | 3300018084 | Groundwater Sediment | MPETVPQNGGYMIAAYIVAGVILLGYALSLYLRARRSLRA |
Ga0184629_104922662 | 3300018084 | Groundwater Sediment | MPETVPQNGSYMIAAYILVGVILVGYTVSLYLRARRSLRP |
Ga0066655_100346965 | 3300018431 | Grasslands Soil | DMPDTVPQNGGYMVGAYVVAAVILISYALSLYLRTRRSLRA |
Ga0066667_100180713 | 3300018433 | Grasslands Soil | MPQSIPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA |
Ga0066667_111915732 | 3300018433 | Grasslands Soil | MPETVPENGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP |
Ga0066667_117741512 | 3300018433 | Grasslands Soil | MPENGNYMIAAYILVGVILSGYALSLYLRARRSLRP |
Ga0066667_117749932 | 3300018433 | Grasslands Soil | MPETVPQNGSYMIAAYILVGVILAGYALLLYLRARRSLRP |
Ga0066662_100503191 | 3300018468 | Grasslands Soil | MPDTVPQNGGYMVAAYVVGAVVLISYALSLYLRTRPRLPA |
Ga0066662_101114033 | 3300018468 | Grasslands Soil | MLEQVPQNGGYMIAAYSVAAGILIGYAVSLYLRARRSLRA |
Ga0066669_100417264 | 3300018482 | Grasslands Soil | MHDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA |
Ga0066669_100741203 | 3300018482 | Grasslands Soil | MPEAVPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP |
Ga0066669_100794593 | 3300018482 | Grasslands Soil | MTPQNGGYMIAAYVVVAAILVGYTLSLYLRARRSLRS |
Ga0066669_101359024 | 3300018482 | Grasslands Soil | MTTQGPPPNSGYMIAAYILVGVILIGYTLSLYLRARRSLRP |
Ga0066669_102071753 | 3300018482 | Grasslands Soil | MPENGTYMIAAYILVGVILVGYALSLYLRTRRSLRP |
Ga0066669_102337412 | 3300018482 | Grasslands Soil | MPENGGYMIAAYVVVGAILIGYTLSLYLRARRSFRA |
Ga0066669_104482122 | 3300018482 | Grasslands Soil | MPQTPAPPQNGGYMIAAYCIVGAIFIVYTLSLYLRARRSLRP |
Ga0066669_110381442 | 3300018482 | Grasslands Soil | MPEILPQNAGYMIAAYIVVAVIMVGYAASLFQRGRKL |
Ga0066669_115557412 | 3300018482 | Grasslands Soil | MPETVPQNGSYMIAAYILVGLILGGYALLLYLRARRSLRP |
Ga0187894_105237192 | 3300019360 | Microbial Mat On Rocks | VVPDNAGYMIAAYVATAAILLGYALSLVLRANKVKE |
Ga0193722_10034985 | 3300019877 | Soil | MPENGGYMIAAYVVVGAILIGYSLSLYLRARRSLRA |
Ga0193723_100027521 | 3300019879 | Soil | MPENGSYMIAAYVLVGVILTGYALSLYLRARRSLRP |
Ga0193723_100051317 | 3300019879 | Soil | MPENGNYMIAAYILVGVILVGYALSLYLRTRRSLRA |
Ga0193725_10565712 | 3300019883 | Soil | MPENGNYMIAAYMLVGVILVGYALSLYLRTRRSLRP |
Ga0193733_11746312 | 3300020022 | Soil | MPESVPQNGGYMIAAYVLVGVILVGYALSLYLRARRGLRP |
Ga0210379_103917932 | 3300021081 | Groundwater Sediment | MTETVPQNAGYMIAAYIVTGVMLIGYALSLYLRARRSLRA |
Ga0179596_101717932 | 3300021086 | Vadose Zone Soil | MPENGNYMIAAYILGGVILVGYALSLYLRTRRSLRP |
Ga0193719_101534492 | 3300021344 | Soil | MPESVPQNATYMIAAYILVGVILIGYALLLYLRARRSLRP |
Ga0193695_10281642 | 3300021418 | Soil | MPETVPQNGSYMIAAYILVGVILAGYALSLYLRARRSLRP |
Ga0137417_10705942 | 3300024330 | Vadose Zone Soil | MPENGGYMIAAYVVAAVIIVGYALSLYLRARRSLRP |
Ga0209341_102665163 | 3300025325 | Soil | VPTDLPHNAGYMIAAYLVTAVIILGYSVSLVVRARRARTD |
Ga0207653_1000006046 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MPENGGYMIAAYIVVGAILSGYTLSLYLRARRSLRA |
Ga0207653_100983592 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MPENGNYMIAAYILVGVILTGYALSLYLRARRSLRP |
Ga0207684_102593602 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA |
Ga0207684_109173503 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQAAPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA |
Ga0207707_112590431 | 3300025912 | Corn Rhizosphere | ISDMPEVPQNAGYMIAAYIVAGAILFGYALSLYLRSRKL |
Ga0207660_102057082 | 3300025917 | Corn Rhizosphere | MQAPVPQNGGYMIAAYIVTGVIVVGYAVSLYLRARRALRP |
Ga0207660_102596712 | 3300025917 | Corn Rhizosphere | MPEAVPQNAGYMIAAYIIVAVILGGYALSLYLRTRRSLRA |
Ga0207660_116983241 | 3300025917 | Corn Rhizosphere | MPEVPQNAGYMIAAYIVAGAILFGYALSLYLRSRKL |
Ga0207662_101099802 | 3300025918 | Switchgrass Rhizosphere | MPETVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRALRP |
Ga0207689_108447062 | 3300025942 | Miscanthus Rhizosphere | MQTVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFRP |
Ga0210090_10634052 | 3300025965 | Natural And Restored Wetlands | MQSVPQNAGYMIAAYILTGAILLGYTLSLYLRARRSLRS |
Ga0208141_10141021 | 3300025988 | Rice Paddy Soil | MMLPQTPPQNSGYMIAAYVIAGAILLGYTLSLYLRARRSLRP |
Ga0209438_100076915 | 3300026285 | Grasslands Soil | MPETVPQNGGYMVAAYIIVAVITVGYTLSLYLRARRSFRA |
Ga0209438_11219182 | 3300026285 | Grasslands Soil | MPENGNYMIAAYILSGVILVGYALSLYLRTRRSLRP |
Ga0209234_10173613 | 3300026295 | Grasslands Soil | MPETLPQNAGYMIAAYIVVAVIMLGYAASLFQRGRKL |
Ga0209235_100033819 | 3300026296 | Grasslands Soil | MPETIPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA |
Ga0209235_10093135 | 3300026296 | Grasslands Soil | MPDTVPQNGGYMVAAYVVAAVILISYAVSLYLRTRRSLRP |
Ga0209235_12262992 | 3300026296 | Grasslands Soil | MPETVPQNGGYLVAAYIVVAVILIGYALSLHLRARRSLRA |
Ga0209235_12560462 | 3300026296 | Grasslands Soil | MPEAVPQNAGFMIAAYILVGVILVGYALSLYLRARRSLRP |
Ga0209027_10440961 | 3300026300 | Grasslands Soil | MLQVPGPPQNGGYMIAAYCIVGAIFIVYTLSLYLRARRSLRP |
Ga0209688_10943102 | 3300026305 | Soil | PQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP |
Ga0209153_10373623 | 3300026312 | Soil | MPETVPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP |
Ga0209470_10189002 | 3300026324 | Soil | MTPQNGGYMIAAYVVVAAILIGYTLSLYLRARRSLRS |
Ga0209470_11593772 | 3300026324 | Soil | MRDVPQNGGYMIAAYITVALILIGYALSLYLRARRSLRA |
Ga0209266_10025229 | 3300026327 | Soil | MPDTVPQNGGYMVGAYVVAAVILISYALSLYLRTRRSLRA |
Ga0209266_10879742 | 3300026327 | Soil | MPENGNYMIAAYILVGVILVGYGLSLYLRTRRSLRP |
Ga0209804_12471222 | 3300026335 | Soil | MPDTVPQNGSYMIAAYILVGVILAGYALLLYLRARRSLRP |
Ga0209378_10095013 | 3300026528 | Soil | MPESVPQNGGYMIAAYIVAGAILVSYALSLYLRARRSLRP |
Ga0209378_10136833 | 3300026528 | Soil | MHETVPQNGGYMIAAYIVVAAILIGYALSLYLRARRSLRA |
Ga0209378_12569602 | 3300026528 | Soil | MPQSIPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA |
Ga0209807_10208902 | 3300026530 | Soil | MPETFPQNGGYMIAAYVVAAVILISYAVSLYLRTRRTLRP |
Ga0209807_11224563 | 3300026530 | Soil | MLEQVPQNGGYMVAAYIVAAGILIGYAVSLYLRARRSLRA |
Ga0209807_11626681 | 3300026530 | Soil | MPETVPQNGGYMVAAYVVAAVILLSYAVSLYLRTRRSLRP |
Ga0209058_10034932 | 3300026536 | Soil | MPETIPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA |
Ga0209157_10220957 | 3300026537 | Soil | MPENGNYMIAAYILVGVILAGYALSLYLRARRSLRP |
Ga0209056_1000853715 | 3300026538 | Soil | MPETVPQNGGYMIAAYIVAGAILVSYALSLYLRARRSLRP |
Ga0209056_100371446 | 3300026538 | Soil | MPQSIPQNGGYMIAAYIVAAVILVGYGLSLYLRARRSLRA |
Ga0209376_12024991 | 3300026540 | Soil | IPQNGGYMIAAYIVAAVILVGYALSLYLRARRSLRA |
Ga0209161_105754622 | 3300026548 | Soil | MHETVPQNGGYMIAAYIVVAAILSGYALSLYLRARRSLRA |
Ga0208454_100102116 | 3300027573 | Soil | MPETVPQNAGYMIAAYVITGVILIGYTLSLYLRARRSLRP |
Ga0208454_10153353 | 3300027573 | Soil | MQAPVPQNAGYMIAAYVITGAILLGYALSLYLRARRSLRS |
Ga0209076_11099132 | 3300027643 | Vadose Zone Soil | MPETVPQNGGYMIAAYVLVGVILVGYALSLYLRARRSLRA |
Ga0209388_10780832 | 3300027655 | Vadose Zone Soil | MPENGNYMIAAYILVGVILFGYALSLYLRARRSLRP |
Ga0209588_100047010 | 3300027671 | Vadose Zone Soil | MPESVPQNGGYMIAAYILVGVILVGYALSLYLRARRSLRP |
Ga0209485_11059612 | 3300027691 | Agricultural Soil | MPETIPQNAGFMIAAYVVAGAIILGYALSLYLRSRKL |
Ga0208989_102454052 | 3300027738 | Forest Soil | MPETVPQNASYMIAAYILVGVILAGYALSLYLRARRSLRP |
Ga0209166_100052497 | 3300027857 | Surface Soil | MLSDTPQNGGYMIAAYVVAAVILLGYTLSLYLRARRSLRP |
Ga0209283_100050707 | 3300027875 | Vadose Zone Soil | MPETIPQNGGYMIAAYIVAAVILVGYAISLHLRARRSLRP |
Ga0209590_100012975 | 3300027882 | Vadose Zone Soil | MPETIPQNGGYMIAAYIVAAVILIGYALSLYLRARRSLRA |
Ga0209590_100465934 | 3300027882 | Vadose Zone Soil | MPENGGYMIAAYVVVGAILIGYTLSLYLRARRSLRA |
Ga0209590_102900243 | 3300027882 | Vadose Zone Soil | MHETVPQNGGYMIAAYIVVAAILIGYALSLYLRARR |
Ga0209488_100442746 | 3300027903 | Vadose Zone Soil | MSETVPQNGNYMIAAYILVGVILAGYALSLYLRARRSLRP |
Ga0209382_100997522 | 3300027909 | Populus Rhizosphere | MPESIPQNGGYMIAAYVIVAVILAGYALSLYLRTRRSLRA |
Ga0209382_101283713 | 3300027909 | Populus Rhizosphere | VPETVPQNAGYMIAAYVIAGAIVLGYALSLYLRARRSLRP |
Ga0209382_104145222 | 3300027909 | Populus Rhizosphere | MPESVPQNGGYLIAAYVIVAVILAGYALSLYLRARRSLRA |
Ga0209382_108808042 | 3300027909 | Populus Rhizosphere | MQVPEAVPQNGGYMVAAYIVVAVVILGYALSLYLRTRRSLRP |
Ga0247663_10807691 | 3300028145 | Soil | MQTVPQNAGYMIAAYIVTGVIVVGYAVSLYLRARRAFR |
Ga0137415_100287645 | 3300028536 | Vadose Zone Soil | MPETVPQNGGYLVAAYIVVAVILIGYALSLYLRARRSLRP |
Ga0137415_102084222 | 3300028536 | Vadose Zone Soil | MPETVPQNGSYMIAAYILVGVILIGYALSLYLRARRSLRP |
Ga0137415_103760073 | 3300028536 | Vadose Zone Soil | MPENGNYMIAAYILVGIILGGYALSLYLRARRSLRP |
Ga0307307_101373122 | 3300028718 | Soil | MPESVPQNATYMIAAYILVGVILTGYALSLYLRARRCLRP |
Ga0307296_104405351 | 3300028819 | Soil | MPETVPQNAGYMIAAYILVGVILTGYALSLYLRARRSLRP |
Ga0307308_100950303 | 3300028884 | Soil | MPENGNYMIAAYIVAAVILIGYALSLYLRTRRSLRP |
Ga0307308_102321123 | 3300028884 | Soil | PLEKWDMPESVPQNATYMIAAYILVGVILTGYALSLYLRARRCLRP |
Ga0073997_107194142 | 3300030997 | Soil | MPETVPQNGGFMIAAYIITAVILGGYALSLYMRTRRSLRA |
Ga0307498_100515592 | 3300031170 | Soil | MTPPNGGYMIAAYVVVAAILIGYTLSLYLRARRSLRS |
Ga0307495_101668142 | 3300031199 | Soil | MPETVPQNAGYMIAAYIIAGTILVSYAVSLYLRARRALRP |
Ga0307505_100168973 | 3300031455 | Soil | MQASPPDNAGYMIVAYLVTAVIVVGYAWSLWVRSKR |
Ga0310813_100053839 | 3300031716 | Soil | MMQATPENGGYMIAAYVIAAVVLVTYAVSLYWRTRKL |
Ga0307469_100125445 | 3300031720 | Hardwood Forest Soil | MLDQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA |
Ga0307469_112142061 | 3300031720 | Hardwood Forest Soil | MLEQVPQNGGYMVAAYVVAAGILIGYAVSLYLRARRSLRA |
Ga0307468_1009681822 | 3300031740 | Hardwood Forest Soil | MPEAIPQNAGYMIAAYIIVAVILGGYALSLYLRTRRSLRA |
Ga0307473_103891961 | 3300031820 | Hardwood Forest Soil | VMPQAAPQNGGYMIAAYIVAGVIIVGYALSLYLRARRSLRA |
Ga0307473_108523352 | 3300031820 | Hardwood Forest Soil | MMLQAPPSNGGYMVAAYVLAGAILIGYTLSLYLRARRSLRP |
Ga0307473_112672582 | 3300031820 | Hardwood Forest Soil | MHDVPQNGGYMIAAYITVAVILIGYALSLYLRARRSLRA |
Ga0326597_101297783 | 3300031965 | Soil | VPTDLPQNAGYMIAAYLVTAVIILGYSVSLLVRARRARTD |
Ga0326597_104010812 | 3300031965 | Soil | VPTELPDNAGYMIAAYLVTAVIILGYSVSLMVRARRAGTD |
Ga0307471_1014822732 | 3300032180 | Hardwood Forest Soil | MLEQVPQNGGYMVAAYILAAGILIGYAVSLYLRARRSLRA |
Ga0307471_1017120042 | 3300032180 | Hardwood Forest Soil | MPETVPQNAGYMIAAYVITGAILFGYALSLYLRARRSLRP |
Ga0307471_1019118451 | 3300032180 | Hardwood Forest Soil | MLEQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARR |
Ga0307471_1033031381 | 3300032180 | Hardwood Forest Soil | WDMLDQVPQNGGYMIAAYIVAAGILIGYAVSLYLRARRSLRA |
Ga0307472_1008935172 | 3300032205 | Hardwood Forest Soil | REESVMPEAVPQNAGYMIAAYIIVAVILGGYALSLYLRTSRSLRA |
Ga0335085_1002200113 | 3300032770 | Soil | MAETIPQNGGYMVAAYIVAAVILVGYALSLYRRSR |
Ga0214472_1001421510 | 3300033407 | Soil | MLQNVPQNAGYMIAAYIVAGAILIGYGLSLYLRARRSLRA |
Ga0364928_0009579_257_379 | 3300033813 | Sediment | MPETVPQNGGYMIAAYIVTAVILTGYALSLYLRARRSLRA |
Ga0364934_0070339_611_730 | 3300034178 | Sediment | MPDVPQNAGYMIAAYIVAGVILIGYALSLYLRARRSLRA |
⦗Top⦘ |