Basic Information | |
---|---|
Family ID | F011980 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 285 |
Average Sequence Length | 45 residues |
Representative Sequence | MPGSHAEEIVGDYFDSDDWAEQLVDDAESEPDLDLPPLPPPRPEAA |
Number of Associated Samples | 224 |
Number of Associated Scaffolds | 285 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 83.09 % |
% of genes near scaffold ends (potentially truncated) | 35.09 % |
% of genes from short scaffolds (< 2000 bps) | 83.86 % |
Associated GOLD sequencing projects | 213 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.228 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.965 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.789 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.73% β-sheet: 0.00% Coil/Unstructured: 70.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 285 Family Scaffolds |
---|---|---|
PF06262 | Zincin_1 | 14.39 |
PF02653 | BPD_transp_2 | 8.42 |
PF01694 | Rhomboid | 7.72 |
PF03734 | YkuD | 5.96 |
PF00185 | OTCace | 2.11 |
PF14542 | Acetyltransf_CG | 1.75 |
PF09360 | zf-CDGSH | 1.75 |
PF01042 | Ribonuc_L-PSP | 1.40 |
PF10944 | DUF2630 | 1.05 |
PF10646 | Germane | 1.05 |
PF13365 | Trypsin_2 | 1.05 |
PF02729 | OTCace_N | 0.70 |
PF14597 | Lactamase_B_5 | 0.70 |
PF13462 | Thioredoxin_4 | 0.70 |
PF00005 | ABC_tran | 0.70 |
PF00583 | Acetyltransf_1 | 0.35 |
PF07859 | Abhydrolase_3 | 0.35 |
PF00696 | AA_kinase | 0.35 |
PF00578 | AhpC-TSA | 0.35 |
PF15919 | HicB_lk_antitox | 0.35 |
PF07705 | CARDB | 0.35 |
PF05130 | FlgN | 0.35 |
PF02371 | Transposase_20 | 0.35 |
PF04087 | DUF389 | 0.35 |
PF05147 | LANC_like | 0.35 |
PF12706 | Lactamase_B_2 | 0.35 |
PF05096 | Glu_cyclase_2 | 0.35 |
PF07876 | Dabb | 0.35 |
PF02887 | PK_C | 0.35 |
PF04216 | FdhE | 0.35 |
PF02518 | HATPase_c | 0.35 |
PF13487 | HD_5 | 0.35 |
PF02810 | SEC-C | 0.35 |
PF12697 | Abhydrolase_6 | 0.35 |
PF03006 | HlyIII | 0.35 |
PF01197 | Ribosomal_L31 | 0.35 |
PF02322 | Cyt_bd_oxida_II | 0.35 |
COG ID | Name | Functional Category | % Frequency in 285 Family Scaffolds |
---|---|---|---|
COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 14.39 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 7.72 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 5.96 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 5.96 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.40 |
COG3418 | Flagellar biosynthesis/type III secretory pathway chaperone FlgN | Cell motility [N] | 1.05 |
COG0254 | Ribosomal protein L31 | Translation, ribosomal structure and biogenesis [J] | 0.35 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.35 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.35 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.35 |
COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.35 |
COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 0.35 |
COG3058 | Formate dehydrogenase maturation protein FdhE | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.35 |
COG3823 | Glutamine cyclotransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.35 |
COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 0.35 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.23 % |
Unclassified | root | N/A | 8.77 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig21456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
2124908016|OU_2_1_1_newblercontig95028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
2170459019|G14TP7Y01BF6QN | Not Available | 634 | Open in IMG/M |
2199352025|deepsgr__Contig_161726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300000886|AL3A1W_1432324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300000956|JGI10216J12902_100315817 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
3300000956|JGI10216J12902_100985267 | All Organisms → cellular organisms → Bacteria | 3507 | Open in IMG/M |
3300000956|JGI10216J12902_111784985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300000956|JGI10216J12902_116422542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300001535|A3PFW1_10333781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1474 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101440209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300002568|C688J35102_119961353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
3300002568|C688J35102_120811798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1657 | Open in IMG/M |
3300004081|Ga0063454_101072665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 655 | Open in IMG/M |
3300004157|Ga0062590_100773021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
3300004463|Ga0063356_101246726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1083 | Open in IMG/M |
3300004479|Ga0062595_100303985 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300005093|Ga0062594_100499262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1028 | Open in IMG/M |
3300005103|Ga0066813_1001272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
3300005166|Ga0066674_10386271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
3300005172|Ga0066683_10372357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
3300005176|Ga0066679_10430753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
3300005180|Ga0066685_10911195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
3300005180|Ga0066685_11021239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
3300005186|Ga0066676_10463756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
3300005187|Ga0066675_10084580 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
3300005187|Ga0066675_10178273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1479 | Open in IMG/M |
3300005330|Ga0070690_100017901 | All Organisms → cellular organisms → Bacteria | 4272 | Open in IMG/M |
3300005434|Ga0070709_10371232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1061 | Open in IMG/M |
3300005436|Ga0070713_100209069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1766 | Open in IMG/M |
3300005445|Ga0070708_100014260 | All Organisms → cellular organisms → Bacteria | 6532 | Open in IMG/M |
3300005446|Ga0066686_10266954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1158 | Open in IMG/M |
3300005450|Ga0066682_10281737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
3300005450|Ga0066682_10451655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 817 | Open in IMG/M |
3300005458|Ga0070681_10330516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1434 | Open in IMG/M |
3300005518|Ga0070699_100005859 | All Organisms → cellular organisms → Bacteria | 10730 | Open in IMG/M |
3300005526|Ga0073909_10100507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1143 | Open in IMG/M |
3300005526|Ga0073909_10210364 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005540|Ga0066697_10437770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
3300005543|Ga0070672_100158494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1876 | Open in IMG/M |
3300005546|Ga0070696_100651703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 854 | Open in IMG/M |
3300005549|Ga0070704_101155065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300005553|Ga0066695_10256123 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300005553|Ga0066695_10531713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
3300005554|Ga0066661_10415721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
3300005558|Ga0066698_11061034 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005586|Ga0066691_10554536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
3300005598|Ga0066706_10839340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300006028|Ga0070717_10137246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2107 | Open in IMG/M |
3300006163|Ga0070715_10070665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1559 | Open in IMG/M |
3300006163|Ga0070715_10996732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 522 | Open in IMG/M |
3300006574|Ga0074056_11619637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
3300006577|Ga0074050_10000647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
3300006605|Ga0074057_12167012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 648 | Open in IMG/M |
3300006606|Ga0074062_12818558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 830 | Open in IMG/M |
3300006796|Ga0066665_11507693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
3300006797|Ga0066659_10489394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
3300006800|Ga0066660_10125187 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
3300006806|Ga0079220_10234368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
3300006881|Ga0068865_100240376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1424 | Open in IMG/M |
3300006953|Ga0074063_13384413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300007255|Ga0099791_10063195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1670 | Open in IMG/M |
3300007258|Ga0099793_10423136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300009012|Ga0066710_100127330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3487 | Open in IMG/M |
3300009012|Ga0066710_102876183 | Not Available | 677 | Open in IMG/M |
3300009012|Ga0066710_104343671 | Not Available | 530 | Open in IMG/M |
3300009012|Ga0066710_104753813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
3300009038|Ga0099829_10038454 | All Organisms → cellular organisms → Bacteria | 3465 | Open in IMG/M |
3300009038|Ga0099829_10426261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1098 | Open in IMG/M |
3300009089|Ga0099828_11552513 | Not Available | 583 | Open in IMG/M |
3300009090|Ga0099827_10018607 | All Organisms → cellular organisms → Bacteria | 4763 | Open in IMG/M |
3300009090|Ga0099827_10205157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1641 | Open in IMG/M |
3300009137|Ga0066709_102366393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
3300009176|Ga0105242_10913895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 879 | Open in IMG/M |
3300010039|Ga0126309_10452391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
3300010044|Ga0126310_10269865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
3300010045|Ga0126311_11114207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
3300010093|Ga0127490_1037607 | Not Available | 569 | Open in IMG/M |
3300010147|Ga0126319_1200761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300010154|Ga0127503_10517072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300010303|Ga0134082_10552089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300010304|Ga0134088_10335801 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300010320|Ga0134109_10199865 | Not Available | 737 | Open in IMG/M |
3300010326|Ga0134065_10180306 | Not Available | 754 | Open in IMG/M |
3300010333|Ga0134080_10155048 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300010333|Ga0134080_10413908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300010336|Ga0134071_10548423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
3300010336|Ga0134071_10814674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300010371|Ga0134125_10712889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
3300010371|Ga0134125_12821672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300010373|Ga0134128_10549097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1287 | Open in IMG/M |
3300010375|Ga0105239_11002182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 960 | Open in IMG/M |
3300010396|Ga0134126_10356633 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
3300010856|Ga0126358_1103368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300010857|Ga0126354_1212282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
3300010861|Ga0126349_1075060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
3300010862|Ga0126348_1065976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
3300011000|Ga0138513_100019742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 921 | Open in IMG/M |
3300011269|Ga0137392_11545098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Euzebyales → Euzebyaceae → Euzebya | 522 | Open in IMG/M |
3300011994|Ga0120157_1001476 | All Organisms → cellular organisms → Bacteria | 8764 | Open in IMG/M |
3300011994|Ga0120157_1040945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
3300011999|Ga0120148_1003122 | All Organisms → cellular organisms → Bacteria | 5161 | Open in IMG/M |
3300012001|Ga0120167_1016911 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
3300012001|Ga0120167_1127790 | Not Available | 505 | Open in IMG/M |
3300012011|Ga0120152_1001476 | All Organisms → cellular organisms → Bacteria | 12011 | Open in IMG/M |
3300012011|Ga0120152_1025155 | All Organisms → cellular organisms → Bacteria | 2179 | Open in IMG/M |
3300012014|Ga0120159_1210929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300012019|Ga0120139_1013532 | Not Available | 1870 | Open in IMG/M |
3300012096|Ga0137389_10070116 | All Organisms → cellular organisms → Bacteria | 2708 | Open in IMG/M |
3300012198|Ga0137364_10034627 | All Organisms → cellular organisms → Bacteria | 3252 | Open in IMG/M |
3300012200|Ga0137382_10092038 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
3300012200|Ga0137382_10502421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 861 | Open in IMG/M |
3300012201|Ga0137365_10004280 | All Organisms → cellular organisms → Bacteria | 11458 | Open in IMG/M |
3300012201|Ga0137365_10085383 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
3300012201|Ga0137365_10636465 | Not Available | 781 | Open in IMG/M |
3300012204|Ga0137374_10000337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 45563 | Open in IMG/M |
3300012205|Ga0137362_11175305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
3300012206|Ga0137380_10015999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6860 | Open in IMG/M |
3300012206|Ga0137380_10724246 | Not Available | 862 | Open in IMG/M |
3300012207|Ga0137381_11407023 | Not Available | 590 | Open in IMG/M |
3300012208|Ga0137376_11417887 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300012209|Ga0137379_10138322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2339 | Open in IMG/M |
3300012209|Ga0137379_11288309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
3300012212|Ga0150985_113919178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300012285|Ga0137370_10337134 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300012349|Ga0137387_10957947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
3300012350|Ga0137372_10004573 | All Organisms → cellular organisms → Bacteria | 13495 | Open in IMG/M |
3300012353|Ga0137367_10035204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3845 | Open in IMG/M |
3300012354|Ga0137366_10611434 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300012359|Ga0137385_10127270 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
3300012361|Ga0137360_10481314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
3300012362|Ga0137361_10616625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
3300012363|Ga0137390_10668622 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300012392|Ga0134043_1196020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
3300012685|Ga0137397_10170459 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
3300012904|Ga0157282_10169375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
3300012914|Ga0157297_10162157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 740 | Open in IMG/M |
3300012922|Ga0137394_11090569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
3300012925|Ga0137419_10269543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1290 | Open in IMG/M |
3300012929|Ga0137404_11141657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
3300012930|Ga0137407_10029067 | All Organisms → cellular organisms → Bacteria | 4283 | Open in IMG/M |
3300012951|Ga0164300_10127024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
3300012951|Ga0164300_10168986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
3300012955|Ga0164298_10411268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 877 | Open in IMG/M |
3300012957|Ga0164303_10018288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2645 | Open in IMG/M |
3300012957|Ga0164303_10860339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300012958|Ga0164299_10087244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1584 | Open in IMG/M |
3300012958|Ga0164299_10956612 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300012961|Ga0164302_10274218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1086 | Open in IMG/M |
3300012986|Ga0164304_10594995 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300012987|Ga0164307_10134079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1607 | Open in IMG/M |
3300012989|Ga0164305_10992367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 713 | Open in IMG/M |
3300013501|Ga0120154_1000189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 26253 | Open in IMG/M |
3300013770|Ga0120123_1024735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1225 | Open in IMG/M |
3300013772|Ga0120158_10002340 | All Organisms → cellular organisms → Bacteria | 22182 | Open in IMG/M |
3300014052|Ga0120109_1011217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1971 | Open in IMG/M |
3300015357|Ga0134072_10047817 | Not Available | 1180 | Open in IMG/M |
3300015358|Ga0134089_10229869 | Not Available | 753 | Open in IMG/M |
3300017659|Ga0134083_10207634 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300017659|Ga0134083_10228633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
3300017659|Ga0134083_10371610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300018000|Ga0184604_10069254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1026 | Open in IMG/M |
3300018027|Ga0184605_10006148 | All Organisms → cellular organisms → Bacteria | 4381 | Open in IMG/M |
3300018027|Ga0184605_10007047 | All Organisms → cellular organisms → Bacteria | 4160 | Open in IMG/M |
3300018027|Ga0184605_10066931 | All Organisms → cellular organisms → Bacteria | 1550 | Open in IMG/M |
3300018027|Ga0184605_10076738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1453 | Open in IMG/M |
3300018027|Ga0184605_10246415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
3300018027|Ga0184605_10288668 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300018027|Ga0184605_10463905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 556 | Open in IMG/M |
3300018028|Ga0184608_10280344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
3300018051|Ga0184620_10328501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300018054|Ga0184621_10187698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
3300018061|Ga0184619_10471218 | Not Available | 558 | Open in IMG/M |
3300018066|Ga0184617_1013026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1710 | Open in IMG/M |
3300018066|Ga0184617_1180618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
3300018071|Ga0184618_10039905 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
3300018071|Ga0184618_10177616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
3300018431|Ga0066655_10707185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
3300018433|Ga0066667_10957523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
3300018433|Ga0066667_12139336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300018920|Ga0190273_11937342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300019233|Ga0184645_1286975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
3300019255|Ga0184643_1179680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300019255|Ga0184643_1265188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300019269|Ga0184644_1494942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300019279|Ga0184642_1619524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300019356|Ga0173481_10475202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300019356|Ga0173481_10704237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
3300019362|Ga0173479_10438622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
3300019872|Ga0193754_1010599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
3300019873|Ga0193700_1021458 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1066 | Open in IMG/M |
3300019875|Ga0193701_1074598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
3300019876|Ga0193703_1060619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
3300019887|Ga0193729_1000008 | All Organisms → cellular organisms → Bacteria | 116119 | Open in IMG/M |
3300019996|Ga0193693_1036476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 837 | Open in IMG/M |
3300020001|Ga0193731_1096801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300020016|Ga0193696_1017688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1921 | Open in IMG/M |
3300020016|Ga0193696_1076728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
3300021080|Ga0210382_10386535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300021344|Ga0193719_10125147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1116 | Open in IMG/M |
3300021413|Ga0193750_1031297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1206 | Open in IMG/M |
3300021951|Ga0222624_1571330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
3300022195|Ga0222625_1561794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300024288|Ga0179589_10392711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 635 | Open in IMG/M |
3300024288|Ga0179589_10620223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
3300025885|Ga0207653_10213182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
3300025898|Ga0207692_10074375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1800 | Open in IMG/M |
3300025903|Ga0207680_10061931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2284 | Open in IMG/M |
3300025904|Ga0207647_10219885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1095 | Open in IMG/M |
3300025914|Ga0207671_11322632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 561 | Open in IMG/M |
3300025918|Ga0207662_10106962 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
3300025928|Ga0207700_11592559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300025935|Ga0207709_10098065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1932 | Open in IMG/M |
3300025972|Ga0207668_10249702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1440 | Open in IMG/M |
3300026078|Ga0207702_11307080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
3300026142|Ga0207698_12158024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300026285|Ga0209438_1142769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
3300026310|Ga0209239_1252654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
3300026331|Ga0209267_1306931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300026538|Ga0209056_10638937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300026547|Ga0209156_10102735 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300026547|Ga0209156_10485954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300026548|Ga0209161_10523721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300026552|Ga0209577_10088953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2525 | Open in IMG/M |
3300027821|Ga0209811_10070185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 1224 | Open in IMG/M |
3300027846|Ga0209180_10388478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
3300027875|Ga0209283_10236852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
3300027882|Ga0209590_10013047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3973 | Open in IMG/M |
3300027882|Ga0209590_10025040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3070 | Open in IMG/M |
3300027882|Ga0209590_10302175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
3300028536|Ga0137415_10329943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1329 | Open in IMG/M |
3300028705|Ga0307276_10015286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1435 | Open in IMG/M |
3300028708|Ga0307295_10037030 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300028709|Ga0307279_10076491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
3300028711|Ga0307293_10098178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
3300028711|Ga0307293_10128493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 806 | Open in IMG/M |
3300028714|Ga0307309_10013021 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300028714|Ga0307309_10125465 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 632 | Open in IMG/M |
3300028715|Ga0307313_10058782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
3300028717|Ga0307298_10093045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
3300028768|Ga0307280_10018565 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
3300028771|Ga0307320_10022669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2268 | Open in IMG/M |
3300028778|Ga0307288_10080693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1162 | Open in IMG/M |
3300028784|Ga0307282_10209672 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300028784|Ga0307282_10536975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
3300028787|Ga0307323_10004041 | All Organisms → cellular organisms → Bacteria | 4757 | Open in IMG/M |
3300028787|Ga0307323_10152469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
3300028787|Ga0307323_10380786 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300028799|Ga0307284_10152430 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300028803|Ga0307281_10200342 | Not Available | 718 | Open in IMG/M |
3300028807|Ga0307305_10075819 | Not Available | 1552 | Open in IMG/M |
3300028807|Ga0307305_10485443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
3300028810|Ga0307294_10216030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300028814|Ga0307302_10128532 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
3300028819|Ga0307296_10274690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
3300028828|Ga0307312_10164409 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300028828|Ga0307312_10168974 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300028828|Ga0307312_10464510 | Not Available | 834 | Open in IMG/M |
3300028828|Ga0307312_10725351 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300028875|Ga0307289_10394942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300028878|Ga0307278_10266336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 759 | Open in IMG/M |
3300028881|Ga0307277_10032962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2069 | Open in IMG/M |
3300028881|Ga0307277_10143795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1032 | Open in IMG/M |
3300028884|Ga0307308_10272269 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300028885|Ga0307304_10003186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4738 | Open in IMG/M |
3300030785|Ga0102757_11351563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300031058|Ga0308189_10542055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300031093|Ga0308197_10337343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300031421|Ga0308194_10025608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1341 | Open in IMG/M |
3300031421|Ga0308194_10327298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
3300031422|Ga0308186_1034932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
3300031740|Ga0307468_100059433 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300031938|Ga0308175_102083541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
3300034447|Ga0370544_23914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300034643|Ga0370545_141125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300034644|Ga0370548_099082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
3300034680|Ga0370541_054763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300034681|Ga0370546_080479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.26% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 5.26% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.21% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.46% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.40% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.40% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.05% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.05% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.05% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.05% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.70% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.70% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.70% | |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.70% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.70% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.35% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.35% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.35% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.35% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.35% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.35% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.35% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.35% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.35% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000886 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-65cm-3A)- 1 week illumina | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010862 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
3300012014 | Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
3300019875 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2 | Environmental | Open in IMG/M |
3300019876 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300030785 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031422 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300034447 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_119 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034680 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_116 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034681 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_121 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_02043590 | 2124908016 | MPGSHADDIVADYFESDDWADELADMDAEPELDLPPLPPAPPSQ | |
OU_00024720 | 2124908016 | MPGSHADDIVGEFFESDDWAKLTEQDAEPGEPDLDLPPVPPRPEAA | |
4MG_04226140 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | NAEEIVSDYFESDDWAEQLLEEGDAEPDPDLPPLTPQRPRPA |
deepsgr_02689960 | 2199352025 | Soil | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPPRPE |
AL3A1W_14323242 | 3300000886 | Permafrost | MPGSHAEEIVGDYFDSDDWAEQLVDDAESEPDLDLPPLPPPRPEAA* |
JGI10216J12902_1003158173 | 3300000956 | Soil | MRGSHAEEIVGDYFDPDDWTEQLMEDTEAEPDLDLPPLPPPPEAA* |
JGI10216J12902_1009852676 | 3300000956 | Soil | MPGSHADDIVGEFFESDDWGDLPGGDRDGDDPDLDLPPLPPRPEAA* |
JGI10216J12902_1117849853 | 3300000956 | Soil | ADDIVGEFFESDDWGELAGDDGEPDDPDLDLPPLPPRPETA* |
JGI10216J12902_1164225422 | 3300000956 | Soil | MPGSHADDIVNDYFEGDEWAELVEGDSEPDLDLPPLPSHAPPRD* |
A3PFW1_103337814 | 3300001535 | Permafrost | MTGSHAEEIVGDYFDSDDWAEQLVDDAESEPDLDLPPFPPPRPEAA* |
JGIcombinedJ26739_1014402091 | 3300002245 | Forest Soil | MPGSHAEEIVGDYLDSEDWAEQLVEDAEAEPDLDLPPLP |
C688J35102_1199613532 | 3300002568 | Soil | VPGSHAEEIVVDYFESEDWAVLDDAEPEPELDLPSLPAPRPST* |
C688J35102_1208117982 | 3300002568 | Soil | MPGSHAEEIVGDYYESDDWAESFTGDAESEPDLDLPPLPPLRPEAA* |
Ga0063454_1010726651 | 3300004081 | Soil | VPGSHAEEIVVDYFESEDWAVLDDAEPEPDLDLPSLPQPAPRPSG* |
Ga0062590_1007730212 | 3300004157 | Soil | MPGSHADDIVGEFFESDDWAGLAKEDDDAEDPDLDFPPLPPRPEAA* |
Ga0063356_1012467262 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPPRPEAA* |
Ga0062595_1003039852 | 3300004479 | Soil | MPGSHADDIVGEFFESDDWGELGTDDADPVDPDLDLSPLPPRPEAA* |
Ga0062594_1004992623 | 3300005093 | Soil | MPGSHADEIVGDYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPEAA* |
Ga0066813_10012723 | 3300005103 | Soil | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPTRPEAA* |
Ga0066674_103862712 | 3300005166 | Soil | MLGSHADEIVGDYFESDDWAEELVGDDEPEPDLDLPPLSPPEAA* |
Ga0066683_103723572 | 3300005172 | Soil | MPGSHAEEIVGDYFDPDDWAEQLMEDTEAEPDLDLPPLPPGPEAA* |
Ga0066680_100220645 | 3300005174 | Soil | MAGSHADDIVGEFFESDDWAKLAEQEAESEEPDLDPAPVPPRPEAA* |
Ga0066679_104307532 | 3300005176 | Soil | VPGSHAEEIVVDYFEGDDWAEFVEAEAEPDLDLPPLPSPAPRPAAA* |
Ga0066688_107496561 | 3300005178 | Soil | MAGSHADDIVGEFFESDEWAKLAEQEAESEEPDLDPAPVPPRPEAA* |
Ga0066685_109111952 | 3300005180 | Soil | MPGSHAEEIVGDYFESDDWGEQLVDDSEAEPDLELPPLPPPRPEAA* |
Ga0066685_110212391 | 3300005180 | Soil | MPGSHADDIVGEFFESDDWAKLAEEDGESEEPDLDLPPLPPPRPEAA* |
Ga0066676_104637561 | 3300005186 | Soil | MPGSHAEEIVGDYFESDDWAEQLVDDSEAEPDLDLPPLPPPHP |
Ga0066675_100845802 | 3300005187 | Soil | MPGSHADDIVGEFFESDDWGELGGDDAASDEPDLDLPPLPPGPDAA* |
Ga0066675_101782731 | 3300005187 | Soil | MPGSHADDIVGDFFESDDWASLAKEDGDKSEEPDLDLPPLPPPRPEAA* |
Ga0070690_1000179017 | 3300005330 | Switchgrass Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPPRHEAA* |
Ga0070709_103712321 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPALPTPRPEAA* |
Ga0070713_1002090691 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSRMPGSHADEIVGDYFESEDWTGLIDGDLEPELDVPPPSPAGRQSPA* |
Ga0070708_1000142603 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGSHADEIVGDYFESDDWAEELVGDDEPEPDLDLPPLPPPEAA* |
Ga0066686_102669542 | 3300005446 | Soil | MPGSHADDIVGEFFESDDWAKLAEDGESEEPDLDLPPLPPPRPEAA* |
Ga0066682_102817372 | 3300005450 | Soil | MPGSHAEEIVGDYFDPDDWAEQLMEETEAEPDLDLPPLPPRPEAA* |
Ga0066682_104516553 | 3300005450 | Soil | MPGSHADDIVGEFFESDDWAKLAEDGESEEPDLDLPPLPPPRPEA |
Ga0070681_103305165 | 3300005458 | Corn Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPLRPEAA* |
Ga0070699_1000058594 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGSHAEEIVGDYSDPDDWAEQLLDEGDAEPDLDLPSLPPPRPEAA* |
Ga0073909_101005071 | 3300005526 | Surface Soil | TGAVMPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPPRPEAA* |
Ga0073909_102103642 | 3300005526 | Surface Soil | MPGSHAEEIVGDYYESDDWAGSLAEDAESEPDLDLPPLPPLRPEAA* |
Ga0066697_104377701 | 3300005540 | Soil | MPGSHADDIVGDFFESDDWASLAKEDGDESEEPDLDLPPLPPPRPEAA* |
Ga0070672_1001584945 | 3300005543 | Miscanthus Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLP |
Ga0070696_1006517032 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGSHADEIVGDYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPQAA* |
Ga0070704_1011550651 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGSHADEIVGDYFDPDDWAEKLMDDTDTEPDLDLPPLPPPRPDAA* |
Ga0066695_102561232 | 3300005553 | Soil | GSHADDIVGEFFESDDWGELGGDDAASDEPDLDLPPLPPGPDAA* |
Ga0066695_105317132 | 3300005553 | Soil | MPGSHAEEIVGDYFDPDDWAEQLMEDTEAEPDLDLPPLPPRPEAA* |
Ga0066661_104157214 | 3300005554 | Soil | VPGSHAEEIVVDYFEGDDWAEFVEAEAEPDLDLPPLPPPAPR |
Ga0066698_108884631 | 3300005558 | Soil | ADDIVGEFFESDEWAELAKETGEPEEPDLDLPPLRPRPEAA* |
Ga0066698_110610342 | 3300005558 | Soil | MPGSHAEEIVGDYSDPDDWAEQLMDEAEAESEPDLDLPPLPPRPETA* |
Ga0066691_105545361 | 3300005586 | Soil | MLGSHADEIVGDYFESDDWAEELVGGDEPEPDLDLPPLSPPEAA* |
Ga0066706_108393401 | 3300005598 | Soil | MPGSHADDIVGDFFESDDWASPAKEDGDESEEPDLDLPPLPPPRPEAA* |
Ga0070717_101372462 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGSHADEIVGDYFESEDWTGLIDGDLEPELDVPPPSPAGRQSPA* |
Ga0070715_100706655 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSRMPGSHADEIVGDYFESEDWTGLIDGDLEPELDIPPPSPAGRQSPA* |
Ga0070715_109967322 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPALPTSRPEAA* |
Ga0074056_116196371 | 3300006574 | Soil | MPGSHAEEIVGDYYESDDWAESFAEDAESEPEDAESEPDLDLPPLPPPRPEAA* |
Ga0074050_100006473 | 3300006577 | Soil | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPRPEAA* |
Ga0074057_121670121 | 3300006605 | Soil | VGDYYESDDWAESFAEDAESEPDLDLPPLPPPRPEAA* |
Ga0074062_128185582 | 3300006606 | Soil | DYYESDDWAESFAEDAESEPDLDLPPLPPPRPEAA* |
Ga0066665_115076932 | 3300006796 | Soil | MPGSHAEEIVGDYFESDDWAEQLVDDSEAEPDLDLPPLPPPHPEAA* |
Ga0066659_104893943 | 3300006797 | Soil | MLGSHADEIVGDYFESDDWAEELVGGDEPEPHLDLPPLSPPEAA* |
Ga0066660_101251872 | 3300006800 | Soil | MPGSHADDIVGEFFESDDWGDLAGEDESDEADLDLPPLPPRPEAA* |
Ga0079220_102343681 | 3300006806 | Agricultural Soil | MPGSHAEEIVGDYFESEDWAALVDSDAEPELDLPPLPPPAPRQ |
Ga0068865_1002403765 | 3300006881 | Miscanthus Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPA |
Ga0074063_133844131 | 3300006953 | Soil | MPGSHADEIVGDYSDPDDWAEQLLDDAEAEPDLDLPPLPPPRPEAA* |
Ga0099791_100631953 | 3300007255 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVEDGEAEPDLDLPPLPPPEAA* |
Ga0099793_104231361 | 3300007258 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLIEDGEAEPDLELPPLPPPPEAA* |
Ga0066710_1001273303 | 3300009012 | Grasslands Soil | MPGSHADDIVGDFFESDDWASPAKEDGDESEEPDLDLPPLPPPRPEAA |
Ga0066710_1028761832 | 3300009012 | Grasslands Soil | MPGSHAEEIVGDYFESDDWAEQLVEDSEAEPDLDLPPLPPPHPEAA |
Ga0066710_1043436711 | 3300009012 | Grasslands Soil | ADDIVGEFFESDDWGELGGDDAASDEPDLDLPPLPPGPDAA |
Ga0066710_1047538132 | 3300009012 | Grasslands Soil | MLGSHAEEIVGDYSDPDDWAEQLLDDTESEPDLDLPPLPPPRPEAA |
Ga0099829_100384547 | 3300009038 | Vadose Zone Soil | MLGSHADEIVGDYLESDDWAEELVGDDEPEPDLDLPPLPPPEAA* |
Ga0099829_104262612 | 3300009038 | Vadose Zone Soil | MTGSHAEEIVGDYFESDDWAEQLGADTEDEPDLDLPPLPPLRPEAA* |
Ga0099828_115525132 | 3300009089 | Vadose Zone Soil | MTGTHAEEIVGDYFESDDWAEQLGADTEDEPDLDLPPLPPLRPEAA* |
Ga0099827_100186075 | 3300009090 | Vadose Zone Soil | MPGSHAEEIVVDFLESEEWPEQLTDAEAEPDLDLPPLPPPRPEAA* |
Ga0099827_102051572 | 3300009090 | Vadose Zone Soil | MPGSHAEEIVGDYSNPDDWAEQLVGDTESEPDLDLPPLPPPRPEAA* |
Ga0066709_1023663932 | 3300009137 | Grasslands Soil | MPGSHAEEIVGDYFESDDWAEPLVDDTEAEPDLDLPPLPPPRPEAA* |
Ga0105242_109138952 | 3300009176 | Miscanthus Rhizosphere | MPGSHADEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPLRPEAA* |
Ga0126309_104523913 | 3300010039 | Serpentine Soil | VPGSHAEEIVVDYFEAEDWALLDDADAEPDLELPPLPPPAARGSAA* |
Ga0126310_102698654 | 3300010044 | Serpentine Soil | LPGSHAEDIVVDYFERADWAVLDDAEAEPDVDLPPLPQPPPQRAHGTR* |
Ga0126311_111142071 | 3300010045 | Serpentine Soil | LPGSHAEDIVVDYFERADWAVLDDAEAEPDVDLPPLPQPP |
Ga0127490_10376072 | 3300010093 | Grasslands Soil | MPGSHADDIVGEFFESDDWGELGGDDAASDEPDLDLPPLPPGPHAA* |
Ga0126319_12007611 | 3300010147 | Soil | MPGSHADEIVGDYFDPDDWAEKLMDDAEAEPDLDLPPLPPPRPDAA* |
Ga0127503_105170721 | 3300010154 | Soil | MTGSHAEEIVGDYFESDDWAEQLVDDTEAEPDLDLPSLPPLRPEAA |
Ga0134082_105520892 | 3300010303 | Grasslands Soil | MPGSHADDIVGEFFESDDWAKLAEEDGESEEPESDLDLPPLPPPRPEAA* |
Ga0134088_103358013 | 3300010304 | Grasslands Soil | GPNNDQGAVMPGSHAEEIVGDYSDPDDWAEQLMDEAEAESEPDLDLPPLPPRPEAA* |
Ga0134109_101998653 | 3300010320 | Grasslands Soil | TAARDNDQGAVMLGSHADEIVGDYFESDDWAEQLEDGEDEPDLELPPLPPPPEAA* |
Ga0134065_101803061 | 3300010326 | Grasslands Soil | MPGSHADEIVGDYFESDDWAEQLEDGEDEPDLELPPLPPPPEAA* |
Ga0134080_101550481 | 3300010333 | Grasslands Soil | ADEIVGDYFESDDWAEELVGDDEPEPDLDLPPLSPPEAA* |
Ga0134080_104139081 | 3300010333 | Grasslands Soil | MPGSHAEEIVGDYFDPDDWAEQLMEDTEAEPDLDLPP |
Ga0134071_105484231 | 3300010336 | Grasslands Soil | MPGSHAEEIVGDYSDPDDWAEQLMDEAEAESEPDLDLPPLPPRPEAA* |
Ga0134071_108146742 | 3300010336 | Grasslands Soil | MPGSHAEEIVGDYFESDDWAEQLGDDTEAEPELDLPPLPPPRPEAA |
Ga0134125_107128891 | 3300010371 | Terrestrial Soil | MPGSHADDIVADYFESDDWADELADMDAEPELDLPPLPP |
Ga0134125_128216722 | 3300010371 | Terrestrial Soil | MSGSHAEEIVGDYSDPDDWTELLLDDNEAEPDLDLPPLPPPR |
Ga0134128_105490973 | 3300010373 | Terrestrial Soil | MPGSNAEEIVWDYLESDDWAEQLLDDGDAEPDLDLPPLPPPRP* |
Ga0105239_110021822 | 3300010375 | Corn Rhizosphere | DKGAVMPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPPRHEAA* |
Ga0134126_103566331 | 3300010396 | Terrestrial Soil | IVGDYYESDDWAESFAEDAESEPDLDLPPLPPLRPEAA* |
Ga0126358_11033682 | 3300010856 | Boreal Forest Soil | MTGSHSEEIVGDYFESDDWAEQLVDDTEAEPDLDLPPLPPPRPEAA* |
Ga0126354_12122821 | 3300010857 | Boreal Forest Soil | MTGSHAEEIVGDYFESDDWAEQLGSDTEEEPDLDLPALPPLRPEAA* |
Ga0126349_10750602 | 3300010861 | Boreal Forest Soil | MPGSHADEIVGDYFESDDWPEQLVEETEAGPVLDLPPLPPPRPEAA* |
Ga0126348_10659762 | 3300010862 | Boreal Forest Soil | MPGSHAEAIVGDYLDSEDWAEQLVEDAEAEPDLDLPPLPQAPPEAA* |
Ga0138513_1000197422 | 3300011000 | Soil | MPGSHAEEIVGDSYESDDWAASFAEDAESEPDLDLPPLPPLRPEAA* |
Ga0137392_115450981 | 3300011269 | Vadose Zone Soil | MPGSHAEEIVGDYFESDDWAEQLGADTEDEPDLDLPPLPPLRPEAA* |
Ga0120157_10014766 | 3300011994 | Permafrost | MTGSHAEEIVGDYFDSDDWAEQLVDDAESEPDLDLPPLPPPRPEEA* |
Ga0120157_10409453 | 3300011994 | Permafrost | MTGSHAEEIVGDYLESDDWAEQLGSDTEDEPDLDLPPLPPLRPEAA* |
Ga0120148_10031227 | 3300011999 | Permafrost | MTGSHAEEIVGDYFDSDDWAEQLVDDAESEPDLDLPPLPPPRPEAA* |
Ga0120167_10169111 | 3300012001 | Permafrost | MPGSHAEEIVGDYFDSDDWAEQLVDDAESEPDLDLPPFPPPRPEAA* |
Ga0120167_11277901 | 3300012001 | Permafrost | MPGSHAEEIVGDYSDPDDWAEQLLDDTEAAPDLDLPPAPPAAS* |
Ga0120152_100147615 | 3300012011 | Permafrost | MTGSHAEEIVGDYFESDDWAEQLGSDTEDDPDLDLPPLPPLRPEAA* |
Ga0120152_10251552 | 3300012011 | Permafrost | MPGSHAEEIVGDYSDPDDWAEQLLDDTESEPDLDLPPLPPPRPEAA* |
Ga0120159_12109292 | 3300012014 | Permafrost | MTGSHAEEIVGDYFDSDDWAEQLVDDAESEPDLDLPPLPPPRPETA* |
Ga0120139_10135321 | 3300012019 | Permafrost | PGSHAEEIVGDYFDSDAWAEQLVDDAESEPDLDLPPLPPPRPEAA* |
Ga0137389_100701166 | 3300012096 | Vadose Zone Soil | MTGSHAEEIVGDYFESDDWAEQLGEDTEAEPGLDLPP |
Ga0137364_100346276 | 3300012198 | Vadose Zone Soil | MPGSHAEEIVGDYFESDDWAEQLVEDSEAEPDLDLPPLPPPHPEAA* |
Ga0137382_100920385 | 3300012200 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVEDGEAEPDLELPPLPPPPEAA* |
Ga0137382_105024212 | 3300012200 | Vadose Zone Soil | MPGSHAEEIVGDYYESDDWAESFAEDAESEPELDLPPLPPLRPEAA* |
Ga0137365_100042809 | 3300012201 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVDDSEAEPDLDLPPLPLPHPEAA* |
Ga0137365_100853832 | 3300012201 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVEDGEAEPDLDLPLLPPPEAA* |
Ga0137365_106364652 | 3300012201 | Vadose Zone Soil | MPGSHAEEIVGDYFESYDWAEQLGKDSEDEPDLDLPPLPPPHPEAA* |
Ga0137374_1000033751 | 3300012204 | Vadose Zone Soil | MPGSHAEEIVGDYFDPDGWAEQLMEDTEAEPDLDLPPLPPPRPEAA* |
Ga0137362_111753053 | 3300012205 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVEDGEAEPDLDIPPLPPPEAA* |
Ga0137380_100159999 | 3300012206 | Vadose Zone Soil | MPGSHAEEIVGDYSDPDDWAEQLMDEAEAESEPDLDLPPLPPPRPEAA* |
Ga0137380_107242461 | 3300012206 | Vadose Zone Soil | NDEGAVMPGSHAEEIVGDYFESDDWAEQLGKDSEDEPDLDLPPLPPPHIEAA* |
Ga0137381_114070231 | 3300012207 | Vadose Zone Soil | EIVGDYSDPDDWAEQLMDDTESEPDLDLPPLPPPRPEAA* |
Ga0137376_114178871 | 3300012208 | Vadose Zone Soil | GAVMPGSHADEIVGDYSDPDDWAEQLLDDTESEPDLDLPPLPPPRPEAA* |
Ga0137379_101383226 | 3300012209 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLGDDSEDEPDLDLPPLPPPH |
Ga0137379_112883093 | 3300012209 | Vadose Zone Soil | MPGSHAEEIVGGYSDPDEWAEQLMNEAEAEPDLDLRPLPAPRA |
Ga0150985_1139191782 | 3300012212 | Avena Fatua Rhizosphere | MPGSHADEIVADYFESEDWAALIDSDAEPELELPPVTPASRQPGA* |
Ga0137370_103371342 | 3300012285 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEELVGDDEPEPDLDLPPLSPPEAA* |
Ga0137387_109579472 | 3300012349 | Vadose Zone Soil | MPGSHAEEIVGDYFESDDWAEQLGDDSEDEPDLDLPPLPPPHPEAA* |
Ga0137372_100045735 | 3300012350 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVDDSEAEPDLDLPPLPPPHPEAA* |
Ga0137367_100352044 | 3300012353 | Vadose Zone Soil | MPGSHAEEIVGDYFDPDSWAEQLMEDTEAEPDLDLPPLPPPRPEAA* |
Ga0137366_106114341 | 3300012354 | Vadose Zone Soil | GAVMPGSHAEEIVGDYSDPDDWAKQLMDEAEAESEPDLDLPPLPPPRPEAA* |
Ga0137385_101272702 | 3300012359 | Vadose Zone Soil | MPGSHAEEIVGDYSDPDDWAEQLMNEAESEPDLDLPPLPPPRPEAA* |
Ga0137360_104813144 | 3300012361 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVEDGEAEPDLELPPLPPPE |
Ga0137361_106166252 | 3300012362 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVEDGEAEPDLELPPLPPPEAA* |
Ga0137390_106686221 | 3300012363 | Vadose Zone Soil | MPGSHAEEIVGDYSDPDDWAEQLLDDTEAEPELDLPPLPPPRPEAA* |
Ga0134043_11960202 | 3300012392 | Grasslands Soil | MPGSHAEEIVGDYSDPDDWAEQLMDEADAEAESEPELDLPPLPPPRPEAA* |
Ga0137397_101704593 | 3300012685 | Vadose Zone Soil | MRGSHAEEIVGDYFDPDDWTEQLMEDTEAEPDLDLPPLPLPPPEAA* |
Ga0157282_101693753 | 3300012904 | Soil | MPGSHAGEIVGDYFDPDDWAEKLMDDTETEPDLDL |
Ga0157297_101621571 | 3300012914 | Soil | GAVMPGSHADEIVGDYFDPDDWAEKLMDNTETEPDLDLPPLPPPRPEAA* |
Ga0137394_110905692 | 3300012922 | Vadose Zone Soil | MPGSHAEEIVGDYSDPDDWAEQLLAEGEAEPDLDLPPLPPPRPEAA* |
Ga0137419_102695434 | 3300012925 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVDDGEAEPDLDLPPLPPPRPEAA* |
Ga0137404_111416573 | 3300012929 | Vadose Zone Soil | MPGSHADEIVGDYFGSDDWAEQLVEDGEAEPDLDLPSLPPPE |
Ga0137407_100290675 | 3300012930 | Vadose Zone Soil | MLGSHADEIVGDYFESDDWAEQLVDDSEAEPDLDLPPLPPPHPEAA* |
Ga0164300_101270242 | 3300012951 | Soil | MPGSHADEIVGDYFDPDDWAEKLMDETETEPDLDLPPLPPPRPEAA* |
Ga0164300_101689862 | 3300012951 | Soil | MPGSHAEEIVGDYYESDDWAESFAQDAESEPDLDLPPLPPLRPEAA* |
Ga0164298_104112684 | 3300012955 | Soil | MSGSHAEEIVGDYFDPDDFFLKDTATTETEPDLDLPPLPPPRPEAA* |
Ga0164303_100182882 | 3300012957 | Soil | MPGSHADEIVGDYYESDDWAESFAQDAESEPDLDLPPLPPLRPEAA* |
Ga0164303_108603392 | 3300012957 | Soil | MLGSHADEIVGDYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPEAA* |
Ga0164299_100872445 | 3300012958 | Soil | MPGSHADEIVGDYYESDDWAESFAEDAESEPDLDLPP |
Ga0164299_109566122 | 3300012958 | Soil | YFDPDDWAEKLMDDTETEPDLELPPLPPPRPQAA* |
Ga0164302_102742181 | 3300012961 | Soil | MPGSHADEIVGAYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPEAA* |
Ga0164304_105949951 | 3300012986 | Soil | MPGSHADEIVGDYFDPDDWAEKLMDDTETEPDLELPPLPPPRPQAA* |
Ga0164307_101340795 | 3300012987 | Soil | MPGSHADEIVGDYYESDDWAESYAEDAESEPDLDLPPLPPLRPEAA* |
Ga0164305_109923673 | 3300012989 | Soil | MSGSHAEEIVGDYSDPDDWTELLLDDNEAEPDLELPPLPPPRPEAA* |
Ga0120154_100018933 | 3300013501 | Permafrost | DQGAVMPGSHAEEIVGDYFDSDDWAEQLVDDAESEPDLDLPPLPPPRPEAA* |
Ga0120123_10247351 | 3300013770 | Permafrost | MTGSHAEEIVGDYFESDDWAEQLGDTEEEPDLDLLPLPPLRPEAA* |
Ga0120158_100023401 | 3300013772 | Permafrost | GSHAEEIVGDYFDSDDWAEQLVDDAESEPDLDLPPLPPPRPEAA* |
Ga0120109_10112175 | 3300014052 | Permafrost | MTGSHAEEIVGDYFESDDWAEQLGDTEEEPDLDLPPLPPLRPEAA* |
Ga0134072_100478173 | 3300015357 | Grasslands Soil | MPGSHADEIVGDYFESEDWAALIDGDAKPELDVAPLWPPATREPAA* |
Ga0134089_102298691 | 3300015358 | Grasslands Soil | MPGSHADEIVGDYFESEDWAALIDSESDPELDLVPLWPPATRESAG* |
Ga0134083_102076341 | 3300017659 | Grasslands Soil | MPGSHAEEIVGDYSDPDDWAEQLMDEADAEAESEPELDLPPLPPPRPEAA |
Ga0134083_102286332 | 3300017659 | Grasslands Soil | MPGSHADEIVGDYFESEDWAALIDSESDPELDLVPLWPPATRESAG |
Ga0134083_103716102 | 3300017659 | Grasslands Soil | MPGSHAEEIVGDYFDPDDWAEQLMEDTEAEPDLDLP |
Ga0184604_100692542 | 3300018000 | Groundwater Sediment | MPGSHADEIVGDYFDPDDWAEKLMDDGETEPDLDLPPLPPPRPEAA |
Ga0184605_100061486 | 3300018027 | Groundwater Sediment | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPLRPEAA |
Ga0184605_100070477 | 3300018027 | Groundwater Sediment | MPGSHAEEIVGDYFDPDDWAEQLLDDTEAEPDLDL |
Ga0184605_100669311 | 3300018027 | Groundwater Sediment | MPGSHAEEIVGDYSDPDDWAEQLLDDTVAEPDLDLPPLPPPRPEAA |
Ga0184605_100767384 | 3300018027 | Groundwater Sediment | MPGSHADDIVGDYFESDDWAEQLVVDGEAEPDLDLPPLPPPRPEAA |
Ga0184605_102464152 | 3300018027 | Groundwater Sediment | MPGSHAEEIVGDYFEADDWAEQLVDDSEAEPDLDLPPLPPPHPEAA |
Ga0184605_102886681 | 3300018027 | Groundwater Sediment | MPGSHAEEIVGDYFESDDWAEQLVEDNEAEPDLDLPPLPPPHPEAA |
Ga0184605_104639052 | 3300018027 | Groundwater Sediment | MPGSHAEEIVGDYFDPDDWAEQLMDDTEAEPDLDLPPLPPPRPEAA |
Ga0184608_102803441 | 3300018028 | Groundwater Sediment | MPGSHAEEIVGDYFDPDDWAEQLIDDTEAEPDLDLPPLPPPRPEAA |
Ga0187788_103675422 | 3300018032 | Tropical Peatland | MGSHADDIVGDYFETADWDALDDEDGRPEPELELPPIPSAPPSQ |
Ga0184620_103285011 | 3300018051 | Groundwater Sediment | MPGSHADEIVGDYFDPDDWTEKLMDDTETEPDLDLPPLPPPRPDAA |
Ga0184621_101876981 | 3300018054 | Groundwater Sediment | MPGSHADEIVGDYFDPDDWAEKLMDDSETEPDLDLPPLPPPR |
Ga0184619_104712181 | 3300018061 | Groundwater Sediment | MPGSHADEIVGDYSDPDDWAEQLLEDTEAEPDLDLPPLPPPRPEAA |
Ga0184617_10130263 | 3300018066 | Groundwater Sediment | MPGSHADEIVGDYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPEAA |
Ga0184617_11806183 | 3300018066 | Groundwater Sediment | MPGSHAEEIVGDYSDPDDWAEQLLDDSEAEPELDLPPLPPLS |
Ga0184618_100399054 | 3300018071 | Groundwater Sediment | MPGSHAEEIVGDYFESDDWAEQLVEDSEAEPDLDLPPLPQPHPEAA |
Ga0184618_101776163 | 3300018071 | Groundwater Sediment | MPGSHAEEIVVDYFEAEDWADLAEVEAEPDLDLPP |
Ga0066655_107071852 | 3300018431 | Grasslands Soil | MPGSHAEEIVGDYSDPDDWAEQLMDEAEAESEPDLDLPPLPPRPEAA |
Ga0066667_109575231 | 3300018433 | Grasslands Soil | MPGSHAEEIVGDYFESDDWAEQLVDDSEAEPDLDLPPLPPPHPEAA |
Ga0066667_121393361 | 3300018433 | Grasslands Soil | MPGSPADDIVGDFFESDDWASLAKEDGDESEEPDLDLPPLPPPRPEAA |
Ga0066662_107384973 | 3300018468 | Grasslands Soil | MAGSHADDIVGEFFESDEWAKLAEQEAESEEPDLDPAPVPPRPEAA |
Ga0190273_119373422 | 3300018920 | Soil | MPGSHAEEIVGDYSDPDDWAEQLLDDTDAEPDLDLPPLPPPRREAA |
Ga0184645_12869751 | 3300019233 | Groundwater Sediment | MPGSHAEEIVGDYFDPDDWAEQMLDDTEAEPDLDLPPLPPPRPEAA |
Ga0184643_11796802 | 3300019255 | Groundwater Sediment | MPGSHAEEIVGDYFESDDWAEQLVEDSEAEPDLDLPPLPQ |
Ga0184643_12651882 | 3300019255 | Groundwater Sediment | MPGSHAEEIVGDYFDPDDWAEQLMEETEAEPDLDLPPLPPPRPEAA |
Ga0184644_14949422 | 3300019269 | Groundwater Sediment | MPGSHAEEIVGDYYESDDWAESFAEGADSEPDLDLPPLPPLRPEAA |
Ga0184642_16195242 | 3300019279 | Groundwater Sediment | MPGSHADEIVGDYFDPDDWAEKLMGDSETEPDVDLPPLPPPRPEAA |
Ga0173481_104752021 | 3300019356 | Soil | MPGSHADDIVGEFFESDDWAGLAKEDDDAEDPDLDFPPLPPRPEAA |
Ga0173481_107042372 | 3300019356 | Soil | MPGSRADEIVGDYFDPDDWAEKLMDDTDTEPDLDLPPLPPPRPDAA |
Ga0173479_104386221 | 3300019362 | Soil | MPGSHADEIVGDYFDPDDWAEKLMDDTETEPDLDLP |
Ga0193754_10105991 | 3300019872 | Soil | MPGSHAEEIVGDYYESDDWADSFAQDAESEPDLDLPPLPPPRPEAA |
Ga0193700_10214583 | 3300019873 | Soil | MPGSHADEIVGDYFDPDDWTEKLMDDTETEPDLDLPPLPPPRPQAA |
Ga0193701_10745981 | 3300019875 | Soil | MPGSHAEEIVGDYYESDDWAESFAEGADSEPDLDL |
Ga0193703_10606191 | 3300019876 | Soil | MPGSHADEIVGDYFDPDDWAEKLMDDTEAEPDLDLPPLPPPRPEAA |
Ga0193729_100000812 | 3300019887 | Soil | MTGSHAEEIVGDYFESDDWAEQLGTDTEEEPDLDLPPLPPLRPEAA |
Ga0193693_10364762 | 3300019996 | Soil | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPPRPEAA |
Ga0193731_10968011 | 3300020001 | Soil | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPL |
Ga0193696_10176884 | 3300020016 | Soil | EIVGDYYESDDWAESFTEDAESEPDLDLPPLPPLRPEAA |
Ga0193696_10767281 | 3300020016 | Soil | MPGSHAEEIVGDYYESDDWAESFTEDAESEPDLDLPPLPPLRPEEA |
Ga0210382_103865352 | 3300021080 | Groundwater Sediment | MPGSHADEIVGDYFDPDDWAEQLMDDTEAEPDLDLPPLPPPRPEAA |
Ga0193719_101251472 | 3300021344 | Soil | MPGSHAEEIVGDYSDPDDWAEKLMDDTEAEPDLDLPPLPPPRPEAA |
Ga0193750_10312973 | 3300021413 | Soil | MTGSHAEEIVGDYFESDDWGEQLGTDTEEEPDLDL |
Ga0222624_15713302 | 3300021951 | Groundwater Sediment | MPGSHAEEIVGDYYESDDWAESFAEGAESEPDLDLPPLPPLRPEAA |
Ga0222625_15617942 | 3300022195 | Groundwater Sediment | MPGSHAEEIVGDYSDPDDWAEQLLDDTEAEPDLDLPPLPPLRPEAA |
Ga0179589_103927112 | 3300024288 | Vadose Zone Soil | HNDKGAVMPGSHAEEIVGDYYESDDWAESFAEDAESEPELDLPPLPPLRPEAA |
Ga0179589_106202231 | 3300024288 | Vadose Zone Soil | MPGSHADEIVGDYYESDDWAESFAEDAESEPELDLPPLPPLRPEAA |
Ga0207653_102131821 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | EEIVGDYYESDDWAESFAEDAESEPDLDLPALPTPRPEAA |
Ga0207692_100743754 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPPRHEAA |
Ga0207680_100619316 | 3300025903 | Switchgrass Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPP |
Ga0207647_102198851 | 3300025904 | Corn Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLAAA |
Ga0207671_113226322 | 3300025914 | Corn Rhizosphere | NDKGAVMPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPALPTPRPEAA |
Ga0207662_101069625 | 3300025918 | Switchgrass Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPALP |
Ga0207700_115925592 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPALPT |
Ga0207709_100980651 | 3300025935 | Miscanthus Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPALPTPRPE |
Ga0207668_102497021 | 3300025972 | Switchgrass Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPP |
Ga0207702_113070801 | 3300026078 | Corn Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPALPTPR |
Ga0207698_121580241 | 3300026142 | Corn Rhizosphere | MPGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPPRP |
Ga0209438_11427691 | 3300026285 | Grasslands Soil | MRGSHAEEIVGDYFDPDDWTEQLMEDTEAEPDLDLPPLPLPPPEAA |
Ga0209239_12526542 | 3300026310 | Grasslands Soil | MPGSHADDIVGDFFESDDWASLAKEDGDESEEPDLDLP |
Ga0209267_13069311 | 3300026331 | Soil | MPGSHADEIVGDYFESDDWAEQLVEDGEPEPDLELPP |
Ga0209056_106389372 | 3300026538 | Soil | MPGSHADEIVGDFFESDEWAELAGEDAEGEPDLDLPPLPPPRPEAA |
Ga0209156_101027353 | 3300026547 | Soil | MPGSHADDIVGDFFESDDWASLAKEDGDKSEEPDLDLPPLPPPRPEAA |
Ga0209156_104859542 | 3300026547 | Soil | MPGSHADDIVGEFFESDDWAKLAEEDGESEEPDLDLP |
Ga0209161_105237212 | 3300026548 | Soil | MPGSHAEEIVVDYFECDDWADFVEAEAEPELDLPPLPPPAP |
Ga0209577_100889533 | 3300026552 | Soil | VPGSHAEEIVVDYFEGDDWAEFVEAEAEPDLDLPPLPSPAPRPAAA |
Ga0209811_100701852 | 3300027821 | Surface Soil | MPGSHAEEIVGDYYESDDWAESFAKDAESEPDLDLPPLPPPRPEAA |
Ga0209180_103884783 | 3300027846 | Vadose Zone Soil | MLGSHADEIVGDYLESDDWAEELVGDDEPEPDLDLPPLPPPEAA |
Ga0209283_102368525 | 3300027875 | Vadose Zone Soil | MPGSHAEEIVGDYSDPDDWAEQLLDDTEAEPELDLPPLPPPRPEAA |
Ga0209590_100130473 | 3300027882 | Vadose Zone Soil | MPGSHAEEIVVDFLESEEWPEQLTDAEAEPDLDLPPLPPPRPEAA |
Ga0209590_100250406 | 3300027882 | Vadose Zone Soil | AEEIVGDYSNPDDWAEQLVGDTESEPDLDLPPLPPPRPEAA |
Ga0209590_103021751 | 3300027882 | Vadose Zone Soil | MPGSHAEEIVGDYSNPDDWAEQLVGDTESEPDLDLPPLPPPRPEAA |
Ga0137415_103299433 | 3300028536 | Vadose Zone Soil | MPGSHADEIVGDYFESDDWAEQLVEDGEAEPDLELPPLPPPPEAA |
Ga0307276_100152864 | 3300028705 | Soil | MPGSHADEIVGDYFDPDDWAEKLMDNTETEPDLDLPPLPPPRPEAA |
Ga0307295_100370301 | 3300028708 | Soil | IVGDYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPEAA |
Ga0307279_100764912 | 3300028709 | Soil | MPGSHADEIVGDYFDPDDWAAKLMDDTETEPDLDLPPLPPPRPDAA |
Ga0307293_100981781 | 3300028711 | Soil | MPGSHADEIVGDYFDPDDWAEKLMDDTETEPDLDL |
Ga0307293_101284932 | 3300028711 | Soil | DHNDKGAVMPGSHAEEIVGDYYESDDWAESFAEGAESEPDLDLPPLPPLRPEAA |
Ga0307309_100130213 | 3300028714 | Soil | MGSHADEIVGDYSDPDDWAEQLLDDGEGEPDLDLPPLPPLRPETA |
Ga0307309_101254652 | 3300028714 | Soil | MPGSHADEIVGDYFDPDDWTEKLMDDTETGPDLDLPPLPPPRPQAA |
Ga0307313_100587821 | 3300028715 | Soil | MPGSHAEEIVGDYYESDDWAESFAEGAESEPDLDLPPLPP |
Ga0307298_100930451 | 3300028717 | Soil | MPGSHAEEIVVDYFEAEDWADLAEVEAEPDLDLPPLPQPTPQ |
Ga0307280_100185651 | 3300028768 | Soil | PGSHAEEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPLRPEAA |
Ga0307320_100226692 | 3300028771 | Soil | MPGSHADDIVGDYFESDDWAEQLVVDGEAEPGLDLPPLPPPRPEAA |
Ga0307288_100806934 | 3300028778 | Soil | MPGSHADEIVGDYFDPDDWTEKLMDDTETEPDLDLPP |
Ga0307282_102096722 | 3300028784 | Soil | SHAEEIVGDYFESDDWAEQLVEDNEAEPYLDLPPLPPPHPEAA |
Ga0307282_105369751 | 3300028784 | Soil | NDQGAVMPGSHADEIVGGYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPEAA |
Ga0307323_100040416 | 3300028787 | Soil | MPGSHAEEIVGDYYESDDWAESLAEDAESEPDLDLPPLPPLRPEAA |
Ga0307323_101524691 | 3300028787 | Soil | MPGSHAEEIVGEYFESDDWAEQLVEDNEAEPDLDLPPLPPPHPEA |
Ga0307323_103807862 | 3300028787 | Soil | QGAVMPGSHADEIVGDYFDPDDWAAKLMDDTETEPDLDLPPLPPPRPDAA |
Ga0307284_101524301 | 3300028799 | Soil | GPNNDQGAVMPGSHADEIVGDYFDPDDWTEKLMDDTETEPDLDLPPLPPPRPQAA |
Ga0307281_102003421 | 3300028803 | Soil | PTNDQGAVMPGSHAEEIVGDYSDPDDWAEQLMDDTEAEPDLDLPPLPPPRPEAA |
Ga0307305_100758191 | 3300028807 | Soil | NNDQGAVMPGSHADEIVGDYSDPDDWAEQLLDDTESEPDLDLPPLPPPRPEAA |
Ga0307305_104854432 | 3300028807 | Soil | MPGSHADEIVGDYSDPDDWAEQLLDDTESEPDLDLPPL |
Ga0307294_102160302 | 3300028810 | Soil | MPGSHADEIVGDYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPQAA |
Ga0307302_101285321 | 3300028814 | Soil | EIVGDYFDPDDWAEQLLDDTEAEPDLDLPPLPPPRPEAA |
Ga0307296_102746903 | 3300028819 | Soil | MPGSHADEIVGDYFDPDDWTEKLMDDTETEPDLDLPPLPPPR |
Ga0307312_101644093 | 3300028828 | Soil | DYFESDDWAEQLVEDNEAEPDLDLPPLPPLHPEAA |
Ga0307312_101689743 | 3300028828 | Soil | EIVGDYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPEAA |
Ga0307312_104645102 | 3300028828 | Soil | MPGSHAEEIVGDYSDPDDWAEQLLDDTESEPDLDLPPLPPPRPEAA |
Ga0307312_107253512 | 3300028828 | Soil | SHADEIVGDYFDPDDWTEKLMDDTETEPDLDLPPLPPPRPQAA |
Ga0307289_103949421 | 3300028875 | Soil | MPGSHAEEIVGDYFESDDWAEQLVEDNEAEPDLDLPPLPPRHPEAA |
Ga0307278_102663361 | 3300028878 | Soil | NDQGAVMPGSHAEEIVGDYFDPDDWAEQLMDDTEAEPDLDLPPLPPPRPEAA |
Ga0307277_100329623 | 3300028881 | Soil | MPGSHADEIVGDYSDPDDWAEQLLDDTESEPDLDLPPLPPPRPEAA |
Ga0307277_101437951 | 3300028881 | Soil | EEIVGDYFESDDWAEQLVEDNEAEPDLDLPPLPPPHPEAA |
Ga0307308_100490361 | 3300028884 | Soil | MPGSHAEEIVVDYFEAEDWADLAEVEAEPDLDLPPLPQPTPQPSAL |
Ga0307308_102722691 | 3300028884 | Soil | HAEEIVGDYFESDDWAEQLVEDNEAEPDLDLPPLPPPHPEAA |
Ga0307304_100031861 | 3300028885 | Soil | CGPKNDQGAVMPGSHADEIVGDYFDPDDWAEKLMDDTETEPDLDLPPLPPPRPEAA |
Ga0102757_113515632 | 3300030785 | Soil | MPGSHADEIVGDYSDPDDWAEQLLDDGEGEPDLDLPPLPPLRSDAA |
Ga0308189_105420552 | 3300031058 | Soil | MPGSHAEEIVGDYFESDDWAEQLVEDNEAEPDLDLPPLPPLHPEAA |
Ga0308197_103373432 | 3300031093 | Soil | MPGSHAEEIVGDYYESDDWAESFAEEAEPEPDLDLPPLPPLRPEAA |
Ga0307499_102364212 | 3300031184 | Soil | LFEERVAVTAATTTTKEQWMPGSHAEEIVGDYYESDDWAESLAEDAESEPDLDLPPLPPPRPEAA |
Ga0308194_100256081 | 3300031421 | Soil | MPGSHAEEIVGDYFESDDWAEQLVEDNEAEPDLDLPPVPPPHPEAA |
Ga0308194_103272982 | 3300031421 | Soil | MPGSHAEEIVGDYFDPDDWAEQLIEDTEAEPDLDLPPLPPPRPEAA |
Ga0308186_10349321 | 3300031422 | Soil | MPGSHAEEIVGDYFDPDDWTEQMMDEAEPDLDLPPLPPPRPEAA |
Ga0307468_1000594335 | 3300031740 | Hardwood Forest Soil | MPGSHADEIVGDYYESDDWAESFAEDAESEPDLDLPPLPPLRPEAA |
Ga0308175_1020835413 | 3300031938 | Soil | MPGSHADEIVGDYFESEDWAALDDGDAEPELDLPPLPPPSAA |
Ga0370544_23914_3_140 | 3300034447 | Soil | MPGSHAEEIVGDYFEADDWAEQLVDDSEAEPDLDLPPLPPPHPENA |
Ga0370545_141125_364_504 | 3300034643 | Soil | MPGSHAEEIVGDYSDPDDWAEQLMDDTEAEPDLDLPPLPPPRPEAA |
Ga0370548_099082_350_490 | 3300034644 | Soil | MPGSNAEEIVVDYFEGDDWAEFLDGEAEPELDLPALPPAASRPSAA |
Ga0370541_054763_88_228 | 3300034680 | Soil | MPGSHAEEIVGDYFDPDDWAEQMLDDTEAEPDLDLPPLPPPSPEAA |
Ga0370546_080479_367_507 | 3300034681 | Soil | MPGSHAEEIVGDYFDPDDWAEQLIDDTEAEPDLDLPPVPPPRPEAA |
⦗Top⦘ |