Basic Information | |
---|---|
Family ID | F011707 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 288 |
Average Sequence Length | 41 residues |
Representative Sequence | MAKPIPIGARGEAEETVEFQHTLTAHHPELPPVYSTPDMIR |
Number of Associated Samples | 235 |
Number of Associated Scaffolds | 288 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 67.01 % |
% of genes near scaffold ends (potentially truncated) | 98.96 % |
% of genes from short scaffolds (< 2000 bps) | 91.32 % |
Associated GOLD sequencing projects | 223 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.222 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.722 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.486 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.694 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.14% β-sheet: 0.00% Coil/Unstructured: 89.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 288 Family Scaffolds |
---|---|---|
PF14518 | Haem_oxygenas_2 | 47.92 |
PF02517 | Rce1-like | 9.03 |
PF01134 | GIDA | 7.64 |
PF08238 | Sel1 | 7.29 |
PF01833 | TIG | 3.12 |
PF03070 | TENA_THI-4 | 2.78 |
PF13932 | GIDA_C | 2.08 |
PF02870 | Methyltransf_1N | 0.69 |
PF00749 | tRNA-synt_1c | 0.69 |
PF00248 | Aldo_ket_red | 0.69 |
PF04909 | Amidohydro_2 | 0.69 |
PF14534 | DUF4440 | 0.69 |
PF12850 | Metallophos_2 | 0.69 |
PF14520 | HHH_5 | 0.35 |
PF00989 | PAS | 0.35 |
PF13432 | TPR_16 | 0.35 |
PF14691 | Fer4_20 | 0.35 |
PF14257 | DUF4349 | 0.35 |
PF02737 | 3HCDH_N | 0.35 |
PF00034 | Cytochrom_C | 0.35 |
PF16881 | LIAS_N | 0.35 |
PF04223 | CitF | 0.35 |
PF03544 | TonB_C | 0.35 |
PF13714 | PEP_mutase | 0.35 |
PF05974 | DUF892 | 0.35 |
PF03331 | LpxC | 0.35 |
PF00313 | CSD | 0.35 |
PF01171 | ATP_bind_3 | 0.35 |
PF00484 | Pro_CA | 0.35 |
PF13676 | TIR_2 | 0.35 |
PF00291 | PALP | 0.35 |
PF14684 | Tricorn_C1 | 0.35 |
PF12867 | DinB_2 | 0.35 |
PF12833 | HTH_18 | 0.35 |
COG ID | Name | Functional Category | % Frequency in 288 Family Scaffolds |
---|---|---|---|
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 9.03 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 9.03 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.69 |
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.35 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.35 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.35 |
COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.35 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.35 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.35 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.35 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.35 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.35 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.35 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.35 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.35 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.35 |
COG3051 | Citrate lyase, alpha subunit | Energy production and conversion [C] | 0.35 |
COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.35 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.57 % |
Unclassified | root | N/A | 2.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001305|C688J14111_10207045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300002155|JGI24033J26618_1061353 | Not Available | 553 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100281401 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101184720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 653 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101594844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 550 | Open in IMG/M |
3300002914|JGI25617J43924_10244724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 605 | Open in IMG/M |
3300003219|JGI26341J46601_10135195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 696 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10269102 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300004082|Ga0062384_100084417 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin063 | 1655 | Open in IMG/M |
3300004082|Ga0062384_100606831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300004152|Ga0062386_100634352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 874 | Open in IMG/M |
3300004157|Ga0062590_101033941 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300004479|Ga0062595_101801617 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha → Cimicoidea → Miridae → Mirinae → Mirini | 581 | Open in IMG/M |
3300004635|Ga0062388_102923411 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005167|Ga0066672_10718903 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300005171|Ga0066677_10255185 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300005175|Ga0066673_10885200 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005176|Ga0066679_10324490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1004 | Open in IMG/M |
3300005179|Ga0066684_11016627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 534 | Open in IMG/M |
3300005187|Ga0066675_10482494 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300005332|Ga0066388_100407216 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
3300005332|Ga0066388_100420104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1981 | Open in IMG/M |
3300005339|Ga0070660_100015936 | All Organisms → cellular organisms → Bacteria | 5443 | Open in IMG/M |
3300005367|Ga0070667_100017411 | All Organisms → cellular organisms → Bacteria | 5956 | Open in IMG/M |
3300005458|Ga0070681_10630460 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300005458|Ga0070681_11084424 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005458|Ga0070681_11342387 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300005471|Ga0070698_100606505 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300005530|Ga0070679_100242819 | All Organisms → cellular organisms → Bacteria | 1758 | Open in IMG/M |
3300005533|Ga0070734_10612292 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300005534|Ga0070735_10113530 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
3300005536|Ga0070697_101007370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
3300005537|Ga0070730_10006212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10236 | Open in IMG/M |
3300005537|Ga0070730_10585789 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300005538|Ga0070731_10211742 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300005538|Ga0070731_10258654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1155 | Open in IMG/M |
3300005540|Ga0066697_10828597 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005541|Ga0070733_10121052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1682 | Open in IMG/M |
3300005547|Ga0070693_100312883 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300005554|Ga0066661_10937219 | Not Available | 506 | Open in IMG/M |
3300005561|Ga0066699_10390702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
3300005568|Ga0066703_10556644 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300005602|Ga0070762_10157611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1363 | Open in IMG/M |
3300005610|Ga0070763_10170651 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300005764|Ga0066903_100001389 | All Organisms → cellular organisms → Bacteria | 17635 | Open in IMG/M |
3300005764|Ga0066903_105510966 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005764|Ga0066903_105906168 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005764|Ga0066903_107000783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
3300005843|Ga0068860_101763506 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300005921|Ga0070766_10346478 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300005938|Ga0066795_10150570 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300005995|Ga0066790_10208508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 835 | Open in IMG/M |
3300006050|Ga0075028_100304520 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300006059|Ga0075017_100543870 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300006059|Ga0075017_101084479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 625 | Open in IMG/M |
3300006086|Ga0075019_10715029 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300006162|Ga0075030_100212251 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300006162|Ga0075030_101039038 | Not Available | 645 | Open in IMG/M |
3300006163|Ga0070715_11069694 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300006176|Ga0070765_100450973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1205 | Open in IMG/M |
3300006176|Ga0070765_101642480 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300006354|Ga0075021_11116937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 516 | Open in IMG/M |
3300006755|Ga0079222_10311590 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300006794|Ga0066658_10173540 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300006903|Ga0075426_10201937 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300009029|Ga0066793_10722384 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300009089|Ga0099828_11355370 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300009148|Ga0105243_11064261 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300009523|Ga0116221_1209998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
3300009524|Ga0116225_1326046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 685 | Open in IMG/M |
3300009545|Ga0105237_11818004 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300009623|Ga0116133_1064069 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300009623|Ga0116133_1191972 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300009672|Ga0116215_1008786 | All Organisms → cellular organisms → Bacteria | 5043 | Open in IMG/M |
3300009698|Ga0116216_10020856 | All Organisms → cellular organisms → Bacteria | 4105 | Open in IMG/M |
3300009764|Ga0116134_1285793 | Not Available | 567 | Open in IMG/M |
3300010339|Ga0074046_10615149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 642 | Open in IMG/M |
3300010343|Ga0074044_10726937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 648 | Open in IMG/M |
3300010376|Ga0126381_102369494 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300010379|Ga0136449_101726691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 941 | Open in IMG/M |
3300010379|Ga0136449_103554416 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300011078|Ga0138565_1083618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 569 | Open in IMG/M |
3300011269|Ga0137392_10660365 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300011269|Ga0137392_10954560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 705 | Open in IMG/M |
3300011270|Ga0137391_11578886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 500 | Open in IMG/M |
3300011271|Ga0137393_11392665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 590 | Open in IMG/M |
3300011271|Ga0137393_11785686 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012096|Ga0137389_10096690 | All Organisms → cellular organisms → Bacteria | 2339 | Open in IMG/M |
3300012096|Ga0137389_11694193 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300012200|Ga0137382_11137841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 556 | Open in IMG/M |
3300012202|Ga0137363_11287379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 619 | Open in IMG/M |
3300012206|Ga0137380_10175169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1952 | Open in IMG/M |
3300012207|Ga0137381_10189199 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
3300012207|Ga0137381_11643105 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300012209|Ga0137379_11260982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 646 | Open in IMG/M |
3300012210|Ga0137378_11116484 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300012211|Ga0137377_10449733 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300012349|Ga0137387_11264081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 518 | Open in IMG/M |
3300012351|Ga0137386_10120956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1863 | Open in IMG/M |
3300012362|Ga0137361_11477785 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300012363|Ga0137390_10482596 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300012922|Ga0137394_11034886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 681 | Open in IMG/M |
3300012929|Ga0137404_10658473 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300012930|Ga0137407_11128952 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300012975|Ga0134110_10137377 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300014158|Ga0181521_10230047 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
3300014168|Ga0181534_10670504 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300014168|Ga0181534_10779852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 564 | Open in IMG/M |
3300014169|Ga0181531_11029688 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300014200|Ga0181526_10115546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1717 | Open in IMG/M |
3300014201|Ga0181537_11222653 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300014638|Ga0181536_10153194 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300014638|Ga0181536_10438617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 577 | Open in IMG/M |
3300015371|Ga0132258_13818533 | Not Available | 1026 | Open in IMG/M |
3300016294|Ga0182041_10507049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1047 | Open in IMG/M |
3300016357|Ga0182032_11763401 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300017822|Ga0187802_10428146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 525 | Open in IMG/M |
3300017823|Ga0187818_10526696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 531 | Open in IMG/M |
3300017930|Ga0187825_10206781 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300017931|Ga0187877_1104648 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
3300017933|Ga0187801_10068453 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300017933|Ga0187801_10098083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1110 | Open in IMG/M |
3300017934|Ga0187803_10107386 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300017934|Ga0187803_10131121 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300017934|Ga0187803_10186179 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300017935|Ga0187848_10350256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 612 | Open in IMG/M |
3300017940|Ga0187853_10196510 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300017940|Ga0187853_10321226 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300017943|Ga0187819_10099949 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
3300017946|Ga0187879_10788465 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300017966|Ga0187776_11094737 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300017972|Ga0187781_10007645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7891 | Open in IMG/M |
3300017973|Ga0187780_10240254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1267 | Open in IMG/M |
3300017973|Ga0187780_10930812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 632 | Open in IMG/M |
3300017974|Ga0187777_11068279 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300017975|Ga0187782_10206577 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300017975|Ga0187782_11568947 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300017994|Ga0187822_10154182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 740 | Open in IMG/M |
3300017995|Ga0187816_10071598 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300017999|Ga0187767_10155030 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300018007|Ga0187805_10575841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 531 | Open in IMG/M |
3300018020|Ga0187861_10235539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 804 | Open in IMG/M |
3300018022|Ga0187864_10301872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 715 | Open in IMG/M |
3300018026|Ga0187857_10026743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3144 | Open in IMG/M |
3300018034|Ga0187863_10822650 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300018038|Ga0187855_10771319 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300018042|Ga0187871_10624370 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300018046|Ga0187851_10496018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 693 | Open in IMG/M |
3300018057|Ga0187858_10168865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1446 | Open in IMG/M |
3300018085|Ga0187772_10114833 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin063 | 1749 | Open in IMG/M |
3300018086|Ga0187769_10249975 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300018086|Ga0187769_10285167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1233 | Open in IMG/M |
3300018086|Ga0187769_11051260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 616 | Open in IMG/M |
3300018086|Ga0187769_11547035 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300018090|Ga0187770_10617004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 863 | Open in IMG/M |
3300018433|Ga0066667_11839790 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300018468|Ga0066662_10138907 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300018468|Ga0066662_11206384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 766 | Open in IMG/M |
3300018468|Ga0066662_12705199 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300019270|Ga0181512_1255347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 749 | Open in IMG/M |
3300019275|Ga0187798_1801028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 571 | Open in IMG/M |
3300019284|Ga0187797_1165923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 967 | Open in IMG/M |
3300019787|Ga0182031_1079123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 519 | Open in IMG/M |
3300019787|Ga0182031_1161556 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
3300019881|Ga0193707_1085873 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300020580|Ga0210403_11208450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 582 | Open in IMG/M |
3300020582|Ga0210395_10323536 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300020582|Ga0210395_11297088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 533 | Open in IMG/M |
3300020582|Ga0210395_11393951 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300021088|Ga0210404_10607778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 622 | Open in IMG/M |
3300021170|Ga0210400_10485293 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300021171|Ga0210405_11330344 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300021181|Ga0210388_10179778 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
3300021181|Ga0210388_10596267 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300021181|Ga0210388_11000733 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300021401|Ga0210393_10010436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7225 | Open in IMG/M |
3300021401|Ga0210393_10887947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
3300021402|Ga0210385_10708850 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300021404|Ga0210389_11385555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 537 | Open in IMG/M |
3300021420|Ga0210394_10085177 | All Organisms → cellular organisms → Bacteria | 2729 | Open in IMG/M |
3300021432|Ga0210384_10497064 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300021432|Ga0210384_10506933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1086 | Open in IMG/M |
3300021433|Ga0210391_10119134 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
3300021433|Ga0210391_11257868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 572 | Open in IMG/M |
3300021477|Ga0210398_10153451 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
3300021477|Ga0210398_10383144 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300021478|Ga0210402_10709093 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300021559|Ga0210409_10523957 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300021560|Ga0126371_12614268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 611 | Open in IMG/M |
3300021861|Ga0213853_10211056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 718 | Open in IMG/M |
3300021861|Ga0213853_11364129 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300022521|Ga0224541_1033115 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300023090|Ga0224558_1069468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1336 | Open in IMG/M |
3300025612|Ga0208691_1003943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4530 | Open in IMG/M |
3300025912|Ga0207707_11403482 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300025913|Ga0207695_11260353 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300025917|Ga0207660_10190417 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300025918|Ga0207662_11122539 | Not Available | 559 | Open in IMG/M |
3300025921|Ga0207652_10220220 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
3300025923|Ga0207681_10947384 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300025939|Ga0207665_10719049 | Not Available | 786 | Open in IMG/M |
3300026469|Ga0257169_1025296 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300026497|Ga0257164_1050185 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300026542|Ga0209805_1229061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 765 | Open in IMG/M |
3300027172|Ga0208098_1020213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 659 | Open in IMG/M |
3300027604|Ga0208324_1046932 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
3300027629|Ga0209422_1007289 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2721 | Open in IMG/M |
3300027641|Ga0208827_1146403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 660 | Open in IMG/M |
3300027662|Ga0208565_1028380 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
3300027667|Ga0209009_1073102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 864 | Open in IMG/M |
3300027676|Ga0209333_1123752 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300027729|Ga0209248_10012462 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
3300027783|Ga0209448_10080319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1093 | Open in IMG/M |
3300027795|Ga0209139_10038776 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
3300027815|Ga0209726_10074316 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
3300027825|Ga0209039_10333055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300027842|Ga0209580_10008979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4284 | Open in IMG/M |
3300027869|Ga0209579_10317358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 841 | Open in IMG/M |
3300027875|Ga0209283_10707490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus | 628 | Open in IMG/M |
3300027879|Ga0209169_10627987 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300027884|Ga0209275_10358013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 818 | Open in IMG/M |
3300027895|Ga0209624_10648858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 698 | Open in IMG/M |
3300027903|Ga0209488_11233215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
3300027905|Ga0209415_10712805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 716 | Open in IMG/M |
3300027905|Ga0209415_10794351 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300027911|Ga0209698_10433217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1024 | Open in IMG/M |
3300028380|Ga0268265_10042613 | All Organisms → cellular organisms → Bacteria | 3369 | Open in IMG/M |
3300028731|Ga0302301_1127749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 640 | Open in IMG/M |
3300028734|Ga0302206_1085139 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300028746|Ga0302233_10322725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 584 | Open in IMG/M |
3300028762|Ga0302202_10446842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 592 | Open in IMG/M |
3300028874|Ga0302155_10221446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 823 | Open in IMG/M |
3300029882|Ga0311368_10936857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 577 | Open in IMG/M |
3300029903|Ga0247271_100763 | All Organisms → cellular organisms → Bacteria | 8638 | Open in IMG/M |
3300029914|Ga0311359_10616565 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
3300029984|Ga0311332_10798740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 752 | Open in IMG/M |
3300029999|Ga0311339_10028636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8008 | Open in IMG/M |
3300030506|Ga0302194_10305671 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300030580|Ga0311355_10918250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 793 | Open in IMG/M |
3300030706|Ga0310039_10049949 | All Organisms → cellular organisms → Bacteria | 1858 | Open in IMG/M |
3300030741|Ga0265459_10645392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 995 | Open in IMG/M |
3300030760|Ga0265762_1060555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 777 | Open in IMG/M |
3300030813|Ga0265750_1040114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 676 | Open in IMG/M |
3300030815|Ga0265746_1008607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1107 | Open in IMG/M |
3300030838|Ga0311335_10613958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300031027|Ga0302308_10433918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 783 | Open in IMG/M |
3300031247|Ga0265340_10484118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 545 | Open in IMG/M |
3300031525|Ga0302326_11413365 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
3300031681|Ga0318572_10645120 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300031708|Ga0310686_117041430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 540 | Open in IMG/M |
3300031708|Ga0310686_118398637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 641 | Open in IMG/M |
3300031708|Ga0310686_119426420 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
3300031718|Ga0307474_10417801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1045 | Open in IMG/M |
3300031718|Ga0307474_11198136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 600 | Open in IMG/M |
3300031720|Ga0307469_11246492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 704 | Open in IMG/M |
3300031753|Ga0307477_10624203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 725 | Open in IMG/M |
3300031754|Ga0307475_10108739 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
3300031754|Ga0307475_10234295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1470 | Open in IMG/M |
3300031820|Ga0307473_10369122 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300031823|Ga0307478_10457927 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300031823|Ga0307478_11103370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 662 | Open in IMG/M |
3300031918|Ga0311367_12346618 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300031941|Ga0310912_10834873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 711 | Open in IMG/M |
3300031962|Ga0307479_11066676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
3300031962|Ga0307479_11200088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 722 | Open in IMG/M |
3300031962|Ga0307479_11568218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 614 | Open in IMG/M |
3300032001|Ga0306922_11863108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 590 | Open in IMG/M |
3300032160|Ga0311301_10741506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1367 | Open in IMG/M |
3300032174|Ga0307470_11095071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 640 | Open in IMG/M |
3300032180|Ga0307471_100715445 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300032180|Ga0307471_103343150 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300032205|Ga0307472_100487601 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300032205|Ga0307472_102764067 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300032515|Ga0348332_14449293 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300032783|Ga0335079_12375891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 502 | Open in IMG/M |
3300032805|Ga0335078_11941092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300032828|Ga0335080_10301551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1739 | Open in IMG/M |
3300032829|Ga0335070_10119770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2722 | Open in IMG/M |
3300032892|Ga0335081_12087821 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300032893|Ga0335069_12231951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 572 | Open in IMG/M |
3300032896|Ga0335075_11690814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 515 | Open in IMG/M |
3300032898|Ga0335072_11388748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 608 | Open in IMG/M |
3300032955|Ga0335076_10002343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 18790 | Open in IMG/M |
3300033004|Ga0335084_10789793 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300033233|Ga0334722_10074247 | All Organisms → cellular organisms → Bacteria | 2621 | Open in IMG/M |
3300033475|Ga0310811_11013435 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300033561|Ga0371490_1138479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 611 | Open in IMG/M |
3300034163|Ga0370515_0323666 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.72% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.68% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.90% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.86% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.86% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.86% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.47% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.47% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.12% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.12% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.78% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.43% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.43% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.74% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.39% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.39% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.04% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.04% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.69% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.69% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.69% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.69% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.35% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.35% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.35% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.35% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.35% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.35% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.35% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.35% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.35% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.35% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.35% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.35% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.35% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.35% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.35% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027172 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF038 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028734 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_1 | Environmental | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J14111_102070451 | 3300001305 | Soil | MAKPVPIGSKGEARQTVEFKHTLSAHHEQLPPVYS |
JGI24033J26618_10613532 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKPMTIGARGEAQETVTFQQTLTAHHPSLPPVYS |
JGIcombinedJ26739_1002814012 | 3300002245 | Forest Soil | LANNIPLGARGEAEETVEFKHTLTSHHPELPPVYSTPDMIRLMETAAF |
JGIcombinedJ26739_1011847201 | 3300002245 | Forest Soil | MPKEVPIGVRGDTQQTVEFKHTLTAHRPELPPVYST |
JGIcombinedJ26739_1015948441 | 3300002245 | Forest Soil | MAKEIPIGANGEARETVEFKHTLAAHHPELPPVYSTPDMIRL |
JGI25617J43924_102447242 | 3300002914 | Grasslands Soil | MAKPIPIGACGDARETVEFKHTLTAHHAKLPPVYSTPDMIRLMETAA |
JGI26341J46601_101351952 | 3300003219 | Bog Forest Soil | LAKEIPIGARGEAQETVEFKHTLTAHHPQLPPVYSTPDMI |
JGIcombinedJ51221_102691022 | 3300003505 | Forest Soil | MARDIPIGVRGEAVETVELKHTLAAHNPQLPPVYSTPDMIRLMETA |
Ga0062384_1000844172 | 3300004082 | Bog Forest Soil | MAKEIPIGAGGEAQQTVEFKHTLTAHRPELPPVYSTPHMI |
Ga0062384_1006068311 | 3300004082 | Bog Forest Soil | MAKEVPLGARGEAKETVEFKHTLTAHRPELPPVYSTPHMIGLM |
Ga0062386_1006343521 | 3300004152 | Bog Forest Soil | VTRLIPIGARGEAQETVEFKHTLTAQHPELPPVYSTPDMIRL |
Ga0062590_1010339411 | 3300004157 | Soil | MAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIR |
Ga0062595_1018016171 | 3300004479 | Soil | VKQVPLGSRGEAREPVAFNHTLTAHHPELPPVYSTPDMIRLME |
Ga0062388_1029234111 | 3300004635 | Bog Forest Soil | MAHHIPIGVAGEAEETVELKHTLAAHHAELPPVYSTPDMIRLMETA |
Ga0066672_107189032 | 3300005167 | Soil | MAQPVPIGVRGESEQTVEFEHTLTYHNKALPPVYSTPHMIAL |
Ga0066677_102551851 | 3300005171 | Soil | MPKAMPIGARATAEQTVEFKHTLTAHHSELPPVYSTPDMIRLM |
Ga0066673_108852002 | 3300005175 | Soil | MARPVPIGTRGDAEETVDFKHTLTAHHDSLPPVYSTPDMIRLM |
Ga0066679_103244902 | 3300005176 | Soil | LARAIPIGARGEAEETVTFEHTLTAQHPELPPVYSTPDMI |
Ga0066684_110166272 | 3300005179 | Soil | MVQPVPPGVRGESEQTVEFEHTLTYHNKALPPVYSTPHMIALM |
Ga0066675_104824941 | 3300005187 | Soil | MPIGAHATAEETVEFKHTLTAHHPELPPVYSTPDMIRLMETAAFL |
Ga0066388_1004072163 | 3300005332 | Tropical Forest Soil | MAKPVPMGAQGKAAETVEFQHTLTAHHPKLPPVYSTPDMIRL |
Ga0066388_1004201043 | 3300005332 | Tropical Forest Soil | VKDVPIGVRGQAAETVEFRHTLTAHHASLPPAYSTPDMIRLMETAA |
Ga0070660_1000159361 | 3300005339 | Corn Rhizosphere | MAKAMPLGVRGEVQQTVELKHTLAAHNPNLPPVYSTPDMIRLMEI |
Ga0070667_1000174111 | 3300005367 | Switchgrass Rhizosphere | MAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMI |
Ga0070681_106304602 | 3300005458 | Corn Rhizosphere | MAKAMPIGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLME |
Ga0070681_110844242 | 3300005458 | Corn Rhizosphere | MAKAMPIGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLM |
Ga0070681_113423871 | 3300005458 | Corn Rhizosphere | MAKPVPIGARGEARQTVEFKHTLSAHHEQLPPVYSTPDMIRL |
Ga0070698_1006065052 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRPIPIGACGEAAETVELKHTLSAHHPELPPVYSTPDMIR |
Ga0070679_1002428191 | 3300005530 | Corn Rhizosphere | MAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEIACFQ |
Ga0070734_106122921 | 3300005533 | Surface Soil | MAKAMPVGTRGTAEETVEFKHTLSAHHPELPPVYSTPDMIRLMETAA |
Ga0070735_101135301 | 3300005534 | Surface Soil | MAKPIPIGARGEASETVEFKHTLTAHHPELPPVYSTPDMIRLMEIAAF |
Ga0070697_1010073702 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMPRPIPIGARGEAEETVEFKHTLTAHHSSLPPVYSTPDM |
Ga0070730_100062121 | 3300005537 | Surface Soil | MAKPIPIGARGEARETVEFKHTLTSHHETLPPIYSTPDMIRLME |
Ga0070730_105857891 | 3300005537 | Surface Soil | MAKPVPIGARGEARETVEFKHTLTSHHETLPPIYSTPDMIRLME |
Ga0070731_102117421 | 3300005538 | Surface Soil | MAKKIPLGVRGEAEETVEFEHTLTSHHPELPPVYSTPDMIRLMET |
Ga0070731_102586541 | 3300005538 | Surface Soil | VAKEIPLGVRGEAEETVEFEHTLTSHHPELPPVYSTPDMIRLMET |
Ga0066697_108285971 | 3300005540 | Soil | MAKPVPIGSRGEAEETVEFRHTLTAHHQELPPVYSTPDMI |
Ga0070733_101210521 | 3300005541 | Surface Soil | MDIPIGARGAAEETVEFKHTLTAHHPELPPVYSTPDMIRLMETAAFR |
Ga0070693_1003128831 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VKKVPIGARGEANETVEFEHTLTSHHPELPAVYSTPDMIRLMETA |
Ga0066661_109372192 | 3300005554 | Soil | MAKPVPIGVRGESEQKVEFEHTLTYHNKALPPVYSTPHMIA |
Ga0066699_103907023 | 3300005561 | Soil | MVKPIPIGARAEAEETVEFQHTLTAHHPELPPVYSTPDMIRLMETA |
Ga0066703_105566442 | 3300005568 | Soil | MAKLVPIGARGTAEQTVKFKHTLTAHHPELPQVYSTPDMVRL |
Ga0070762_101576111 | 3300005602 | Soil | MAKQIPIGVSGKEQQTVEFKHTLTAHGAELPPVYSTPHMIG |
Ga0070763_101706511 | 3300005610 | Soil | MAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEFAAF |
Ga0066903_1000013891 | 3300005764 | Tropical Forest Soil | MPRFIPIGARGEAEETVEFKHTLTAHHESLPPVYSTPDMIRLMET |
Ga0066903_1055109662 | 3300005764 | Tropical Forest Soil | MAREIPIGAKATAEETVEFKHTLTAHHPELPPVYST |
Ga0066903_1059061681 | 3300005764 | Tropical Forest Soil | MAKQVPIGTRAEASETVAFEHTLTSHHQQLPPVYSTPDMIRLMET |
Ga0066903_1070007832 | 3300005764 | Tropical Forest Soil | LSVPKRIPIGVRGDAEETVEFKHTLTSHDPSLPPVYSTPD |
Ga0068860_1017635062 | 3300005843 | Switchgrass Rhizosphere | VKKAPIGARGEAHETVEFEHTLTSHHPELPAVYST |
Ga0070766_103464782 | 3300005921 | Soil | MAKAIPIGVRGEAEETVEFKDTLTAHHPELPPVYSTPDMIRLMETAA |
Ga0066795_101505701 | 3300005938 | Soil | MARPIPIGTRGEAAETVEVKHTLSAHHPELPPVYSTPDMIRLMETAC |
Ga0066790_102085081 | 3300005995 | Soil | MAREVPIGTRAQVELTVELKHTLAAHNPNLPPVYSTPDMIRLMEIAAFAA |
Ga0075028_1003045202 | 3300006050 | Watersheds | MARPIPIGVRGEAAETVESKHTLSAHHPELPPVYSTPDMI |
Ga0075017_1005438701 | 3300006059 | Watersheds | MARPIPLGVRGEAEETVELKHTLAGHHPELPPVYSTPDMIRLM |
Ga0075017_1010844792 | 3300006059 | Watersheds | LAKEIPIGVRGEAEETVQFEHTLTSHHPELPPVYS |
Ga0075019_107150292 | 3300006086 | Watersheds | MAKPMPIGARGEAEETVEFKHTLTSHHPELPPVYSTPDMIRLMETAC |
Ga0075030_1002122511 | 3300006162 | Watersheds | MAKAMPIGARGTAEETVEFQHTLTAHHPELPPVYSTPDMIRLMET |
Ga0075030_1010390382 | 3300006162 | Watersheds | MARPIPLGTRGEAEQTVELKHTLAGHRAELPPVYS |
Ga0070715_110696942 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MARLIPLGASAEAEETVEFKHTLTAHHGSLPPVYSTPDM |
Ga0070765_1004509731 | 3300006176 | Soil | MAKQIPLGARGEARETVEFKHTLTAHHPELPPVYSTPDMIRLME |
Ga0070765_1016424802 | 3300006176 | Soil | MQIPIGARGEAQQTVEFKHTLTAHRSELPPIYSTPHMIGLMETA |
Ga0075021_111169371 | 3300006354 | Watersheds | MVRPIPIGVRGEAAETVEFKHTLSAHHPELPPVYS |
Ga0079222_103115901 | 3300006755 | Agricultural Soil | MARLIPLGASAEAEETVEFKHTLTAHHGSLPPVYSTPDMIRLMETAA |
Ga0066658_101735402 | 3300006794 | Soil | MDMPKPMPIGAHATAEETVEFKHTLTAHHPELPPVYSTPDMIRL |
Ga0075426_102019373 | 3300006903 | Populus Rhizosphere | MPREIAIGARGEAEETVAFEHTLTSHHPELPPVYSTPDMIRLME |
Ga0066793_107223841 | 3300009029 | Prmafrost Soil | MARPIPIGTRGEAAETVEVKHTLSAHHPELPPVYSTPDMI |
Ga0099828_113553701 | 3300009089 | Vadose Zone Soil | MNHPSMAKTIPIGAHGEAEETVEFEHTLTAHHPTLPPVYSTPDMIRL |
Ga0105243_110642612 | 3300009148 | Miscanthus Rhizosphere | MAKPMTIGARGEAQETVTFQQTLTAHHPSLPPVYSTPD |
Ga0116221_12099982 | 3300009523 | Peatlands Soil | MAKAMPIGARGAAEETVEFEHTLTAHHPELPPVYST |
Ga0116225_13260461 | 3300009524 | Peatlands Soil | MAKAMPIGPRGKAEETVEFKHTLTAHHPELPPVYSTPDMIRLMETA |
Ga0105237_118180041 | 3300009545 | Corn Rhizosphere | MAKAMPLGVRGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEIA |
Ga0116133_10640692 | 3300009623 | Peatland | MVRPIPIGVRGEAEETVELKHTLAAQHPELPPVYSTPDMIRLMETAGF |
Ga0116133_11919722 | 3300009623 | Peatland | VARHIPIGVCAEVQEVVERRHTLAAHHPELPPVYSTPDMIR |
Ga0116215_10087864 | 3300009672 | Peatlands Soil | MAKPIPLGARGTAEETVEFKHTLTAHHPELPPVYSTPDMIRLM* |
Ga0116216_100208564 | 3300009698 | Peatlands Soil | MAKAMPIGARATVEETVEFKHTLTSHHPELPPVYS |
Ga0116134_12857931 | 3300009764 | Peatland | MAKAVPIGARGEAEKRTKFQHTLTAWGGELPPVRS |
Ga0074046_106151491 | 3300010339 | Bog Forest Soil | LEDEFLAKDIPIGARGEAEETVEFKHTLTSHHAQLPPVYSTPDM |
Ga0074044_107269372 | 3300010343 | Bog Forest Soil | MARPIPIGVRGEAVETVELKHTLSAHHPELPPVYSTPDMIRLME |
Ga0126381_1023694941 | 3300010376 | Tropical Forest Soil | MAKAMPIGARGSAAETVEFKHTLTAHHPELPPVYSTPDMIR |
Ga0136449_1017266911 | 3300010379 | Peatlands Soil | MAKQIPIGARGEARETVEFKHTLTAHHAELPPVYSTPDMIRLME |
Ga0136449_1035544161 | 3300010379 | Peatlands Soil | MAKQILIGARGEARETVEFKHTLTAHHAELPPVYSTPDMIRLMEI |
Ga0138565_10836182 | 3300011078 | Peatlands Soil | LAKDIPIGTRGEAEETVAFEHTLTSRHPELPPVYSTPHMIGLME |
Ga0137392_106603652 | 3300011269 | Vadose Zone Soil | MARPIPIGTRGEASETVELKHTLSAHHAELPPVYSTPDMIR |
Ga0137392_109545602 | 3300011269 | Vadose Zone Soil | MPKQIPIGVRGEAQETVEFKHTLTAHHAELPPVYSTP |
Ga0137391_115788862 | 3300011270 | Vadose Zone Soil | MARPIPIGTRGEASETVELKHTLSAHHAELPPVYSTPDMIRLME |
Ga0137393_113926651 | 3300011271 | Vadose Zone Soil | VAVARDIPFGARGQAEETVAFEHTLTSHHPDLPPVYSTPDMIRLMET |
Ga0137393_117856862 | 3300011271 | Vadose Zone Soil | MSKPVPVGTRGEAEETVEFRHTLSSHHAELPPVYSTPDMI |
Ga0137389_100966901 | 3300012096 | Vadose Zone Soil | MAKETPIGARGDAEETVEFKHTLTAYHPELPPVYST |
Ga0137389_116941932 | 3300012096 | Vadose Zone Soil | MPKPIPIGTRGEARETVEFKHTLTSHHEMLPPVYSTPDMVRLM |
Ga0137382_111378412 | 3300012200 | Vadose Zone Soil | MPKPVPIGARATAEETVEFKHTLTAHHSELPPVYS |
Ga0137363_112873792 | 3300012202 | Vadose Zone Soil | MALPIPIGVRGEAHETVELKHTLAAHHPELPPVYSTPDMIRL |
Ga0137380_101751691 | 3300012206 | Vadose Zone Soil | MAKTIPLGARGEAEQIVEFQHTLTAHHPTLPPVYSTPDMIRLM |
Ga0137381_101891993 | 3300012207 | Vadose Zone Soil | MPKAMPIGARASAEQTVEFKHTLTAHHSELPPVYSTP |
Ga0137381_116431052 | 3300012207 | Vadose Zone Soil | LAKELAFVKDVPIGARGEAAETVEFQHTLTAHHASLPPVYSTPDMIRLME |
Ga0137379_112609822 | 3300012209 | Vadose Zone Soil | VARDIPVGARGQAEETVAFEHTLTSHHPDLPPVYSTPDMIRLME |
Ga0137378_111164841 | 3300012210 | Vadose Zone Soil | MAKHVPIGARGTAEQTVEFKHTLTAHHPELPQVYS |
Ga0137377_104497331 | 3300012211 | Vadose Zone Soil | MARPIPIGARGEACETVELKHTLAAHHAELPPVYSTPDMIR |
Ga0137387_112640812 | 3300012349 | Vadose Zone Soil | MAKPVPKGARGEAREIVDFKHTLSAHHEQLPPVYSTPDMI |
Ga0137386_101209561 | 3300012351 | Vadose Zone Soil | MKPVPIGARGEAQETVEFKHTLTSHHEFLPPIYSTPDMVRLME |
Ga0137361_114777851 | 3300012362 | Vadose Zone Soil | MTLPIPIGVRGEAHETVELKHTLAAHHPELPPVYSTPDMIRLMETASFK |
Ga0137390_104825962 | 3300012363 | Vadose Zone Soil | MAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLME |
Ga0137394_110348862 | 3300012922 | Vadose Zone Soil | MALPIPIGVRGETQETVELKHTLAAHHPELPTVYS |
Ga0137404_106584731 | 3300012929 | Vadose Zone Soil | MALPIPIGVRGEAQETVELKHTLAAHHPELPPVYS |
Ga0137407_111289521 | 3300012930 | Vadose Zone Soil | MAIPVPIGVRGEARETVELKHTLAAHHPELPPVYSTPDMIRLMETACF |
Ga0134110_101373771 | 3300012975 | Grasslands Soil | MSKSVPIGARGEAEETVEFRHTLTAHHFSLPPVYSTPDMI |
Ga0181521_102300471 | 3300014158 | Bog | VRGEAAETVELKHTIAADHPELPPVYSTPDMIRLMETACFH |
Ga0181534_106705042 | 3300014168 | Bog | LAKDVPIGARGEAQETVEFKHTLTAQHPELPPVYSTPDMIRLMET |
Ga0181534_107798522 | 3300014168 | Bog | MAREIPIGARGEAQETVEFKHTLTAHHPELPPVYSTPDMIRLM |
Ga0181531_110296882 | 3300014169 | Bog | MARPIPIGARGEATETVELKHTLSAHHPELPPVYSTPDMIRLM |
Ga0181526_101155463 | 3300014200 | Bog | MAQPIPIGVRGEAAETVELKHTLAAHDPQLPPVYSTPDMIRLME |
Ga0181537_112226532 | 3300014201 | Bog | MARPIPIGARGEATETVELKHTLSAHHPELPPVYSTPDMIRLMET |
Ga0181536_101531943 | 3300014638 | Bog | MPRPIPIGVRGEAAETVELKHTIAAHHPELPPVYSTPDMIRLMETA |
Ga0181536_104386171 | 3300014638 | Bog | MARPIPIGVRGEAAETVELKHTLAAHDPELPPVYS |
Ga0132258_138185331 | 3300015371 | Arabidopsis Rhizosphere | MAKQVPIGTRGEAAETVAFEHTLTSHHPQLPPVYSTPDMIRLM |
Ga0182041_105070491 | 3300016294 | Soil | VAKQVSLGARGEAAETVEFKHTLTSHHSELPPVYSTP |
Ga0182032_117634011 | 3300016357 | Soil | MPKLIPIGARGEASETVEFKHTLTSHHDSLPPIYSTPDMIRL |
Ga0187802_104281462 | 3300017822 | Freshwater Sediment | VARQVPLGTRGEAEETVEFRHTLTAHHPELPPVYSTPDMIRLMETAG |
Ga0187818_105266962 | 3300017823 | Freshwater Sediment | MARHIPIGVRGEAAETVELRHTLSAHHPELPPVYSTPDMIRLMET |
Ga0187825_102067811 | 3300017930 | Freshwater Sediment | MKAVPQGARGETEQVVEFKHTLTFHHPELPPVYSTPDMIR |
Ga0187877_11046483 | 3300017931 | Peatland | MPRPIPIGVRGEAAETVELKHTIAADHPELPPVYSTPDM |
Ga0187801_100684531 | 3300017933 | Freshwater Sediment | MARPIPIGVRGEAAETVELKHTIAAHHPELPPVYSTP |
Ga0187801_100980831 | 3300017933 | Freshwater Sediment | VAKEVPIGARGEASETVEFEHTLTSHHAELPPVYS |
Ga0187803_101073863 | 3300017934 | Freshwater Sediment | MARPIPLGVRGEAEETVELKHTLASHHPELPPVYATPAMIRLMETACF |
Ga0187803_101311211 | 3300017934 | Freshwater Sediment | MARPIPLGTRGEAEETVELKHTLARHHPELPPVYSTPSMI |
Ga0187803_101861792 | 3300017934 | Freshwater Sediment | MPRPIPIGVRGEAAETVELKHTIAAHHPELPPVYS |
Ga0187848_103502561 | 3300017935 | Peatland | MAKEIPIGARGEARETVEFKHTLTAHHPELPPIYS |
Ga0187853_101965102 | 3300017940 | Peatland | MPRPIPIGVRGEAAETVELKHTIAAHHPELPPVYSTPDMIRLMETACFH |
Ga0187853_103212261 | 3300017940 | Peatland | MARHIPIGVMGEAEEIVDRQHTLAAHHPELPPVYSTPDMI |
Ga0187819_100999491 | 3300017943 | Freshwater Sediment | MAKAMPIGARGTAEETVEFEHTLTAHHPELPPVYSTPDMIRLMETAA |
Ga0187879_107884652 | 3300017946 | Peatland | MAKEIPIGARGEAHETVEFKHTLTAHHPELPPVYSTPDM |
Ga0187776_110947372 | 3300017966 | Tropical Peatland | MALPIPIGVRGEAHETVELRHTLATHHPELPPVYSTPDMIRLME |
Ga0187781_100076451 | 3300017972 | Tropical Peatland | LAKPIPIGARGEAEETVEFRHTLAAHHSELPPVYSTPDMIRLMETA |
Ga0187780_102402542 | 3300017973 | Tropical Peatland | VARAIPIGARGEAEETIEFKHTLTVHHPELPPVYSTPDMIRLMETA |
Ga0187780_109308122 | 3300017973 | Tropical Peatland | MKSVPIGARGEAAETVAFEHTLTAHHPELPPVYSTPDMIRLME |
Ga0187777_110682791 | 3300017974 | Tropical Peatland | MAREIPIGAKATAEETVEFKHTLTAQHPQLPPVYSTPDMIRLME |
Ga0187782_102065771 | 3300017975 | Tropical Peatland | MAKPIPIGARGEAEETVEFQHTLTAHHPELPPVYSTPDMIR |
Ga0187782_115689471 | 3300017975 | Tropical Peatland | MPQPIPIGASGEAEETVEEKHTLAAHHSELPPVYSTPDMIRLM |
Ga0187822_101541822 | 3300017994 | Freshwater Sediment | MPKPVPMGTWGEAEETVEFQHTLTAHHPQLPPVYSTPDMI |
Ga0187816_100715983 | 3300017995 | Freshwater Sediment | MAKEIPIGARATAEETVEFKHTLTAHHPQLPPVYSTPDMIRLME |
Ga0187767_101550301 | 3300017999 | Tropical Peatland | VKEVPIGARAEAEETVEFKHTLTSHHAELPPVYSTPDMIR |
Ga0187805_105758411 | 3300018007 | Freshwater Sediment | MAKAMPIGARATAEETVELEHTLTSHHPELPPVYSTPDMIRLMET |
Ga0187861_102355392 | 3300018020 | Peatland | MPRPIPIGVRGEAAETVELNHTIAAHHPELPPVYSTPDMIRLMET |
Ga0187864_103018721 | 3300018022 | Peatland | MAKAMPIGARSTAEETVEFKHTLAAHHPELPPVYSTPDMIR |
Ga0187857_100267431 | 3300018026 | Peatland | MVKEIPIGARGEASETVEFKHTLTAHHPELPLVYSTPDMIRLMETA |
Ga0187863_108226501 | 3300018034 | Peatland | MARPIPIGVRGEADETVELKHTLAAQHPELPPVYSTPDMIRLMETA |
Ga0187855_107713192 | 3300018038 | Peatland | MAKQIPIGARGEAQETVGFKHTLTAYRAELPPVYS |
Ga0187871_106243702 | 3300018042 | Peatland | MAHHIPIGVRGEAAETVELKHTLAAHDPRLPPVYSTPDMIRLM |
Ga0187851_104960182 | 3300018046 | Peatland | MSRPIPIGVHGEAEETVERKHTLSAHHPELPPVYSTPDMIRLME |
Ga0187858_101688653 | 3300018057 | Peatland | VARAIPIGARAEAEETVEFEHTLTSHHPELPPVYSTPD |
Ga0187772_101148332 | 3300018085 | Tropical Peatland | LAKDIPIGVRGEAEETVAFEHTLTAHHPQLPPVYSTPDMIRLMETA |
Ga0187769_102499751 | 3300018086 | Tropical Peatland | MAKAVPIGARATVEETVEFEHTLTSHRPELPPVYSTPDMIR |
Ga0187769_102851671 | 3300018086 | Tropical Peatland | VARAIPIGARGEAEETVEFKHTLTAHHPELPPVYSTPDMIR |
Ga0187769_110512601 | 3300018086 | Tropical Peatland | LAKEIPIGARGEAEETVEFKHTLTAHHPELPPVYSTPD |
Ga0187769_115470351 | 3300018086 | Tropical Peatland | MALPIPICVRGEAAETVELKHTLTAEHPVLPPVCSSPD |
Ga0187770_106170041 | 3300018090 | Tropical Peatland | MAKKIPIGARGTAEETVEFKHTLTAHHPELPPVYSTPDMIRLMET |
Ga0066667_118397901 | 3300018433 | Grasslands Soil | MKPVPIGVRGQAEETVEFRHTLTANNPQLPPVYSTPDMIR |
Ga0066662_101389071 | 3300018468 | Grasslands Soil | MKPVPIGVRAAANQVVAFEHTLAAHHPQLPPVYSTPDMIRLMDLAIL |
Ga0066662_112063841 | 3300018468 | Grasslands Soil | MAKTIPLGARGEAEQIVEFQHTLTAHHPTLPPVYSTPDMVR |
Ga0066662_127051992 | 3300018468 | Grasslands Soil | MAKPVPIGSRGEAEETVEFRHTLTAHHQELPPVYSTPDMIRLMET |
Ga0181512_12553471 | 3300019270 | Peatland | MAKEIPLGARGEAQEKVEFKHTLTAHHPHLPPVYSTPDMIRLME |
Ga0187798_18010281 | 3300019275 | Peatland | MAKRIPIGARGEAHETVEFSHTLTAHHAELPPVYSTPDMI |
Ga0187797_11659232 | 3300019284 | Peatland | MAKEVPIGARGEAEETVEFKHTLTAHHPELPPVYSTPDMI |
Ga0182031_10791232 | 3300019787 | Bog | MARTIPIGARGEAAGTVELKHTLSAHHSELPPVYSTPDMIRL |
Ga0182031_11615563 | 3300019787 | Bog | MARTIPIGARGEAAETVELKHTLSAHHSELPPVYSTPDMIRLM |
Ga0193707_10858731 | 3300019881 | Soil | MQKPIPIGARATAEETVEFKHTLTAHHPELPPVYSTPDMIR |
Ga0210403_112084501 | 3300020580 | Soil | MAKEVPIGARGDAQETVEFKHTLTAHRAELPPVYSTPD |
Ga0210395_103235363 | 3300020582 | Soil | MAKAMPIGARATVEETVEFKHTLTSHHPELPPVYSTPDMIRL |
Ga0210395_112970882 | 3300020582 | Soil | VAKPIPIGARGEAQETVEFKHTLTAHRAELPPVYSTPDMIRLMEIAA |
Ga0210395_113939512 | 3300020582 | Soil | LAKPIPIRTRGEVEETVAFEHTLTSHHPDLPPVYSTPDMIRLM |
Ga0210404_106077781 | 3300021088 | Soil | MAKAMPIGARATAEETVEFKHTLTAHHPELPPVYSTPDM |
Ga0210400_104852933 | 3300021170 | Soil | MKTVPVGARGEAEEVVEFEHTLTAHHPQLPPVYSTPDMIR |
Ga0210405_113303441 | 3300021171 | Soil | MAKAMPIGARATVEETVAFKHTLTSHHPELPPVYSTPDMI |
Ga0210388_101797784 | 3300021181 | Soil | MPKPIPIGTRGTAEETIAFEHTLSSRHPNLPPVYSTPDMIRL |
Ga0210388_105962671 | 3300021181 | Soil | MAKAMPIGARATVEETVEFKHTLTSHHPELPPVYSTPDMIRLM |
Ga0210388_110007332 | 3300021181 | Soil | VAKPIPIGALGEAEETVEFKHTLTSHHAELPPVYSTQDM |
Ga0210393_100104361 | 3300021401 | Soil | MAKQIPIGARSEAHQTVEFKHTLTAHGAELPPVYSTPH |
Ga0210393_108879472 | 3300021401 | Soil | MAKEIPIGARGEARETVEFKHTLTSHHAELPPIYSTPDMIRLM |
Ga0210385_107088501 | 3300021402 | Soil | MAQPIPIGVRGEAAETVDLKHTLAAHHPELPPVYSTPDMI |
Ga0210389_113855551 | 3300021404 | Soil | MAKAMPIGVRATVEETVEFKHTLTSHHPELPPVYSTPDMSR |
Ga0210394_100851771 | 3300021420 | Soil | MANAMPIGARGTAEETVEFKHTLSVHHPELPPVYSTPDMI |
Ga0210384_104970643 | 3300021432 | Soil | MAKAMPIGARATVEETVEFKHTLTSHHPELPPVYSTPDMIRLME |
Ga0210384_105069332 | 3300021432 | Soil | VKEIPIGARGEASETVEFTHTLTSHHPELPPVYSTPDMIRLMETAAF |
Ga0210391_101191341 | 3300021433 | Soil | MARPIPIGEAAETVDLKHTLAAHHPELPPVYSTPDMIRLMETA |
Ga0210391_112578682 | 3300021433 | Soil | VAKPIPIGARGEAQETVEFKHTLTAHRAELPPVYLNPDMNR |
Ga0210398_101534513 | 3300021477 | Soil | LARPIPIGVRGEAAETVDLKHTLAAHHPELPPVYSTPDMI |
Ga0210398_103831442 | 3300021477 | Soil | VAKTIPIGARGEAQETVEFKHTLTAHRAELPPVYST |
Ga0210402_107090932 | 3300021478 | Soil | MTKAMPIGARATVEETVAFKHTLTSHHPELPPVYS |
Ga0210409_105239573 | 3300021559 | Soil | MAKAMPIGARGTAEETVEFKHTLTSHHPELPPVYSTP |
Ga0126371_126142683 | 3300021560 | Tropical Forest Soil | MARAMPIGARGSAEETVEFKHTLTAHHPELPPVYSTPDMIRLM |
Ga0213853_102110562 | 3300021861 | Watersheds | MAKPVPIGARGEAEETVEFQHTLTAHHPSLPPVYSTPDMIRLM |
Ga0213853_113641293 | 3300021861 | Watersheds | MARPIPIGTRGEAEETVKLKHTLADHHPELPPVYSTPDMIRL |
Ga0224541_10331152 | 3300022521 | Soil | MAQPIPIGVRGEAAETVELKHTLAAHHSELPPVYSTPDMIRL |
Ga0224558_10694681 | 3300023090 | Soil | MARPIPIGTRGEAAETVELKHTLAAHHPELPPVYSTPDMIRL |
Ga0208691_10039435 | 3300025612 | Peatland | MVKEIPIGARGEASETVEFKHTLTAHHPELPLVYSTPDMI |
Ga0207707_114034822 | 3300025912 | Corn Rhizosphere | MAKAMPIGARGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEVAC |
Ga0207695_112603532 | 3300025913 | Corn Rhizosphere | VPIGARGEAHETVEFEHTLTSHHPELPAVYSTPDMIRLMET |
Ga0207660_101904173 | 3300025917 | Corn Rhizosphere | MAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYSTP |
Ga0207662_111225392 | 3300025918 | Switchgrass Rhizosphere | MAKAMPLGVRGEVEQTVELKHTLAAHNPNLPPVYST |
Ga0207652_102202203 | 3300025921 | Corn Rhizosphere | MAKAMPLGARGEVEQTVELKHTLAAHNPNLPPVYST |
Ga0207681_109473841 | 3300025923 | Switchgrass Rhizosphere | VPIGARGEAHETVEFEHTLTSHHPELPAVYSTPDMI |
Ga0207665_107190492 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRTVPIGARGEASEIVAFEHTLTAHHPELPPVYS |
Ga0257169_10252962 | 3300026469 | Soil | MARPIPIGVRGEAAEIVELKQTLSAHHAELPPVYSTPDMIRLM |
Ga0257164_10501851 | 3300026497 | Soil | MALPIPIGVRGEAHETVELKHTLAAHHPELPPVYSTPDMIRLME |
Ga0209805_12290612 | 3300026542 | Soil | MAKPVPIGTRAEMEEVVQLEHTLTARRPELPPVYSTPDMIR |
Ga0208098_10202131 | 3300027172 | Forest Soil | MAKAMPIGARATVEETVGFKHTLTSHHPELPPVYSTPDMIRLM |
Ga0208324_10469321 | 3300027604 | Peatlands Soil | MAKAMPIGARGTAEETVEFKHTLTAHHPELPPVYSTPDMIR |
Ga0209422_10072893 | 3300027629 | Forest Soil | LAKDIPLGTRSEAEETVAFEHTLASHHPELPPVYSTPDMIRLME |
Ga0208827_11464032 | 3300027641 | Peatlands Soil | LAKDIPIGARGEAEETVEFKHTLTSHHPELPPVYSTPEM |
Ga0208565_10283801 | 3300027662 | Peatlands Soil | DPMAKPIPLGARGTAEETVEFKHTLTAHHPELPPVYSTPDMIRLM |
Ga0209009_10731022 | 3300027667 | Forest Soil | MLFWKGAWHLAKDIPLGTRSEAEETVAFEHTLASHHPELPPVYSTPDMIRL |
Ga0209333_11237522 | 3300027676 | Forest Soil | MPKEVPIGVRGDTQQTVEFKHTLTAHRPELPPVYSTPH |
Ga0209248_100124623 | 3300027729 | Bog Forest Soil | MAKQIPIGMRGDAQQTVEFKHTLTAHRPELPPVYSTPHMI |
Ga0209448_100803192 | 3300027783 | Bog Forest Soil | MAKQVPIGARGEAHETVEFKHTLTAHHAELPPVYSTPDMIRLMET |
Ga0209139_100387763 | 3300027795 | Bog Forest Soil | MAKAMPVGARGAAEETVEFKHTLTSRHPELPPVYSTPDM |
Ga0209726_100743164 | 3300027815 | Groundwater | MAKPVPIGARGEAEERVEFQHTLTSHHEMLPPVYSTPDMIRLMETA |
Ga0209039_103330552 | 3300027825 | Bog Forest Soil | LAKDIPIGARGEAEETVEFKHTLTSHHAQLPPVYSTP |
Ga0209580_100089791 | 3300027842 | Surface Soil | VAKPVPIGTRAQAEEIVEFKHTLTSQHPQLPPVYS |
Ga0209579_103173581 | 3300027869 | Surface Soil | LAKDIPIGARGEASETVEFKHTLTSYHPELPPVYSTPDMIRLMET |
Ga0209283_107074902 | 3300027875 | Vadose Zone Soil | MAKTIPIGAHGEAEETVEFEHTLTAHHPTLPPVYSTPDMIRL |
Ga0209169_106279871 | 3300027879 | Soil | MAKAMPIGARATVEETVAFKHTLTSHHPELPPVYSTPDMIRLMETA |
Ga0209275_103580132 | 3300027884 | Soil | MASEIPMGARGEAEETVEFKHTLTAHHPELPPVYSTPDMIR |
Ga0209624_106488582 | 3300027895 | Forest Soil | MAKEIPIGANGEARETVEFKHTLAAHHPELPPVYSTPDMIRLM |
Ga0209488_112332151 | 3300027903 | Vadose Zone Soil | MAKPVPVGARGEARERVEFKHTLSAHHEQLPPVYSTP |
Ga0209415_107128051 | 3300027905 | Peatlands Soil | MAKAMPIGARGTAEETVEFEHTLTAHHPELPPVYSTPDM |
Ga0209415_107943512 | 3300027905 | Peatlands Soil | LARQIPIGARGGAEETVEFEHTLTSHHPELPPVYSTPDM |
Ga0209698_104332171 | 3300027911 | Watersheds | MAKAMPIGARGTAEETVEFEHTLTAHHPELPAVYSTPDMIRLM |
Ga0268265_100426131 | 3300028380 | Switchgrass Rhizosphere | MPLGVRGEVEQTVELKHTLAAHNPNLPPVYSTPDMIRLMEIACFQA |
Ga0302301_11277491 | 3300028731 | Palsa | MAKEIPIGARGKARETVELKHTLAAHDAKLPPVYS |
Ga0302206_10851391 | 3300028734 | Fen | MPRPIPIRAHGAAEETVEFKHTLSAHHPELPPVYSTPDMIRLMETAC |
Ga0302233_103227251 | 3300028746 | Palsa | MAKRIPIGARGEAQEIVQFKHTLTAHHAELPPVYSTPD |
Ga0302202_104468421 | 3300028762 | Bog | VAKEIPIGARGEAHETVEFKHTLTAHHEQLPPVYST |
Ga0302155_102214462 | 3300028874 | Bog | MAKEIPIGARGEASETVEFKHTLTAHHPELPPVYSTPDMIR |
Ga0311368_109368572 | 3300029882 | Palsa | LAKPIPVGARGEAEETVEFRHTLTAHHSELPPVYSTPDMIRLME |
Ga0247271_1007635 | 3300029903 | Soil | MARPIPIGVRGEAAETVELKHTLSAHHPELPPVYSTPXXXAAVL |
Ga0311359_106165652 | 3300029914 | Bog | MAKPIPIGARGEAQETVEFKHTLTSHHAELPPVYSTPDMIRLMETA |
Ga0311332_107987401 | 3300029984 | Fen | MALPVPIGASGEAEETVKLRHTLSVHHPELPPVYSTPDMI |
Ga0311339_100286368 | 3300029999 | Palsa | LAKPIPVGARGEAEETVEFRHTLTAHHSELPPVYST |
Ga0302194_103056712 | 3300030506 | Bog | MARPIPIRAQGEASETVELKHTLSAHHPELPPVYS |
Ga0311355_109182502 | 3300030580 | Palsa | LAKPIPVGARGEAEETVEFRHTLTAHHSELPPVYSTPDMIR |
Ga0310039_100499495 | 3300030706 | Peatlands Soil | MARPIPIGVRGEAAETVELKHTLSAHHPELPPVYSTP |
Ga0265459_106453922 | 3300030741 | Soil | MAKEIPIGAKGEARETVEFKHTLAAHHPELPPVYSTP |
Ga0265762_10605552 | 3300030760 | Soil | MAREIPIGVRGEAEETVEFEHTLTAHHPQLPPVYSTPDMI |
Ga0265750_10401142 | 3300030813 | Soil | MAKPIPIGARGEAQETVEFKHTLTSHHPELPPVYSTPDMIR |
Ga0265746_10086073 | 3300030815 | Soil | MAKEIPIGARGEARETVEFKHTLTAHHPELPAVYSTPDMIR |
Ga0311335_106139581 | 3300030838 | Fen | MAKPIPIRAHGEAEETVELKHTLAAHHPELPPVYSTPDMIR |
Ga0302308_104339182 | 3300031027 | Palsa | MAKEIPIGVRAEAQETVEFKHTLAAHHSELPPVYSTPDM |
Ga0265340_104841182 | 3300031247 | Rhizosphere | LAKDVPIGARGEAEETVLFEHTLTAHHPELPPVYSTPDMIRLMETA |
Ga0302326_114133651 | 3300031525 | Palsa | MAKEIPIGARGEAQETVEFKHTLTAHHPELPPVYSTPDMIRLM |
Ga0318572_106451201 | 3300031681 | Soil | MAKAVPMGARGEAGETVEFRHTLTAHHPMLPPVYSTPDMIRLMETAA |
Ga0310686_1170414301 | 3300031708 | Soil | MPKPIPIGARGEARETVEFKHTLTAYHPQLPPVYSTPDM |
Ga0310686_1183986372 | 3300031708 | Soil | MAKAMPIGTRGTAEETVEFKHTLSAHHPELPPVYSTPDMIRLMETA |
Ga0310686_1194264201 | 3300031708 | Soil | MAREIPIGARGEARETVEFKHTLAAHDARLPPVYSTPDMIR |
Ga0307474_104178011 | 3300031718 | Hardwood Forest Soil | VAKQIPIGARAEAEETVEFEHTLTSHHPELPPVYS |
Ga0307474_111981362 | 3300031718 | Hardwood Forest Soil | MAKPVPMGARGEAEETVEFEHTLKAHHQSLPPVYSTPDMIRLMETA |
Ga0307469_112464921 | 3300031720 | Hardwood Forest Soil | MQKPIPIGARATAEETVEFKHTLTAHHPELPPVYSTPDMIRL |
Ga0307477_106242032 | 3300031753 | Hardwood Forest Soil | MARAIPIGTRGEARETVEFQRTLTAHNARLPPIYSTPDMIRLMETA |
Ga0307475_101087394 | 3300031754 | Hardwood Forest Soil | MAKLIPIGVHGETRETVEFKHTLTAHHPELPPVYSTPDMIPLQT |
Ga0307475_102342951 | 3300031754 | Hardwood Forest Soil | LAKEIPLGVRGEAAETVAFENTLTSRYPELPPVYSTPDM |
Ga0307473_103691221 | 3300031820 | Hardwood Forest Soil | MARPIPIGVRGEASETVELKHTLSEHHAELPPVYSTPDMIRLME |
Ga0307478_104579272 | 3300031823 | Hardwood Forest Soil | MAKAMPIGARGTAEETVEFKHTLTSHDPELPPVYSTPDMIRLMETA |
Ga0307478_111033702 | 3300031823 | Hardwood Forest Soil | MAKEIPIGASGEARETVEFKHTLAAHHPELPPVYS |
Ga0311367_123466181 | 3300031918 | Fen | MPRPIPIRAHGAAEETVEFKHTLSAHHPELPPVYSTP |
Ga0310912_108348731 | 3300031941 | Soil | VAKEISIGARGEAEETVEFEHTLTSHHPELPPVYSTPDMI |
Ga0307479_110666761 | 3300031962 | Hardwood Forest Soil | MAKPIGIGARGEVEETVEFKHTLTLNHPQLPPVYSTPAMIRFME |
Ga0307479_112000881 | 3300031962 | Hardwood Forest Soil | LAKDVPLGAREEVTETVEFRHTLTSHHPELPPVYSTPDMIRL |
Ga0307479_115682182 | 3300031962 | Hardwood Forest Soil | MARPIPIGVRGEASETVELKHTLAAHHAELPPVYSTPDMIRLM |
Ga0306922_118631081 | 3300032001 | Soil | MTLPIPIGAYGDAEETVGLQHTLAAHHPELPPVYSTPDMIRLMETAC |
Ga0311301_107415061 | 3300032160 | Peatlands Soil | MARQIPIGVRGEAAETVELKHTLSAHHAELPPVYSTPDMIRLMETVAE |
Ga0307470_110950712 | 3300032174 | Hardwood Forest Soil | LAREIPIGARSDAEETVAFEHTLTSHHPELPPVYST |
Ga0307471_1007154452 | 3300032180 | Hardwood Forest Soil | MAKPVPMGARGEAEQTVEFEHTLKAHHPSLPPVYSTPDMIRLM |
Ga0307471_1033431502 | 3300032180 | Hardwood Forest Soil | MVKPIPIGARGEAQETVEFQHTLTAHNPKLPPVYSTPDMIRLM |
Ga0307472_1004876012 | 3300032205 | Hardwood Forest Soil | MAKAIPIGVRGEAEETVEFKHTLTAHHPELPPVYSTPDMI |
Ga0307472_1027640672 | 3300032205 | Hardwood Forest Soil | MAKETPIGARGEAEETVEFKHTLTAYHPELPPVYSTPDMIR |
Ga0348332_144492931 | 3300032515 | Plant Litter | MAKAMPIGARATVEETVEFKHTLTSRHPELPPVYSTPDMIRLMETA |
Ga0335079_123758911 | 3300032783 | Soil | MVIGRNLAKDIPIGARGEASETVAFQHTLTSHHPELPPVYSTPDMIR |
Ga0335078_119410921 | 3300032805 | Soil | LAKPIPIGARGDAEETVTFEHTLTSHHPQLPPVYSTPDMIRLMET |
Ga0335080_103015513 | 3300032828 | Soil | MVIGRNLAKDIPIGARGEASETVAFQHTLTSHHPELPPVYSTPD |
Ga0335070_101197701 | 3300032829 | Soil | MPRLIPIGVRGEAEETVEFRHTLTSHHEALPPVYSTP |
Ga0335081_120878212 | 3300032892 | Soil | MAKPVPLGTHGTASEAVAFENTLTFHHPELPPVYSTPDMIRLM |
Ga0335069_122319511 | 3300032893 | Soil | MSKSVPIGARGEVSEIVEHKHTLTHFDPKLPPVYST |
Ga0335075_116908141 | 3300032896 | Soil | VPKEIPIGARGEAEETVEFQHTLTSRHAELPPIYST |
Ga0335072_113887481 | 3300032898 | Soil | MAKPFPIGARGEAQETVEFKHTLTAQHPELPPVYSTPDMI |
Ga0335076_100023431 | 3300032955 | Soil | MAKEIPIGVRGEAQETVEFKHTLTAHHPQLPPVYS |
Ga0335084_107897932 | 3300033004 | Soil | MAISIPIGVRGEAAETVELKHTLATHHPDLPPVYSTPDMIRLMETACFH |
Ga0334722_100742471 | 3300033233 | Sediment | MKEGPLGARATAEEAVEFQHTLTSHHPELPPVYSTPDMIRLMETA |
Ga0310811_110134352 | 3300033475 | Soil | MKQVPIGARAERSEVVERKHTLTHHHDQLPPVYSTPDMIR |
Ga0371490_11384792 | 3300033561 | Peat Soil | MPPPSTEFMPRPIPIGTRGEAEETIELRHTLAGHRPELPPVYATPAMILLMEIA |
Ga0370515_0323666_3_110 | 3300034163 | Untreated Peat Soil | MARPIPIGVRGEAAETVELKHTLSAHHPELPPVYST |
⦗Top⦘ |