Basic Information | |
---|---|
Family ID | F011227 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 293 |
Average Sequence Length | 43 residues |
Representative Sequence | MTLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Number of Associated Samples | 159 |
Number of Associated Scaffolds | 293 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 2.40 % |
% of genes near scaffold ends (potentially truncated) | 19.45 % |
% of genes from short scaffolds (< 2000 bps) | 72.70 % |
Associated GOLD sequencing projects | 148 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (53.242 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.382 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.614 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (44.027 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 293 Family Scaffolds |
---|---|---|
PF13426 | PAS_9 | 4.10 |
PF00959 | Phage_lysozyme | 4.10 |
PF08291 | Peptidase_M15_3 | 3.75 |
PF08299 | Bac_DnaA_C | 2.05 |
PF00149 | Metallophos | 1.02 |
PF08447 | PAS_3 | 1.02 |
PF01541 | GIY-YIG | 0.68 |
PF07120 | DUF1376 | 0.68 |
PF00145 | DNA_methylase | 0.68 |
PF03237 | Terminase_6N | 0.68 |
PF00182 | Glyco_hydro_19 | 0.68 |
PF02195 | ParBc | 0.68 |
PF01381 | HTH_3 | 0.68 |
PF13884 | Peptidase_S74 | 0.68 |
PF01145 | Band_7 | 0.34 |
PF13392 | HNH_3 | 0.34 |
PF13412 | HTH_24 | 0.34 |
PF00535 | Glycos_transf_2 | 0.34 |
PF14550 | Peptidase_S78_2 | 0.34 |
PF13582 | Reprolysin_3 | 0.34 |
PF02557 | VanY | 0.34 |
PF13560 | HTH_31 | 0.34 |
PF13455 | MUG113 | 0.34 |
PF01171 | ATP_bind_3 | 0.34 |
PF09718 | Tape_meas_lam_C | 0.34 |
PF00303 | Thymidylat_synt | 0.34 |
PF11753 | DUF3310 | 0.34 |
PF13539 | Peptidase_M15_4 | 0.34 |
PF08774 | VRR_NUC | 0.34 |
PF00132 | Hexapep | 0.34 |
PF13148 | DUF3987 | 0.34 |
PF04466 | Terminase_3 | 0.34 |
PF13443 | HTH_26 | 0.34 |
COG ID | Name | Functional Category | % Frequency in 293 Family Scaffolds |
---|---|---|---|
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 2.05 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.68 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.68 |
COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.68 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.68 |
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.34 |
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.34 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.34 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.34 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.34 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.34 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.34 |
COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 0.34 |
COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.34 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.18 % |
Unclassified | root | N/A | 20.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000947|BBAY92_10001054 | Not Available | 6764 | Open in IMG/M |
3300000973|BBAY93_10125098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300001213|JGIcombinedJ13530_107971213 | Not Available | 792 | Open in IMG/M |
3300001282|B570J14230_10116191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300002272|B570J29579_101644 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
3300002408|B570J29032_109497045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 811 | Open in IMG/M |
3300002835|B570J40625_100769076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300002835|B570J40625_100877823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300003986|Ga0063233_10017053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1782 | Open in IMG/M |
3300004112|Ga0065166_10215788 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 760 | Open in IMG/M |
3300004112|Ga0065166_10302579 | Not Available | 653 | Open in IMG/M |
3300004240|Ga0007787_10656631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300004481|Ga0069718_13960561 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
3300004481|Ga0069718_14990628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300004481|Ga0069718_15730091 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
3300004481|Ga0069718_15861374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300004481|Ga0069718_15904396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc | 1964 | Open in IMG/M |
3300004793|Ga0007760_11086761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300004836|Ga0007759_11299699 | Not Available | 507 | Open in IMG/M |
3300005527|Ga0068876_10000021 | Not Available | 115823 | Open in IMG/M |
3300005527|Ga0068876_10000451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33899 | Open in IMG/M |
3300005527|Ga0068876_10469442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
3300005581|Ga0049081_10000651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13184 | Open in IMG/M |
3300005581|Ga0049081_10158867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300005582|Ga0049080_10280227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300005662|Ga0078894_10009723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7521 | Open in IMG/M |
3300005662|Ga0078894_10562996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
3300005662|Ga0078894_10602310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
3300005662|Ga0078894_11148558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300005805|Ga0079957_1058818 | All Organisms → Viruses → Predicted Viral | 2298 | Open in IMG/M |
3300005805|Ga0079957_1129103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1321 | Open in IMG/M |
3300006005|Ga0073910_1015855 | Not Available | 527 | Open in IMG/M |
3300006484|Ga0070744_10000037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34037 | Open in IMG/M |
3300006484|Ga0070744_10056860 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
3300006484|Ga0070744_10182500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300006641|Ga0075471_10016048 | All Organisms → Viruses → Predicted Viral | 4507 | Open in IMG/M |
3300006802|Ga0070749_10003320 | Not Available | 10768 | Open in IMG/M |
3300006802|Ga0070749_10056697 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
3300006802|Ga0070749_10122112 | All Organisms → Viruses → Predicted Viral | 1530 | Open in IMG/M |
3300006802|Ga0070749_10166748 | Not Available | 1274 | Open in IMG/M |
3300006802|Ga0070749_10206538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1124 | Open in IMG/M |
3300006802|Ga0070749_10259309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 983 | Open in IMG/M |
3300006920|Ga0070748_1222139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300006920|Ga0070748_1281376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300007538|Ga0099851_1187402 | Not Available | 757 | Open in IMG/M |
3300007538|Ga0099851_1287833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300008055|Ga0108970_10865221 | All Organisms → Viruses → Predicted Viral | 3521 | Open in IMG/M |
3300008055|Ga0108970_11401191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1308 | Open in IMG/M |
3300008055|Ga0108970_11481725 | Not Available | 1211 | Open in IMG/M |
3300008107|Ga0114340_1028996 | All Organisms → Viruses → Predicted Viral | 2550 | Open in IMG/M |
3300008111|Ga0114344_1005311 | Not Available | 5606 | Open in IMG/M |
3300008113|Ga0114346_1303526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300008113|Ga0114346_1322374 | Not Available | 519 | Open in IMG/M |
3300008117|Ga0114351_1160280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1226 | Open in IMG/M |
3300008261|Ga0114336_1008307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10687 | Open in IMG/M |
3300008261|Ga0114336_1361542 | Not Available | 517 | Open in IMG/M |
3300008266|Ga0114363_1036561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3218 | Open in IMG/M |
3300008266|Ga0114363_1057029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1532 | Open in IMG/M |
3300008266|Ga0114363_1113543 | Not Available | 953 | Open in IMG/M |
3300008266|Ga0114363_1122445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi | 902 | Open in IMG/M |
3300008266|Ga0114363_1149996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1652 | Open in IMG/M |
3300008266|Ga0114363_1227570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300008267|Ga0114364_1030551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2113 | Open in IMG/M |
3300008267|Ga0114364_1035293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1914 | Open in IMG/M |
3300008267|Ga0114364_1083141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1042 | Open in IMG/M |
3300008267|Ga0114364_1090871 | Not Available | 974 | Open in IMG/M |
3300008448|Ga0114876_1016805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3915 | Open in IMG/M |
3300008448|Ga0114876_1054277 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
3300008448|Ga0114876_1061795 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1634 | Open in IMG/M |
3300008448|Ga0114876_1067657 | All Organisms → Viruses → Predicted Viral | 1532 | Open in IMG/M |
3300008448|Ga0114876_1160045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300008448|Ga0114876_1239832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300008450|Ga0114880_1035747 | All Organisms → Viruses → Predicted Viral | 2189 | Open in IMG/M |
3300008450|Ga0114880_1130159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300008450|Ga0114880_1141492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
3300008450|Ga0114880_1141926 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300008450|Ga0114880_1265881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300009009|Ga0105105_10554200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300009075|Ga0105090_10584707 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300009081|Ga0105098_10181080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300009081|Ga0105098_10188430 | Not Available | 947 | Open in IMG/M |
3300009081|Ga0105098_10258932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300009085|Ga0105103_10064452 | All Organisms → Viruses → Predicted Viral | 1867 | Open in IMG/M |
3300009085|Ga0105103_10204386 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Rhodocytophaga → Rhodocytophaga rosea | 1057 | Open in IMG/M |
3300009085|Ga0105103_10366420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300009085|Ga0105103_10584915 | Not Available | 633 | Open in IMG/M |
3300009085|Ga0105103_10857061 | Not Available | 530 | Open in IMG/M |
3300009111|Ga0115026_10970088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300009146|Ga0105091_10101202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1320 | Open in IMG/M |
3300009165|Ga0105102_10050564 | All Organisms → Viruses → Predicted Viral | 1825 | Open in IMG/M |
3300009165|Ga0105102_10135634 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
3300009165|Ga0105102_10290519 | Not Available | 844 | Open in IMG/M |
3300009165|Ga0105102_10710782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300009168|Ga0105104_10268492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300009168|Ga0105104_10764107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300009169|Ga0105097_10131405 | Not Available | 1374 | Open in IMG/M |
3300009169|Ga0105097_10384589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300009170|Ga0105096_10104029 | All Organisms → Viruses → Predicted Viral | 1418 | Open in IMG/M |
3300009170|Ga0105096_10345083 | Not Available | 763 | Open in IMG/M |
3300009183|Ga0114974_10000504 | Not Available | 32638 | Open in IMG/M |
3300009183|Ga0114974_10275582 | Not Available | 997 | Open in IMG/M |
3300009184|Ga0114976_10286881 | Not Available | 884 | Open in IMG/M |
3300009194|Ga0114983_1064397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300009419|Ga0114982_1016322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2523 | Open in IMG/M |
3300009419|Ga0114982_1074110 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
3300009419|Ga0114982_1194663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300010354|Ga0129333_10429988 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
3300010354|Ga0129333_10821389 | Not Available | 791 | Open in IMG/M |
3300011116|Ga0151516_11236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10622 | Open in IMG/M |
3300011268|Ga0151620_1003216 | All Organisms → Viruses | 6100 | Open in IMG/M |
3300011268|Ga0151620_1011314 | All Organisms → Viruses → Predicted Viral | 3190 | Open in IMG/M |
3300011268|Ga0151620_1031115 | Not Available | 1819 | Open in IMG/M |
3300011268|Ga0151620_1082355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1027 | Open in IMG/M |
3300011334|Ga0153697_1051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35808 | Open in IMG/M |
3300011335|Ga0153698_1108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 35499 | Open in IMG/M |
3300011336|Ga0153703_1118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28940 | Open in IMG/M |
3300011337|Ga0153702_1443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14133 | Open in IMG/M |
3300011339|Ga0153700_10373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 22990 | Open in IMG/M |
3300011339|Ga0153700_11171 | Not Available | 11583 | Open in IMG/M |
3300012000|Ga0119951_1026263 | All Organisms → Viruses → Predicted Viral | 1977 | Open in IMG/M |
3300012012|Ga0153799_1011958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1885 | Open in IMG/M |
3300012348|Ga0157140_10000142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9123 | Open in IMG/M |
3300012352|Ga0157138_1009106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1645 | Open in IMG/M |
3300012663|Ga0157203_1000964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7507 | Open in IMG/M |
3300012663|Ga0157203_1006628 | All Organisms → Viruses → Predicted Viral | 2115 | Open in IMG/M |
3300012663|Ga0157203_1039146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300013004|Ga0164293_10072022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2719 | Open in IMG/M |
3300013004|Ga0164293_10276825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 1173 | Open in IMG/M |
3300013004|Ga0164293_10434007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300013005|Ga0164292_10343452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
(restricted) 3300013133|Ga0172362_10537350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300013212|Ga0172421_107162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8106 | Open in IMG/M |
3300013372|Ga0177922_10166298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300013372|Ga0177922_10206439 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
3300013372|Ga0177922_10985418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300017701|Ga0181364_1016131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
3300017707|Ga0181363_1021801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
3300017707|Ga0181363_1046636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300017716|Ga0181350_1104346 | Not Available | 694 | Open in IMG/M |
3300017722|Ga0181347_1148549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300017723|Ga0181362_1035920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
3300017736|Ga0181365_1045955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1095 | Open in IMG/M |
3300017747|Ga0181352_1001529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8973 | Open in IMG/M |
3300017754|Ga0181344_1101922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300017754|Ga0181344_1214969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300017766|Ga0181343_1012965 | All Organisms → Viruses → Predicted Viral | 2652 | Open in IMG/M |
3300017766|Ga0181343_1126756 | Not Available | 716 | Open in IMG/M |
3300017774|Ga0181358_1231823 | Not Available | 589 | Open in IMG/M |
3300017777|Ga0181357_1126780 | Not Available | 954 | Open in IMG/M |
3300017778|Ga0181349_1299228 | Not Available | 522 | Open in IMG/M |
3300017780|Ga0181346_1025741 | All Organisms → Viruses → Predicted Viral | 2456 | Open in IMG/M |
3300017784|Ga0181348_1137173 | Not Available | 927 | Open in IMG/M |
3300017784|Ga0181348_1229756 | Not Available | 651 | Open in IMG/M |
3300017785|Ga0181355_1254951 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → unclassified Flavobacterium → Flavobacterium sp. LC2016-23 | 671 | Open in IMG/M |
3300017785|Ga0181355_1290281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300018790|Ga0187842_1030360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1750 | Open in IMG/M |
3300019093|Ga0187843_10026758 | All Organisms → Viruses | 2932 | Open in IMG/M |
3300019784|Ga0181359_1065752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1380 | Open in IMG/M |
3300019784|Ga0181359_1084023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1188 | Open in IMG/M |
3300019784|Ga0181359_1136339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300019784|Ga0181359_1162759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300020048|Ga0207193_1195289 | Not Available | 1609 | Open in IMG/M |
3300020151|Ga0211736_10247348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300020159|Ga0211734_10771277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300020505|Ga0208088_1025417 | Not Available | 756 | Open in IMG/M |
3300020527|Ga0208232_1015600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
3300020547|Ga0208361_1002270 | All Organisms → Viruses → Predicted Viral | 3576 | Open in IMG/M |
3300020551|Ga0208360_1006790 | All Organisms → Viruses → Predicted Viral | 1726 | Open in IMG/M |
3300020563|Ga0208082_1009958 | All Organisms → Viruses → Predicted Viral | 2224 | Open in IMG/M |
3300021961|Ga0222714_10007991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9544 | Open in IMG/M |
3300021961|Ga0222714_10081515 | All Organisms → Viruses → Predicted Viral | 2108 | Open in IMG/M |
3300021961|Ga0222714_10181757 | All Organisms → Viruses → Predicted Viral | 1230 | Open in IMG/M |
3300021961|Ga0222714_10270447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
3300021961|Ga0222714_10301189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300021961|Ga0222714_10351251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300021962|Ga0222713_10204903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1316 | Open in IMG/M |
3300021962|Ga0222713_10472848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300021963|Ga0222712_10002967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18909 | Open in IMG/M |
3300021963|Ga0222712_10284359 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin217 | 1043 | Open in IMG/M |
3300021963|Ga0222712_10757763 | Not Available | 540 | Open in IMG/M |
3300022179|Ga0181353_1049655 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
3300022179|Ga0181353_1087779 | Not Available | 778 | Open in IMG/M |
3300022190|Ga0181354_1089474 | Not Available | 1010 | Open in IMG/M |
3300022407|Ga0181351_1030225 | All Organisms → Viruses → Predicted Viral | 2303 | Open in IMG/M |
3300024346|Ga0244775_10000999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34109 | Open in IMG/M |
3300024346|Ga0244775_10278042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1391 | Open in IMG/M |
3300024346|Ga0244775_10625264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300024346|Ga0244775_10893091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300024346|Ga0244775_11332580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
3300024351|Ga0255141_1028998 | Not Available | 835 | Open in IMG/M |
3300024536|Ga0256338_1153940 | Not Available | 514 | Open in IMG/M |
3300025647|Ga0208160_1173531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300025732|Ga0208784_1005421 | All Organisms → Viruses → Predicted Viral | 4625 | Open in IMG/M |
3300025889|Ga0208644_1012592 | Not Available | 5664 | Open in IMG/M |
3300025889|Ga0208644_1165327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
3300025889|Ga0208644_1166556 | Not Available | 993 | Open in IMG/M |
3300026573|Ga0255269_1201274 | Not Available | 530 | Open in IMG/M |
3300027595|Ga0255122_1066373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300027659|Ga0208975_1001406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10190 | Open in IMG/M |
3300027693|Ga0209704_1030636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1420 | Open in IMG/M |
3300027693|Ga0209704_1057121 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
3300027693|Ga0209704_1156828 | Not Available | 660 | Open in IMG/M |
3300027710|Ga0209599_10003114 | Not Available | 6486 | Open in IMG/M |
3300027710|Ga0209599_10011950 | All Organisms → Viruses → Predicted Viral | 2619 | Open in IMG/M |
3300027710|Ga0209599_10059289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
3300027721|Ga0209492_1031333 | All Organisms → Viruses → Predicted Viral | 1852 | Open in IMG/M |
3300027721|Ga0209492_1157633 | Not Available | 790 | Open in IMG/M |
3300027721|Ga0209492_1242755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300027743|Ga0209593_10134382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300027743|Ga0209593_10205945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300027756|Ga0209444_10214687 | Not Available | 689 | Open in IMG/M |
3300027759|Ga0209296_1000551 | Not Available | 32620 | Open in IMG/M |
3300027759|Ga0209296_1307770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300027769|Ga0209770_10183961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
3300027792|Ga0209287_10190301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300027793|Ga0209972_10000885 | Not Available | 28768 | Open in IMG/M |
3300027798|Ga0209353_10331790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300027804|Ga0209358_10267928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
3300027808|Ga0209354_10257825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
3300027808|Ga0209354_10406113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300027885|Ga0209450_10422429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
3300027899|Ga0209668_10012357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4046 | Open in IMG/M |
3300027899|Ga0209668_10357540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
3300027899|Ga0209668_11209728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300027972|Ga0209079_10030872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1793 | Open in IMG/M |
3300027972|Ga0209079_10147090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300028025|Ga0247723_1000307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 33235 | Open in IMG/M |
3300028025|Ga0247723_1001469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13755 | Open in IMG/M |
3300028025|Ga0247723_1002186 | Not Available | 10656 | Open in IMG/M |
3300028025|Ga0247723_1006865 | All Organisms → Viruses → Predicted Viral | 4895 | Open in IMG/M |
3300028025|Ga0247723_1007519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4607 | Open in IMG/M |
3300028025|Ga0247723_1008018 | All Organisms → Viruses → Predicted Viral | 4416 | Open in IMG/M |
3300028025|Ga0247723_1010813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3537 | Open in IMG/M |
3300028025|Ga0247723_1012433 | All Organisms → Viruses → Predicted Viral | 3204 | Open in IMG/M |
3300028025|Ga0247723_1015744 | All Organisms → Viruses → Predicted Viral | 2698 | Open in IMG/M |
3300028025|Ga0247723_1041648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1362 | Open in IMG/M |
3300028025|Ga0247723_1058949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
3300028027|Ga0247722_10004838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6386 | Open in IMG/M |
3300031707|Ga0315291_10952431 | Not Available | 728 | Open in IMG/M |
3300031707|Ga0315291_11152820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 638 | Open in IMG/M |
3300031758|Ga0315907_10657608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300031784|Ga0315899_10408659 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
3300031784|Ga0315899_10519159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
3300031786|Ga0315908_10234380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
3300031786|Ga0315908_10357883 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
3300031787|Ga0315900_10002004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31953 | Open in IMG/M |
3300031787|Ga0315900_10013646 | Not Available | 9880 | Open in IMG/M |
3300031787|Ga0315900_10131276 | All Organisms → Viruses → Predicted Viral | 2361 | Open in IMG/M |
3300031787|Ga0315900_10663221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 747 | Open in IMG/M |
3300031787|Ga0315900_10789451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300031834|Ga0315290_10916699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300031857|Ga0315909_10019500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6861 | Open in IMG/M |
3300031857|Ga0315909_10115604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2279 | Open in IMG/M |
3300031857|Ga0315909_10142930 | All Organisms → Viruses → Predicted Viral | 1985 | Open in IMG/M |
3300031857|Ga0315909_10314435 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
3300031857|Ga0315909_10435442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300031951|Ga0315904_10004160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20839 | Open in IMG/M |
3300031951|Ga0315904_10138183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2488 | Open in IMG/M |
3300031951|Ga0315904_10494628 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
3300031951|Ga0315904_10681102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
3300031952|Ga0315294_10504019 | All Organisms → Viruses | 1107 | Open in IMG/M |
3300031952|Ga0315294_10903839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 748 | Open in IMG/M |
3300031999|Ga0315274_11199257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 752 | Open in IMG/M |
3300032050|Ga0315906_10001766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 31469 | Open in IMG/M |
3300032092|Ga0315905_10373312 | All Organisms → Viruses → Predicted Viral | 1347 | Open in IMG/M |
3300032093|Ga0315902_10537689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1003 | Open in IMG/M |
3300032093|Ga0315902_11341268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300032116|Ga0315903_10045296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4535 | Open in IMG/M |
3300032156|Ga0315295_11177303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 753 | Open in IMG/M |
3300032177|Ga0315276_10741499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1053 | Open in IMG/M |
3300032516|Ga0315273_11175834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 968 | Open in IMG/M |
3300033418|Ga0316625_102048494 | Not Available | 565 | Open in IMG/M |
3300033816|Ga0334980_0065065 | All Organisms → Viruses → Predicted Viral | 1534 | Open in IMG/M |
3300033984|Ga0334989_0571142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 548 | Open in IMG/M |
3300033993|Ga0334994_0225481 | Not Available | 997 | Open in IMG/M |
3300033995|Ga0335003_0395842 | Not Available | 593 | Open in IMG/M |
3300033996|Ga0334979_0521345 | Not Available | 641 | Open in IMG/M |
3300034050|Ga0335023_0001322 | Not Available | 15099 | Open in IMG/M |
3300034050|Ga0335023_0065798 | All Organisms → Viruses → Predicted Viral | 2110 | Open in IMG/M |
3300034060|Ga0334983_0320486 | Not Available | 920 | Open in IMG/M |
3300034061|Ga0334987_0151322 | All Organisms → Viruses → Predicted Viral | 1698 | Open in IMG/M |
3300034061|Ga0334987_0162566 | All Organisms → Viruses → Predicted Viral | 1619 | Open in IMG/M |
3300034063|Ga0335000_0006296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9488 | Open in IMG/M |
3300034064|Ga0335001_0239241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
3300034082|Ga0335020_0007201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6920 | Open in IMG/M |
3300034102|Ga0335029_0670325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300034104|Ga0335031_0002757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13219 | Open in IMG/M |
3300034107|Ga0335037_0546777 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300034200|Ga0335065_0083511 | All Organisms → Viruses → Predicted Viral | 2187 | Open in IMG/M |
3300034283|Ga0335007_0407661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 848 | Open in IMG/M |
3300034357|Ga0335064_0401283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300034357|Ga0335064_0548819 | Not Available | 729 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.38% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 10.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.53% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.19% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.46% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.80% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 4.10% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.75% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.75% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.75% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.41% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.41% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.73% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.73% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.39% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.71% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.71% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.71% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.37% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.37% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.37% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.02% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.68% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.68% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.68% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.68% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.34% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.34% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.34% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.34% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.34% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002272 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013212 | Freshwater microbial communities from Saiful Muluk Lake, Pakistan | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033984 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
BBAY92_100010549 | 3300000947 | Macroalgal Surface | MTLIELKAKAYDILAQIEYLQKQLQETNQAIGEELKNDNAEVNS* |
BBAY93_101250982 | 3300000973 | Macroalgal Surface | MTLTELKAKAYDILSNLEYLQKQLQDVNQKIAEELKNEHAEVNP* |
JGIcombinedJ13530_1079712131 | 3300001213 | Wetland | MNLTELKAQAYDILAQIEFLQKKLQETNQAIGEELKKDEVSTN* |
B570J14230_101161912 | 3300001282 | Freshwater | MTLLELKGAAYDLLANLEHLQKQLQEVNQKIAEELQKEKNENG* |
B570J29579_1016442 | 3300002272 | Freshwater | MTLIELKAAAYDLLAQIEYLQKQLQETNAKIGEELQKEKNENG* |
B570J29032_1094970453 | 3300002408 | Freshwater | MTLIELKAAAYDLLAQIEYLQKQLQETNAKIGEELQKQNNENG* |
B570J40625_1007690761 | 3300002835 | Freshwater | MTLIELKAAAYDILSNLEYLQKQLQEVNQKIAEELQKEKNENG* |
B570J40625_1008778232 | 3300002835 | Freshwater | MTLTELKAQAYDILAQIEFLQKKLQETNQLIGEKINEEKVDG* |
Ga0063233_100170534 | 3300003986 | Freshwater Lake | MTLIELKAQAYDILAQIEFLQKKLQETNQSIGEELKKQEEAPSA* |
Ga0065166_102157881 | 3300004112 | Freshwater Lake | MTLIEMKAQAYDLLANLEHLQKQLHEINQKIAQKLQEDQAGE* |
Ga0065166_103025792 | 3300004112 | Freshwater Lake | MDTITTLKAKAYDLLANLEYIQKQLQEVNQQIAEEMKKNEDSAN* |
Ga0007787_106566311 | 3300004240 | Freshwater Lake | MTLVELKAAAYDILSNLEYLQKQLQEVNQKIAEELQKEKNENG* |
Ga0069718_139605612 | 3300004481 | Sediment | MTITELKAKCYDILAQMEYLQKELQQLNQQIAEQMKNEEASTDSSVL* |
Ga0069718_149906282 | 3300004481 | Sediment | MTIVEMKAAAYDALAQIEYLQKQLQEINQKIAEELQKEKQENG* |
Ga0069718_157300912 | 3300004481 | Sediment | MENLSITDLKARAYDLLANLEYLQKQLAEVNQQIAEKMKNEEATDSSAA* |
Ga0069718_158613741 | 3300004481 | Sediment | MNLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKENKENG* |
Ga0069718_159043963 | 3300004481 | Sediment | MNLKELKAKAYDLLAQIEYLQRELQQVNQQIAEESKNENTSN* |
Ga0007760_110867612 | 3300004793 | Freshwater Lake | LYKLNIMTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG* |
Ga0007759_112996991 | 3300004836 | Freshwater Lake | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKAENG* |
Ga0068876_10000021120 | 3300005527 | Freshwater Lake | MELVELKAKAYDIISQIEYLQKLLQETNQQIAVKIQEQEAMKGGE* |
Ga0068876_1000045119 | 3300005527 | Freshwater Lake | MTLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG* |
Ga0068876_104694422 | 3300005527 | Freshwater Lake | MTLVELKASAYDCLAQIEYLQKQLQEINQKIAEELQKEKNENG* |
Ga0049081_100006514 | 3300005581 | Freshwater Lentic | MTLVELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG* |
Ga0049081_101588673 | 3300005581 | Freshwater Lentic | FYLKLNTMTLVELKASAYDCLAQIEYLQKQLQEINQKIAEELQKEKNENG* |
Ga0049080_102802272 | 3300005582 | Freshwater Lentic | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKENNENG* |
Ga0078894_100097231 | 3300005662 | Freshwater Lake | LYKLNTMNLTELKAQAYDILAQIEYLQKQLQETNAKIGEEIQKQNNENG* |
Ga0078894_105629962 | 3300005662 | Freshwater Lake | MTLIELKAAAYDILSNLEYLQKQLQEVNQKIAEELQKEKAENG* |
Ga0078894_106023102 | 3300005662 | Freshwater Lake | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG* |
Ga0078894_111485582 | 3300005662 | Freshwater Lake | MTLLELKGAAYDCLAQIEYLQKQLQEVNQKIAEELQKEKNENG* |
Ga0079957_10588182 | 3300005805 | Lake | MNLTELKAKAYDLLANLEYIQKQLQEVNQQIAEEMQKNDKADSDN* |
Ga0079957_11291032 | 3300005805 | Lake | MNLTELKAQAYDILAQIEYLQKQLQDTNAKIGEELQKEKNENG* |
Ga0073910_10158553 | 3300006005 | Sand | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKQNNENG* |
Ga0070744_1000003739 | 3300006484 | Estuarine | MTLVELKAKAYDILAQIEYLQKQLQETNQAIGEELKKEQE* |
Ga0070744_100568604 | 3300006484 | Estuarine | MTIVEMKAAAYDLLAQLEYLQKQLQEINQKIAEELNKSKEEGL* |
Ga0070744_101825002 | 3300006484 | Estuarine | MTLIELKASAYDILSNLEYLQKQLQEVNQKIGEELQKEKQENG* |
Ga0075471_100160487 | 3300006641 | Aqueous | MDNITSLKAKAYDLLAQLEYLQKQLQEVNQQIAEEMKKNEDSSN* |
Ga0070749_100033205 | 3300006802 | Aqueous | MNLTELKAQAYDLLAQIEYLQKQLQETNQKIGQAMQDQSEEKNED* |
Ga0070749_100566972 | 3300006802 | Aqueous | MNLTELKAAAYDALANIEFWQRKLQEINQQIAEEAKKSEEPSN* |
Ga0070749_101221122 | 3300006802 | Aqueous | MDVTTLKAKAYDLLANIEYLQKQLVEVNQQIAEQMQKDENASSDSND* |
Ga0070749_101667485 | 3300006802 | Aqueous | MNLTELKAAAYDALVNVEYWQRKLQEINQQIAEESKKQEEEK* |
Ga0070749_102065382 | 3300006802 | Aqueous | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEEIQKQNNENG* |
Ga0070749_102593094 | 3300006802 | Aqueous | MNLTELKAKAYDILAQIEYLQKELQNVNQAIGEELKKHQEESEN* |
Ga0070748_12221392 | 3300006920 | Aqueous | MTLTELKAQAYDILAQIEYLQKKLQETNQLIGEEINEQKSDG* |
Ga0070748_12813763 | 3300006920 | Aqueous | MELIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG* |
Ga0099851_11874023 | 3300007538 | Aqueous | MDLITLKATAYDILAQIEYLQKKLQETNQAIADKIKQEQEVDG* |
Ga0099851_12878333 | 3300007538 | Aqueous | NFVKNIIMTLIELKSSAYDCLAQIEFLQKKLQEINQAISEELKKEEA* |
Ga0108970_108652216 | 3300008055 | Estuary | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKQNNENG* |
Ga0108970_114011912 | 3300008055 | Estuary | MTLIELKSQAYDILAQIEYLQKKLQETNQAIAEEINKEKSESN* |
Ga0108970_114817254 | 3300008055 | Estuary | MNLTELKAEAYDILAQIEFLQKKLQETNQAIPAELQKANDEKPQ* |
Ga0114340_10289967 | 3300008107 | Freshwater, Plankton | MTLVEMKAAAYDLLANLEYIQKQLQEVNQKIAEELQKEKNENG* |
Ga0114344_10053113 | 3300008111 | Freshwater, Plankton | MNLVELKAEAYDILAQIEFLQKKLQETNQAIAAELQKANDEKPQ* |
Ga0114346_13035262 | 3300008113 | Freshwater, Plankton | MNLTELKAQAYDILASLEYHQKQLQELNQKIAEEIEKLKQENG* |
Ga0114346_13223742 | 3300008113 | Freshwater, Plankton | MTLIELKSQAYDTLANIEYLQKKLQELNQAIAEEINKEKSESN* |
Ga0114351_11602803 | 3300008117 | Freshwater, Plankton | MELIELKAQAYDILSNLEYLQKQLQEVNQKIAQKMQEEKSED* |
Ga0114336_100830715 | 3300008261 | Freshwater, Plankton | MELIELKAQAYDILSNLEYLQKQLQEVNQKIAQKMQEEKAEN* |
Ga0114336_13615423 | 3300008261 | Freshwater, Plankton | AYDILAQIEYLQKQLQETNAKIGEELQKENKENG* |
Ga0114363_10365611 | 3300008266 | Freshwater, Plankton | MENLTIKDLKVRAYDLLANLEYLQKQLAEVNQQIAEKMKNEEATDSSAA* |
Ga0114363_10570294 | 3300008266 | Freshwater, Plankton | MNLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKENKE |
Ga0114363_11135435 | 3300008266 | Freshwater, Plankton | MNLIELKAQAYDIIAEIEYLQNKLKETNAKIGEELQKENKENG* |
Ga0114363_11224452 | 3300008266 | Freshwater, Plankton | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKENKENG* |
Ga0114363_11499965 | 3300008266 | Freshwater, Plankton | MELITLKAQAYDCLASIEHLQKQLQEINQKIAQKMQEEKSED* |
Ga0114363_12275702 | 3300008266 | Freshwater, Plankton | MDLITLKAQAYDILAQIEYLQKQLQETNAKIGEEIQKQNNENG* |
Ga0114364_10305516 | 3300008267 | Freshwater, Plankton | MELIELKAQAYDCLASIEHLQKQLQEINQKIAQKMQEEKSED* |
Ga0114364_10352934 | 3300008267 | Freshwater, Plankton | MNLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQ |
Ga0114364_10831411 | 3300008267 | Freshwater, Plankton | YTMNLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKENKENG* |
Ga0114364_10908715 | 3300008267 | Freshwater, Plankton | KAQAYDILAQIEYLQKQLQETNAKIGEELQKQNNENG* |
Ga0114876_10168057 | 3300008448 | Freshwater Lake | MNLTDLKAKAYDLLAQIEYLQRELQQTNQQIAEESKNEAASN* |
Ga0114876_10542775 | 3300008448 | Freshwater Lake | MNLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKTENG* |
Ga0114876_10617953 | 3300008448 | Freshwater Lake | MHKFVKKNPMTLIEMKAQAYDLLANLEHLQKQLHEINQKIAQKLQEDQAGE* |
Ga0114876_10676571 | 3300008448 | Freshwater Lake | MNLIELKAQAYDIIAEIEYLQKQLQETNAKIGEELQKENKENG* |
Ga0114876_11600451 | 3300008448 | Freshwater Lake | MNLTELKAQAYDILAQIEYLQKQLQEVNAKIGEEIQKQQTENG* |
Ga0114876_12398322 | 3300008448 | Freshwater Lake | MNLIELKAQAYDILANLEYNQKQLQELNQKIAEEIEKLKQENG* |
Ga0114880_10357475 | 3300008450 | Freshwater Lake | MNLTELKAAAYDILASLEYHQKQLQELNQKIAEEIEKLKNENG* |
Ga0114880_11301593 | 3300008450 | Freshwater Lake | TDLKARAYDLLANLEYLQKQLAEVNQQIAEKMKNEEATDSSAA* |
Ga0114880_11414922 | 3300008450 | Freshwater Lake | MTLIELKAAAYDILSNLEYLQKQLQEVNQKIAEELQKENKENG* |
Ga0114880_11419263 | 3300008450 | Freshwater Lake | MTLVEMKAAAYDLLANLEYIQKQLQEVNQKIAEELQKEKKENG* |
Ga0114880_12658813 | 3300008450 | Freshwater Lake | MNLTELKAQAYDILAQLEYLQKQLQETNAKIGEELQKQNNENG* |
Ga0105105_105542002 | 3300009009 | Freshwater Sediment | MLTELKAKAYDLLAQLEYLQKQLQEVNQKIAEEMKQNEGSSN* |
Ga0105090_105847072 | 3300009075 | Freshwater Sediment | MSITELKAKAYDILSHLEYLQKQLQEVNQQIAEEMKKNEDTSN* |
Ga0105098_101810802 | 3300009081 | Freshwater Sediment | MTLVEMKSAAYDCLAQIEYLQKQLQEINQKIAEELQKQNNENG* |
Ga0105098_101884302 | 3300009081 | Freshwater Sediment | MNLTELKAKAYDLLANLEYIQKQLQEVNQQIAEEMKKNEDSSN* |
Ga0105098_102589323 | 3300009081 | Freshwater Sediment | MTLVELKAKAYDILAQIEYLQKQLQETNQAIGEELKKDETTLA* |
Ga0105103_100644523 | 3300009085 | Freshwater Sediment | MTLTELKAAAYDLLANLEHLQKQLQEVNQKIAEELQKEKNENG* |
Ga0105103_102043863 | 3300009085 | Freshwater Sediment | MNLTELKAQAYDILAQIEFLQKKLQETNQAIGEELKKDEVSAD* |
Ga0105103_103664201 | 3300009085 | Freshwater Sediment | MDTITSLKAKAYDLLANLEYIQKQLQEVNQQIAEEMQKNDKADSSN* |
Ga0105103_105849151 | 3300009085 | Freshwater Sediment | MNLTDLKAKAYDLLAQLEYLQKQLQEVNQQIAEEMKKNEDTSN* |
Ga0105103_108570611 | 3300009085 | Freshwater Sediment | MNITELKAKAYDILSNLEYLQKQLQEVNQQIGEEMQKENDGKNNLTVADNS* |
Ga0115026_109700882 | 3300009111 | Wetland | MTLVELKAAAYDILSNLEYLQKQLQEVNQKIAEELKKEKEENG* |
Ga0105091_101012023 | 3300009146 | Freshwater Sediment | MTLIELKAQAYDILAQIEFLQKKLQETNQAIGEELKKDNEQESA* |
Ga0105102_100505645 | 3300009165 | Freshwater Sediment | MTLTELKAAAYDLLANLEHLQKQLQEVNAKIGEELQKEKNENG* |
Ga0105102_101356344 | 3300009165 | Freshwater Sediment | MNLTELKASAYDLLAQLEYLQKQLQEVNQKIAEEMKQNEGNSN* |
Ga0105102_102905191 | 3300009165 | Freshwater Sediment | MNLTELKAQAYDILAQIEYLQKKLQETNQAIGEELKKDEVSAD* |
Ga0105102_107107823 | 3300009165 | Freshwater Sediment | MTLIELKAAAYDLLAQIEYLQKQLQEINAKIGEELQKQNNDNG* |
Ga0105104_102684924 | 3300009168 | Freshwater Sediment | MTLTELKAAAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG* |
Ga0105104_107641072 | 3300009168 | Freshwater Sediment | MTLTELKAQAYDILSQLEYLQKKLQETNQAIGEKIKEEQETPKVDG* |
Ga0105097_101314053 | 3300009169 | Freshwater Sediment | MNLTELKAQAYDILAQIEFLQKKLQETNQAIGEEMKKGEDSAE* |
Ga0105097_103845892 | 3300009169 | Freshwater Sediment | MTLVELKAAAYDLLANLEHLQKQLQEVNAKIGEELQKEKNENG* |
Ga0105096_101040291 | 3300009170 | Freshwater Sediment | MNLTELKAKAYDLLAQLEYLQKQLQEVNQQIAEEMKKNEDTSN* |
Ga0105096_103450831 | 3300009170 | Freshwater Sediment | MNLTELKAQAYDILAQIEFLQKKLQETNQQIGEELKKDESSSD* |
Ga0114974_1000050414 | 3300009183 | Freshwater Lake | MTLTELKAQAYDILAQIEFLQKKLQETNQAIGEKIKEESKTQDVDG* |
Ga0114974_102755823 | 3300009183 | Freshwater Lake | MTLVELKAAAYDILSNLEYLQKQLQEINQKIAEELQKEKNENG* |
Ga0114976_102868813 | 3300009184 | Freshwater Lake | MTLIELKAQAYDILAQIEFLQKKLQETNEAIGKELKNQETAPTE* |
Ga0114983_10643973 | 3300009194 | Deep Subsurface | MTLIELKASAYDCLAQIEYLQKQLQEINQKIAEELQKEKNENG* |
Ga0114982_10163224 | 3300009419 | Deep Subsurface | MTLTELKAQAYDILAQIEFLQKKLQETNQQIGEKINEEKVDG* |
Ga0114982_10741103 | 3300009419 | Deep Subsurface | MTLIELKASAYDLLANLEYIQKQLQEVNQKIAEELQKEKNENG* |
Ga0114982_11946632 | 3300009419 | Deep Subsurface | MSLVELKSSAYDCLAQIEYLQKQLQEINQKIGEELKKEKQENG* |
Ga0129333_104299882 | 3300010354 | Freshwater To Marine Saline Gradient | MSITELKAKAYDLLANIEYLQKQLVEVNQQIAEQMKNEEATTDSAA* |
Ga0129333_108213892 | 3300010354 | Freshwater To Marine Saline Gradient | MNLTELKAKAYDLLANLEYIQKQLQEVNQQIAEEMKKNEDNSN* |
Ga0151516_112369 | 3300011116 | Freshwater | MNLTELKAQAYDILSNLEYLQKQLQEVNQKIAEELQNQKNENG* |
Ga0151620_10032165 | 3300011268 | Freshwater | MNLTELKAQAYDILAQIEFLQKKLQETNQAISEELNKEKSETE* |
Ga0151620_10113143 | 3300011268 | Freshwater | MTLTEMKAAAYDLLANLEYIQKQLQEINAKIGEEIQKQNTENG* |
Ga0151620_10311156 | 3300011268 | Freshwater | MNLTELKAEAYDILAQIEFLQKKLQETNQAIAAELQKANDEKPQ* |
Ga0151620_10823553 | 3300011268 | Freshwater | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKVNNENG* |
Ga0153697_105113 | 3300011334 | Freshwater | MSIIELKAKAYDLLATLEYTQKQLQEVNQKIAEELQKEKNENG* |
Ga0153698_11088 | 3300011335 | Freshwater | MDLISLKAQAYDILSNLEYFQKQLQEVNQKIAEELQKEKEENG* |
Ga0153703_111839 | 3300011336 | Freshwater | MNLVELKAAAYDILSNLEYLQKQLQEVNQKIAEELQKEKNENG* |
Ga0153702_144320 | 3300011337 | Freshwater | MTLTDLKASAYDCLAQIEYLQKQLQEINQKIAEELQKEKNENG* |
Ga0153700_1037324 | 3300011339 | Freshwater | MTIVELKASAYDCLAQIEYLQKQLQEINQKIAEELQKEKNENG* |
Ga0153700_1117120 | 3300011339 | Freshwater | MSIIELKAAAYDLLAQLEYTQKQLQEVNQKIAEEIEKLNKENGQTN* |
Ga0119951_10262636 | 3300012000 | Freshwater | MTLIELKSQAYDILSQIEYLQRKLQETNQAIAEEINKEKSESN* |
Ga0153799_10119585 | 3300012012 | Freshwater | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG* |
Ga0157140_100001424 | 3300012348 | Freshwater | MTLIELKAQAYDIIAQIEYLQEQLKETNAKIGEELQKEKTENG* |
Ga0157138_10091064 | 3300012352 | Freshwater | MNLIELKAQAYDILSNLEYLQKQLQEINQKIAQKMQEEKAEN* |
Ga0157203_100096415 | 3300012663 | Freshwater | MTLLEMKGAAYDCLAQIEYFQKQLQEINQKIAEELQKEKNENG* |
Ga0157203_10066281 | 3300012663 | Freshwater | MTLVELKASAYDCLAQIEYLQKQLQEINQKIAEELQKE |
Ga0157203_10391463 | 3300012663 | Freshwater | MTLLQLKGAAYDCLAQIEYLQKQLQEINQKIAEELQKEKNEN |
Ga0164293_100720222 | 3300013004 | Freshwater | MNLTELKAQAYDILAQIEYLQKKLQETNQAIGEELKKDEVPAN* |
Ga0164293_102768252 | 3300013004 | Freshwater | MNLTELKAQAYDILAQIEYLQKQLQDTNAKIGEELQKENNENG* |
Ga0164293_104340073 | 3300013004 | Freshwater | MTLIELKAAAYDLLANLEHLQKQLQEVNQKIAEEHQKENNENG* |
Ga0164292_103434521 | 3300013005 | Freshwater | TMNLTELKAQAYDNLAQIEYLQKHLQDTNAKIGEELQKEKNENG* |
(restricted) Ga0172362_105373503 | 3300013133 | Sediment | MTLVELKAKAYDILAQIEYLQQELAKVNQKISNSLKEEK |
Ga0172421_10716217 | 3300013212 | Freshwater | MNLTELKAAAYDILANLEHLQKQLQEVNQKINEELQKEKNENG* |
Ga0177922_101662984 | 3300013372 | Freshwater | AQAYDILAQIEYLQKQLQETNAKIGEELQKEKAENG* |
Ga0177922_102064391 | 3300013372 | Freshwater | MTLIELKAAAYDLLANLEYIQKQLQEVNQKISEELQKEKNENG* |
Ga0177922_109854182 | 3300013372 | Freshwater | MELIELKAQAYDILSNLEYLQKQLQEVNQKIAQKMQEEKAED* |
Ga0181364_10161315 | 3300017701 | Freshwater Lake | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEEIQKEKNENG |
Ga0181363_10218012 | 3300017707 | Freshwater Lake | MTLIELKAAAYDILSNLEYLQKQLQEINQKIAEELQKEKNENG |
Ga0181363_10466362 | 3300017707 | Freshwater Lake | MDNITSLKAKAYDLLAQLEYLQKQLQEVNQQIAEEMKKNED |
Ga0181350_11043461 | 3300017716 | Freshwater Lake | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKE |
Ga0181347_11485493 | 3300017722 | Freshwater Lake | MNLTEMKAQVYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0181362_10359205 | 3300017723 | Freshwater Lake | TLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKAENG |
Ga0181365_10459553 | 3300017736 | Freshwater Lake | MTLIELKAAAYDILSNLEYLQKQLQEVNQKISEELQKEKKENG |
Ga0181352_100152921 | 3300017747 | Freshwater Lake | MDNITSLKAKAYDLLAQLEYLQKQLQEVNQQIAEEMKNNEDSSN |
Ga0181344_11019222 | 3300017754 | Freshwater Lake | MNLTELKAKAYDLLANLEYIQKQLQEVNQQIAEEMKKNEDSAN |
Ga0181344_12149691 | 3300017754 | Freshwater Lake | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKQNN |
Ga0181343_10129652 | 3300017766 | Freshwater Lake | MDTITTLKAKAYDLLANLEYIQKQLQEVNQQIAEEMKKNEDSAN |
Ga0181343_11267562 | 3300017766 | Freshwater Lake | MTLIEMKAQAYDLLANLEHLQKQLHEINQKIAQKLQEDQAGE |
Ga0181358_12318231 | 3300017774 | Freshwater Lake | MTLIELKAAAYDILSNLEYLQKQHQEVNQKISEELQKEKNEN |
Ga0181357_11267803 | 3300017777 | Freshwater Lake | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEEHQ |
Ga0181349_12992282 | 3300017778 | Freshwater Lake | IELKAQAYDILAQIEFLQKKLQETNQSIGEELKKQEEAPSA |
Ga0181346_10257413 | 3300017780 | Freshwater Lake | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKTENG |
Ga0181348_11371733 | 3300017784 | Freshwater Lake | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQK |
Ga0181348_12297563 | 3300017784 | Freshwater Lake | MTLIELKTQAYDILAQIEYLQKQLQETNAKIGEELQKE |
Ga0181355_12549513 | 3300017785 | Freshwater Lake | MTLIELKAAAYDILSNLEYLQKQLQEVNQKISEELQKEK |
Ga0181355_12902813 | 3300017785 | Freshwater Lake | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEEL |
Ga0187842_10303602 | 3300018790 | Freshwater | MTLVELKAQAYDILAQIEFLQKKLQETNQSIGEELKKQEEAPSA |
Ga0187843_100267587 | 3300019093 | Freshwater | MTLTELKAQAYDILAQIEFLQKKLQETNQQIGEKINEEKVDG |
Ga0181359_10657524 | 3300019784 | Freshwater Lake | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKAENG |
Ga0181359_10840233 | 3300019784 | Freshwater Lake | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0181359_11363393 | 3300019784 | Freshwater Lake | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0181359_11627592 | 3300019784 | Freshwater Lake | MTLIELKASAYDLLANLEYIQKQLQEVNQKISEELQKEKNENG |
Ga0207193_11952893 | 3300020048 | Freshwater Lake Sediment | MDSITSLKARAYDLLAQLEYLQKQLQEVNQQIAEEMKKNEDSSN |
Ga0211736_102473482 | 3300020151 | Freshwater | MNLTELKAAAYDILANLEHLQKQLQEVNQKINEELQKPKEENG |
Ga0211734_107712772 | 3300020159 | Freshwater | MNLIELKAQAYDILAQIEYLQKQLQEVNQKIAEELQKENKENG |
Ga0208088_10254171 | 3300020505 | Freshwater | YNIMTLTELKAQAYDILAQIEFLQKKLQETNQLIGEKINEEKVDG |
Ga0208232_10156003 | 3300020527 | Freshwater | MNLTELKAQAYDILAQIEYLQKQLQDTNAKIGEELQKENNENG |
Ga0208361_10022703 | 3300020547 | Freshwater | MTLIELKAAAYDLLAQIEYLQKQLQETNAKIGEELQKQNNENG |
Ga0208360_10067905 | 3300020551 | Freshwater | MTLIELKAAAYDLLAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0208082_10099585 | 3300020563 | Freshwater | MTLTEMKAAAYDLLANLEYIQKQLQEVNQKIAEELQKEKNENG |
Ga0222714_100079912 | 3300021961 | Estuarine Water | MTLIELKAAAYDILSNLEYLQKQLQEVNQKISEELQKEKNENG |
Ga0222714_100815156 | 3300021961 | Estuarine Water | MTLTEMKAAAYDLLANLEYIQKQLQEINAKIGEEIQKQNNENG |
Ga0222714_101817572 | 3300021961 | Estuarine Water | MDTITTLKAKAYDLLANLEYIQKQLQEVNQQIAEEMQKNDKADSDN |
Ga0222714_102704473 | 3300021961 | Estuarine Water | MNIIELKAKAYDILAQIEYLQKQLQETNAKIGEELQKENTENG |
Ga0222714_103011894 | 3300021961 | Estuarine Water | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEEIEKQKNENG |
Ga0222714_103512512 | 3300021961 | Estuarine Water | MNLIELKAKAYDILAQIEYLQKQLQETNQAIGEEMQKQNGEQAS |
Ga0222713_102049032 | 3300021962 | Estuarine Water | MTLIELKSQAYDILAQIEYLQKKLQETNQAIAEEINKEKSESN |
Ga0222713_104728481 | 3300021962 | Estuarine Water | INTMTLTEMKAAAYDLLANLEYIQKQLQEINAKIGEEIQKQNNENG |
Ga0222712_1000296720 | 3300021963 | Estuarine Water | MTLTEMKAAAYDLLANLEYIQKQLQEINAKIGEELQKQNTENG |
Ga0222712_102843592 | 3300021963 | Estuarine Water | MDLKDLKSQAYDILAQLEFLQQKLKETNDQIAEEM |
Ga0222712_107577632 | 3300021963 | Estuarine Water | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEEIQK |
Ga0181353_10496552 | 3300022179 | Freshwater Lake | MTLIELKAAAYDLLANLEHLQKQLQEVNQKIAEEHQKEEKENG |
Ga0181353_10877793 | 3300022179 | Freshwater Lake | HKLNNMELIELKAQAYDILSNLEYLQKQLQEVNQKIAQKMQEEKSED |
Ga0181354_10894741 | 3300022190 | Freshwater Lake | MTLIELKASAYDLLANLEYIQKQLQEVNQKISEELQN |
Ga0181351_10302252 | 3300022407 | Freshwater Lake | MDTITSLKATAYDLLANLEYIQKQLQEVNQKIAEEMKKNEDSSN |
Ga0244775_1000099916 | 3300024346 | Estuarine | MTLVELKAKAYDILAQIEYLQKQLQETNQAIGEELKKEQE |
Ga0244775_102780425 | 3300024346 | Estuarine | MTIVEMKAAAYDLLAQLEYLQKQLQEINQKIAEELNKSKEEGL |
Ga0244775_106252643 | 3300024346 | Estuarine | MTLIELKASAYDILSNLEYLQKQLQEVNQKIGEELQKEKQENG |
Ga0244775_108930912 | 3300024346 | Estuarine | MTIVELKAAAYDLLAQLEYTQKQLQEVNQKIAEELQKEKQENG |
Ga0244775_113325802 | 3300024346 | Estuarine | MTLIELKAKAYDILAQIEYLQKQLQETNQAIGEEIQKENGESN |
Ga0255141_10289983 | 3300024351 | Freshwater | MTLIELKSQAYDTLANIEYLQKKLQELNQAIAEEINKEKSESN |
Ga0256338_11539401 | 3300024536 | Freshwater | IELKSQAYDTLANIEYLQKKLQELNQAIAEEINKEKSESN |
Ga0208160_11735312 | 3300025647 | Aqueous | TELKAKAYDLLANLEYLQKQLAEVNQQIGEQMKNEEVTPAD |
Ga0208784_10054212 | 3300025732 | Aqueous | MDNITSLKAKAYDLLAQLEYLQKQLQEVNQQIAEEMKKNEDSSN |
Ga0208644_10125925 | 3300025889 | Aqueous | MNLTELKAQAYDLLAQIEYLQKQLQETNQKIGQAMQDQSEEKNED |
Ga0208644_11653274 | 3300025889 | Aqueous | MNLTELKAKAYDILAQIEYLQKELQNVNQAIGEELKKHQEESEN |
Ga0208644_11665562 | 3300025889 | Aqueous | MDVTTLKAKAYDLLANIEYLQKQLVEVNQQIAEQMQKDENASSDSND |
Ga0255269_12012743 | 3300026573 | Freshwater | QAYDTLANIEYLQKKLQELNQAIAEEINKEKSESN |
Ga0255122_10663734 | 3300027595 | Freshwater | TELKAAAYDILASLEYHQKQLQELNQKIAEEIEKLKQENG |
Ga0208975_10014068 | 3300027659 | Freshwater Lentic | MTLVELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0209704_10306361 | 3300027693 | Freshwater Sediment | MTLTELKAAAYDLLANLEHLQKQLQEVNQKIAEELQKEKNENG |
Ga0209704_10571212 | 3300027693 | Freshwater Sediment | MNLTELKAKAYDLLANLEYIQKQLQEVNQQIAEEMKKNEDSSN |
Ga0209704_11568281 | 3300027693 | Freshwater Sediment | LTELKAKAYDLLAQLEYLQKQLQEVNQQIAEEMKKNEDTSN |
Ga0209599_100031144 | 3300027710 | Deep Subsurface | MNLTELKAQAYDILAQIEYLQKQLQDTNAKIGEELQKEKNENG |
Ga0209599_100119506 | 3300027710 | Deep Subsurface | MTLIELKASAYDLLANLEYIQKQLQEVNQKIAEELQKEKNENG |
Ga0209599_100592894 | 3300027710 | Deep Subsurface | MSLVELKSSAYDCLAQIEYLQKQLQEINQKIGEELKKEKQENG |
Ga0209492_10313332 | 3300027721 | Freshwater Sediment | MNLTELKAKAYDLLAQLEYLQKQLQEVNQQIAEEMKKNEDTSN |
Ga0209492_11576331 | 3300027721 | Freshwater Sediment | MNLTELKAQAYDILAQIEFLQKKLQETNQAIGEEMKKGEDSAE |
Ga0209492_12427552 | 3300027721 | Freshwater Sediment | MTLVELKAAAYDLLANLEHLQKQLQEVNAKIGEELQKEKNENG |
Ga0209593_101343822 | 3300027743 | Freshwater Sediment | MDTITSLKAKAYDLLANLEYIQKQLQEVNQQIAEEMQKNDKADSSN |
Ga0209593_102059454 | 3300027743 | Freshwater Sediment | MTLTELKAAAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0209444_102146873 | 3300027756 | Freshwater Lake | YMTLIELKAQAYDILAQIEFLQKKLQETNQSIGEELKKQEEAPSA |
Ga0209296_100055137 | 3300027759 | Freshwater Lake | MTLTELKAQAYDILAQIEFLQKKLQETNQAIGEKIKEESKTQDVDG |
Ga0209296_13077701 | 3300027759 | Freshwater Lake | MTLVELKAAAYDILSNLEYLQKQLQEINQKIAEELQKE |
Ga0209770_101839611 | 3300027769 | Freshwater Lake | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNEN |
Ga0209287_101903013 | 3300027792 | Freshwater Sediment | KASAYDCLAQIEYLQKQLQEVNQKIAEELQKEKNENG |
Ga0209972_100008859 | 3300027793 | Freshwater Lake | MELVELKAKAYDIISQIEYLQKLLQETNQQIAVKIQEQEAMKGGE |
Ga0209353_103317901 | 3300027798 | Freshwater Lake | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQK |
Ga0209358_102679282 | 3300027804 | Freshwater Lake | MTLVELKAAAYDILSNLEYLQKQLQEVNQKIAEELQKEKNENG |
Ga0209354_102578252 | 3300027808 | Freshwater Lake | MTLTELKAQAYDILAQIEFLQKKLQETNQLIGEKINEEKVDG |
Ga0209354_104061132 | 3300027808 | Freshwater Lake | MDLITLKASAYDILAQIEYLQKKLQETNQAIGEKIKQEQETQEVDG |
Ga0209450_104224294 | 3300027885 | Freshwater Lake Sediment | MTLVEMKAAAYDILSNLEYLQKQLQEVNQKIAEELQKEKAENG |
Ga0209668_100123571 | 3300027899 | Freshwater Lake Sediment | MTLIELKAKAYDILAQLEFLQKQLQETNEAIGKELQNQEAPSAE |
Ga0209668_103575402 | 3300027899 | Freshwater Lake Sediment | MTLIELKSNAYDCLAQIEFLQKKLQEINQAIGEELKKEKEGE |
Ga0209668_104461762 | 3300027899 | Freshwater Lake Sediment | MELMELKAKAYDILSNLEYLQNQLKEVNQLIAKKIQEDQKEEKTD |
Ga0209668_112097282 | 3300027899 | Freshwater Lake Sediment | MTLIELKAQAYDILAQIEFLQKKLQETNQQIGEEMKKQEKNLIHSAKIL |
Ga0209079_100308727 | 3300027972 | Freshwater Sediment | MTLTELKAAAYDLLANLEHLQKQLQEVNAKIGEELQKEKNENG |
Ga0209079_101470903 | 3300027972 | Freshwater Sediment | MTLTELKAAAYDLLANLEHLQKQLQEVNQKIAEELQKEKNEN |
Ga0247723_100030714 | 3300028025 | Deep Subsurface Sediment | MTLVEMKAAAYDLLANLEYIQKQLQEINQKIAEELQKEKNENG |
Ga0247723_10014699 | 3300028025 | Deep Subsurface Sediment | MNLVELKAQAYDILAQIEYLQKQLQETNAKIGEELQKDKNENG |
Ga0247723_10021861 | 3300028025 | Deep Subsurface Sediment | MTLTELKAQAYDILSNLEFLQKKLQETNQAIAEKIKEEQSTPKVDG |
Ga0247723_10068659 | 3300028025 | Deep Subsurface Sediment | MTLIELKASAYDCLAQIEYLQKQLQEINQKIAEELQKEKKENG |
Ga0247723_10075192 | 3300028025 | Deep Subsurface Sediment | MELIELKAQAYDILSNLEYLQKQLQEVNQKIAQKMQEEKAEN |
Ga0247723_10080183 | 3300028025 | Deep Subsurface Sediment | MTLVELKAAAYDCLAQIEYLQKQLQEINQKIAEELQKEKNENG |
Ga0247723_10108135 | 3300028025 | Deep Subsurface Sediment | MTLTELKAQAYDILSNLEYLQKKLQETNQLIGQKINEESQNQDVDGKEK |
Ga0247723_10124333 | 3300028025 | Deep Subsurface Sediment | MTLIELKAQAYDILAQVEFLQKKLQETNQLIGQKINEESQNQDVDGKEK |
Ga0247723_10157441 | 3300028025 | Deep Subsurface Sediment | KEQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0247723_10416484 | 3300028025 | Deep Subsurface Sediment | MTLTELKAQAYDILAQVEFLQKKLQETNQLIGQKINEESQNQDVDGKEK |
Ga0247723_10589494 | 3300028025 | Deep Subsurface Sediment | MTLLELKAQAYDILAQVEFLQKKLQETNQLIGQKIQEEQSTPKVDG |
Ga0247722_100048385 | 3300028027 | Deep Subsurface Sediment | MDLITLKASAYDILAQIEYLQKQLQEVNAKIGEELQKEKNDNG |
Ga0315291_109524313 | 3300031707 | Sediment | MTLIELKASAYDILAQIEYLQKQLQETNAKIGEELQKEKNE |
Ga0315291_111528203 | 3300031707 | Sediment | NIMTLIELKASAYDILAQIEYLQKQLQETNAKIGEELQKQNNENG |
Ga0315907_106576082 | 3300031758 | Freshwater | MENLTIKDLKVRAYDLLANLEYLQKQLAEVNQQIAEKMKNEEATDSSAA |
Ga0315899_104086594 | 3300031784 | Freshwater | MNLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKENKENG |
Ga0315899_105191594 | 3300031784 | Freshwater | MNLTELKAQAYDILASLEYHQKQLQELNQKIAEEIEKLKQENG |
Ga0315908_102343804 | 3300031786 | Freshwater | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKQNNENG |
Ga0315908_103578832 | 3300031786 | Freshwater | MNLTELKAQAYDILAQIEYLQKQLQETNTKIGEELQKEKNENG |
Ga0315900_100020045 | 3300031787 | Freshwater | MNLTELKAQAYDILAQIEYLQKQLQETNAKIGEEIQKQKEEGL |
Ga0315900_1001364623 | 3300031787 | Freshwater | MELKAKAYDILSNLEYLQKQLQEVNQLIAKKIQEEKTD |
Ga0315900_101312762 | 3300031787 | Freshwater | MENLSITDLKARAYDLLANLEYLQKQLAEVNQQIAEKMKNEEATDSSAA |
Ga0315900_106632213 | 3300031787 | Freshwater | MTLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKQENG |
Ga0315900_107894513 | 3300031787 | Freshwater | MNLIELKAQAYDIIAEIEYLQNKLKETNAKIGEELQKENKENG |
Ga0315290_109166992 | 3300031834 | Sediment | MTLIELKAQAYDILAQIEYLQKQLQETNANIGEELQKEKNENG |
Ga0315909_100195007 | 3300031857 | Freshwater | MELMELKAKAYDILSNLEYLQNQLKEVNQLIAKKIQEDQSKEEKTD |
Ga0315909_101156043 | 3300031857 | Freshwater | MELIELKAQAYDILSNLEYLQKQLQEVNQKIAQKMQEEKSED |
Ga0315909_101429302 | 3300031857 | Freshwater | MTLVEMKAAAYDLLANLEYIQKQLQEVNQKIAEELQKEKKENG |
Ga0315909_103144352 | 3300031857 | Freshwater | MSITELKAKAYDLLANIEYLQKQLVEVNQQIAEQMKNEEATTDSAA |
Ga0315909_104354422 | 3300031857 | Freshwater | MELIELKAQAYDILSNLEYLQKQLQEINQKIAQKMQEEKSED |
Ga0315904_1000416039 | 3300031951 | Freshwater | MTLVEMKAAAYDLLANLEYIQKQLQEVNQKIAEELQKEKNENG |
Ga0315904_101381837 | 3300031951 | Freshwater | LNIMELIELKAQAYDILSNLEYLQKQLQEVNQKIAQKMQEEKSED |
Ga0315904_104946283 | 3300031951 | Freshwater | MTLLELKAQAYDILAQIEYLQKKLQETNQEISMKLQEESQTPPSAE |
Ga0315904_106811023 | 3300031951 | Freshwater | MELIELKAQAYDILSNLEYLQKQLQEVNQKIAQKMQEEK |
Ga0315294_105040193 | 3300031952 | Sediment | MTLIEMKAQAYDLLANLEHLQKQLQEINQKIAQKLQEDQAGE |
Ga0315294_109038392 | 3300031952 | Sediment | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEELQKQNNENG |
Ga0315274_111992573 | 3300031999 | Sediment | MKAQAYDLLANLEHLQKQLQEINQKIAQKLQEDQAGE |
Ga0315906_1000176650 | 3300032050 | Freshwater | NTMTLVEMKAAAYDLLANLEYIQKQLQEVNQKIAEELQKEKNENG |
Ga0315905_103733125 | 3300032092 | Freshwater | YLKLNTMNLTELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0315902_105376894 | 3300032093 | Freshwater | AQAYDILAQIEYLQKQLQETNAKIGEELQKDNKENG |
Ga0315902_113412682 | 3300032093 | Freshwater | MNLTELKAQAYDILAQIEYLQKQLQDTNAKIGEELQK |
Ga0315903_100452961 | 3300032116 | Freshwater | MNLVELKAEAYDILAQIEFLQKKLQETNQAIAAELQKANDE |
Ga0315295_111773033 | 3300032156 | Sediment | MTLIELKASAYDILAQIEYLQKQLQETNAKISEELQKEKNENG |
Ga0315276_107414992 | 3300032177 | Sediment | MTLIELKASAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0315273_111758343 | 3300032516 | Sediment | IELKAQAYDILAQIEYLQKQLQETNAKIGEELQKEKNENG |
Ga0316625_1020484941 | 3300033418 | Soil | MDLISLKATAYDILAQIEFLQKKLQETNQAIAEAMEKEKSENS |
Ga0334980_0065065_1200_1331 | 3300033816 | Freshwater | MTLVELKAQAYDILAQIEYLQKQLQEVNQKIAEELQKEKNENG |
Ga0334989_0571142_439_546 | 3300033984 | Freshwater | AAYDILSNLEYLQKQLQEVNQKIAEELQKEKNENG |
Ga0334994_0225481_749_880 | 3300033993 | Freshwater | MNLTELKAQAYDILAQIEFLQKKLQETNQAIGEELKKDEVPAN |
Ga0335003_0395842_220_351 | 3300033995 | Freshwater | MNLTELKAQAYDILAQIEFLQKKLQETNQAIGEEMKKGEESAD |
Ga0334979_0521345_248_379 | 3300033996 | Freshwater | MNLTELKAQAYDILAQIEYLQKKLQETNQAIGEELKKDEVPAN |
Ga0335023_0001322_3232_3360 | 3300034050 | Freshwater | MTLIELKAQAYDILAQIEFLQKKLQETNQLIGEKINEEKVDG |
Ga0335023_0065798_1743_1874 | 3300034050 | Freshwater | MNLTELKAQAYDILAQIEFLQRKLQETNQQIGEASKEQEDSNK |
Ga0334983_0320486_588_719 | 3300034060 | Freshwater | MNLTALKAQAYDILAQIEYLQKKLQETNQQIGEELKKDEVSAD |
Ga0334987_0151322_1591_1698 | 3300034061 | Freshwater | MTLIELKAAAYDLLANLEHLQKQLQEVNQKIAEELQ |
Ga0334987_0162566_1496_1618 | 3300034061 | Freshwater | TELKAQAYDILAQIEYLQKQLQETNAKIGEEIQKQNNENG |
Ga0335000_0006296_1614_1754 | 3300034063 | Freshwater | MDTITSLKATAYDLLANLEYIQKQLQEVNQKIAEEMQKNDKADSSN |
Ga0335001_0239241_85_225 | 3300034064 | Freshwater | MDTITSLKAKAYDLLANLEYIQKQLQEVNQQIAEEMQKNDKADISN |
Ga0335020_0007201_5093_5224 | 3300034082 | Freshwater | MNLTELKAQAYDILAQIEFLQRKLQETNQQIGEASKEEEDSNK |
Ga0335029_0670325_39_170 | 3300034102 | Freshwater | MNLIELKAQAYDILANLEYNQKQLQELNQKIAEEIEKLKQENG |
Ga0335031_0002757_491_622 | 3300034104 | Freshwater | MTLIELKAAAYDLLAQIEHLQKQLQETNAKIGEELKKQNNENG |
Ga0335037_0546777_415_543 | 3300034107 | Freshwater | MTLIELKSSAYDILAQIEYLQKKLQETNQLIGEKINEEKVDG |
Ga0335065_0083511_610_741 | 3300034200 | Freshwater | MTLTELKAAAYDLLANLEHLQKQLQEVNQKIAEELQKEKQENG |
Ga0335007_0407661_314_445 | 3300034283 | Freshwater | MTLIELKAQAYDILAQIEYLQKQLQETNAKIGEEIQKQNNENG |
Ga0335064_0401283_1_126 | 3300034357 | Freshwater | MTLTELKAQAYDILAQIEYLQKKLQETNQAIGEKIKEEQENK |
Ga0335064_0548819_236_376 | 3300034357 | Freshwater | MTLTELKAQAYDILAQIEYLQKKLQETNQAIGEKIKEEQENKDVDG |
⦗Top⦘ |