Metagenome / Metatranscriptome Family F010766

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F010766
Family Type	Metagenome / Metatranscriptome
Number of Sequences	299
Average Sequence Length	36 residues
Representative Sequence	MRIKIIKFVVKALGYEWGGDNLNAPVWTVKAKKKK
Number of Associated Samples	150
Number of Associated Scaffolds	299

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	91.30 %
% of genes near scaffold ends (potentially truncated)	7.02 %
% of genes from short scaffolds (< 2000 bps)	50.84 %
Associated GOLD sequencing projects	140
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (36.789 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (17.726 % of family members)
Environment Ontology (ENVO)	Unclassified (50.836 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (59.866 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 19.05% β-sheet: 9.52% Coil/Unstructured: 71.43%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 299 Family Scaffolds
PF09834	DUF2061	28.09
PF09723	Zn-ribbon_8	13.04
PF05257	CHAP	8.36
PF13640	2OG-FeII_Oxy_3	6.69
PF00565	SNase	4.68
PF16861	Carbam_trans_C	3.34
PF01583	APS_kinase	3.34
PF03567	Sulfotransfer_2	2.68
PF02467	Whib	2.68
PF13692	Glyco_trans_1_4	2.01
PF00011	HSP20	1.67
PF00037	Fer4	1.67
PF01471	PG_binding_1	1.34
PF07235	DUF1427	1.00
PF00082	Peptidase_S8	1.00
PF00085	Thioredoxin	1.00
PF05118	Asp_Arg_Hydrox	1.00
PF08007	JmjC_2	0.67
PF04820	Trp_halogenase	0.67
PF04860	Phage_portal	0.67
PF06414	Zeta_toxin	0.67
PF00590	TP_methylase	0.67
PF11753	DUF3310	0.67
PF00089	Trypsin	0.67
PF12849	PBP_like_2	0.33
PF07510	DUF1524	0.33
PF00685	Sulfotransfer_1	0.33
PF02543	Carbam_trans_N	0.33
PF00141	peroxidase	0.33
PF11397	GlcNAc	0.33
PF11735	CAP59_mtransfer	0.33
PF00255	GSHPx	0.33
PF04577	Glyco_transf_61	0.33
PF03793	PASTA	0.33
PF14579	HHH_6	0.33
PF06067	DUF932	0.33
PF01551	Peptidase_M23	0.33
PF00296	Bac_luciferase	0.33

COG ID	Name	Functional Category	% Frequency in 299 Family Scaffolds
COG0529	Adenylylsulfate kinase or related kinase	Inorganic ion transport and metabolism [P]	3.34
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	1.67
COG3555	Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily	Posttranslational modification, protein turnover, chaperones [O]	1.00
COG4317	Xanthosine utilization system component, XapX domain	Nucleotide transport and metabolism [F]	1.00
COG2850	Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain	Translation, ribosomal structure and biogenesis [J]	0.67
COG0376	Catalase (peroxidase I)	Inorganic ion transport and metabolism [P]	0.33
COG0386	Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides	Defense mechanisms [V]	0.33
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.33
COG2192	Predicted carbamoyl transferase, NodU family	General function prediction only [R]	0.33

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.21 %
Unclassified	root	N/A	36.79 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	47.16 %
Unclassified	root	N/A	36.79 %
cellular organisms	root	All Organisms → cellular organisms	16.05 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.79 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	28.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.39 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	16.05 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.79 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	28.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.39 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	5.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.79 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	28.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.39 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	3.01 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.79 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	28.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.39 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	3.01 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.79 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	27.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.39 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	3.01 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.33 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.79 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	27.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.39 %
Aphanizomenonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae	3.01 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	0.33 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.79 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	27.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.39 %
Aphanizomenon	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon	3.01 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	0.33 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.79 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	27.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.39 %
Aphanizomenon flos-aquae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae	3.01 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	0.33 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.79 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	27.76 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	18.39 %
Aphanizomenon flos-aquae WA102	isolate	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	3.01 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	0.33 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	0.33 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001282\|B570J14230_10020130	All Organisms → cellular organisms → Bacteria	2447	Open in IMG/M
3300001968\|GOS2236_1044813	All Organisms → cellular organisms → Bacteria	1710	Open in IMG/M
3300002408\|B570J29032_109316470	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	687	Open in IMG/M
3300002408\|B570J29032_109645719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	985	Open in IMG/M
3300002408\|B570J29032_109882733	All Organisms → Viruses → Predicted Viral	1946	Open in IMG/M
3300002408\|B570J29032_109935513	All Organisms → cellular organisms → Bacteria	3320	Open in IMG/M
3300002408\|B570J29032_109950423	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5125	Open in IMG/M
3300005517\|Ga0070374_10001536	Not Available	10014	Open in IMG/M
3300005517\|Ga0070374_10007632	Not Available	5168	Open in IMG/M
3300005517\|Ga0070374_10017123	All Organisms → Viruses → Predicted Viral	3650	Open in IMG/M
3300005517\|Ga0070374_10030874	All Organisms → Viruses → Predicted Viral	2764	Open in IMG/M
3300005517\|Ga0070374_10091746	All Organisms → Viruses → Predicted Viral	1582	Open in IMG/M
3300005517\|Ga0070374_10104208	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1479	Open in IMG/M
3300005517\|Ga0070374_10149615	All Organisms → Viruses → Predicted Viral	1211	Open in IMG/M
3300005517\|Ga0070374_10155127	All Organisms → cellular organisms → Bacteria	1188	Open in IMG/M
3300005517\|Ga0070374_10164156	All Organisms → Viruses → Predicted Viral	1150	Open in IMG/M
3300005517\|Ga0070374_10185231	All Organisms → cellular organisms → Bacteria	1074	Open in IMG/M
3300005517\|Ga0070374_10213663	All Organisms → cellular organisms → Bacteria	991	Open in IMG/M
3300005517\|Ga0070374_10379893	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	711	Open in IMG/M
3300005517\|Ga0070374_10546105	Not Available	577	Open in IMG/M
3300005517\|Ga0070374_10566562	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300005527\|Ga0068876_10008067	Not Available	7080	Open in IMG/M
3300005527\|Ga0068876_10020612	Not Available	4173	Open in IMG/M
3300005527\|Ga0068876_10096735	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1764	Open in IMG/M
3300005527\|Ga0068876_10168036	All Organisms → cellular organisms → Bacteria	1283	Open in IMG/M
3300005527\|Ga0068876_10368499	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	805	Open in IMG/M
3300005527\|Ga0068876_10492505	All Organisms → cellular organisms → Bacteria	674	Open in IMG/M
3300005528\|Ga0068872_10003548	Not Available	11884	Open in IMG/M
3300005583\|Ga0049085_10001416	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9533	Open in IMG/M
3300005583\|Ga0049085_10003114	Not Available	6623	Open in IMG/M
3300005583\|Ga0049085_10195956	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	672	Open in IMG/M
3300005584\|Ga0049082_10000129	Not Available	17982	Open in IMG/M
3300005662\|Ga0078894_10002237	Not Available	14603	Open in IMG/M
3300005662\|Ga0078894_10005605	Not Available	9683	Open in IMG/M
3300005662\|Ga0078894_10038767	All Organisms → Viruses → Predicted Viral	3977	Open in IMG/M
3300005662\|Ga0078894_10056371	All Organisms → Viruses → Predicted Viral	3347	Open in IMG/M
3300005662\|Ga0078894_10071340	All Organisms → Viruses → Predicted Viral	3001	Open in IMG/M
3300005662\|Ga0078894_10108347	All Organisms → Viruses → Predicted Viral	2460	Open in IMG/M
3300005662\|Ga0078894_10128451	All Organisms → Viruses → Predicted Viral	2261	Open in IMG/M
3300005662\|Ga0078894_10142654	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2146	Open in IMG/M
3300005662\|Ga0078894_10343917	All Organisms → Viruses → Predicted Viral	1351	Open in IMG/M
3300005662\|Ga0078894_10604851	All Organisms → cellular organisms → Bacteria	976	Open in IMG/M
3300005662\|Ga0078894_10701714	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	893	Open in IMG/M
3300005662\|Ga0078894_10979830	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	729	Open in IMG/M
3300005662\|Ga0078894_11466622	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	567	Open in IMG/M
3300005805\|Ga0079957_1003278	All Organisms → cellular organisms → Bacteria	13824	Open in IMG/M
3300005805\|Ga0079957_1005727	Not Available	10061	Open in IMG/M
3300005805\|Ga0079957_1008547	All Organisms → cellular organisms → Bacteria	7916	Open in IMG/M
3300005805\|Ga0079957_1009148	Not Available	7608	Open in IMG/M
3300005941\|Ga0070743_10003858	Not Available	5482	Open in IMG/M
3300005941\|Ga0070743_10014640	All Organisms → Viruses → Predicted Viral	2749	Open in IMG/M
3300005941\|Ga0070743_10111198	All Organisms → cellular organisms → Bacteria	919	Open in IMG/M
3300005941\|Ga0070743_10136694	All Organisms → cellular organisms → Bacteria	816	Open in IMG/M
3300006030\|Ga0075470_10000171	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	22842	Open in IMG/M
3300006030\|Ga0075470_10189705	All Organisms → cellular organisms → Bacteria	591	Open in IMG/M
3300006484\|Ga0070744_10003277	All Organisms → Viruses → Predicted Viral	4870	Open in IMG/M
3300006484\|Ga0070744_10006070	All Organisms → Viruses → Predicted Viral	3627	Open in IMG/M
3300006484\|Ga0070744_10007278	All Organisms → Viruses → Predicted Viral	3316	Open in IMG/M
3300006484\|Ga0070744_10030260	All Organisms → Viruses → Predicted Viral	1602	Open in IMG/M
3300006639\|Ga0079301_1003923	All Organisms → cellular organisms → Bacteria	6255	Open in IMG/M
3300006639\|Ga0079301_1014136	All Organisms → Viruses → Predicted Viral	2894	Open in IMG/M
3300006639\|Ga0079301_1052758	All Organisms → Viruses → Predicted Viral	1314	Open in IMG/M
3300007169\|Ga0102976_1139121	All Organisms → cellular organisms → Bacteria	1388	Open in IMG/M
3300007169\|Ga0102976_1157675	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1335	Open in IMG/M
3300007171\|Ga0102977_1019794	All Organisms → cellular organisms → Bacteria	2848	Open in IMG/M
3300007171\|Ga0102977_1213587	Not Available	2531	Open in IMG/M
3300007516\|Ga0105050_10024553	Not Available	5217	Open in IMG/M
3300007541\|Ga0099848_1262359	Not Available	601	Open in IMG/M
3300007545\|Ga0102873_1192785	Not Available	612	Open in IMG/M
3300007547\|Ga0102875_1136513	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	774	Open in IMG/M
3300007557\|Ga0102821_1097380	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	750	Open in IMG/M
3300007559\|Ga0102828_1123433	Not Available	639	Open in IMG/M
3300007590\|Ga0102917_1072184	Not Available	1216	Open in IMG/M
3300007590\|Ga0102917_1286682	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	569	Open in IMG/M
3300007620\|Ga0102871_1225926	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	519	Open in IMG/M
3300007622\|Ga0102863_1158113	Not Available	667	Open in IMG/M
3300007622\|Ga0102863_1265978	Not Available	500	Open in IMG/M
3300007630\|Ga0102903_1205050	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	535	Open in IMG/M
3300007639\|Ga0102865_1026807	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	1668	Open in IMG/M
3300007644\|Ga0102902_1227861	Not Available	548	Open in IMG/M
3300008055\|Ga0108970_10369099	All Organisms → Viruses → Predicted Viral	2941	Open in IMG/M
3300008055\|Ga0108970_11281586	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1159	Open in IMG/M
3300008107\|Ga0114340_1000599	Not Available	62989	Open in IMG/M
3300008110\|Ga0114343_1039656	All Organisms → Viruses → Predicted Viral	1894	Open in IMG/M
3300008113\|Ga0114346_1014115	All Organisms → Viruses → Predicted Viral	4445	Open in IMG/M
3300008113\|Ga0114346_1035294	Not Available	2595	Open in IMG/M
3300008113\|Ga0114346_1036407	All Organisms → Viruses → Predicted Viral	2545	Open in IMG/M
3300008114\|Ga0114347_1008779	All Organisms → cellular organisms → Bacteria	5223	Open in IMG/M
3300008114\|Ga0114347_1098071	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2571	Open in IMG/M
3300008116\|Ga0114350_1000425	Not Available	29998	Open in IMG/M
3300008116\|Ga0114350_1001400	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	18709	Open in IMG/M
3300008116\|Ga0114350_1004137	Not Available	7424	Open in IMG/M
3300008116\|Ga0114350_1023734	All Organisms → cellular organisms → Bacteria	3335	Open in IMG/M
3300008119\|Ga0114354_1279187	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	517	Open in IMG/M
3300008120\|Ga0114355_1005973	Not Available	13389	Open in IMG/M
3300008258\|Ga0114840_1055191	Not Available	621	Open in IMG/M
3300008261\|Ga0114336_1002460	Not Available	23190	Open in IMG/M
3300008264\|Ga0114353_1397465	Not Available	512	Open in IMG/M
3300008962\|Ga0104242_1088258	Not Available	514	Open in IMG/M
3300008996\|Ga0102831_1011684	All Organisms → cellular organisms → Bacteria	3085	Open in IMG/M
3300008996\|Ga0102831_1124921	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	855	Open in IMG/M
3300008996\|Ga0102831_1330503	Not Available	504	Open in IMG/M
3300009059\|Ga0102830_1257825	Not Available	509	Open in IMG/M
3300009068\|Ga0114973_10000393	Not Available	32776	Open in IMG/M
3300009068\|Ga0114973_10000603	Not Available	27189	Open in IMG/M
3300009080\|Ga0102815_10249945	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	978	Open in IMG/M
3300009152\|Ga0114980_10000356	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	33039	Open in IMG/M
3300009152\|Ga0114980_10002895	Not Available	11929	Open in IMG/M
3300009152\|Ga0114980_10011208	Not Available	5746	Open in IMG/M
3300009152\|Ga0114980_10262130	All Organisms → Viruses → Predicted Viral	1007	Open in IMG/M
3300009158\|Ga0114977_10227976	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1082	Open in IMG/M
3300009158\|Ga0114977_10338459	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	850	Open in IMG/M
3300009159\|Ga0114978_10000521	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	32711	Open in IMG/M
3300009160\|Ga0114981_10000560	Not Available	24013	Open in IMG/M
3300009184\|Ga0114976_10002003	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	12808	Open in IMG/M
3300009419\|Ga0114982_1000472	Not Available	21651	Open in IMG/M
3300009419\|Ga0114982_1050647	All Organisms → Viruses → Predicted Viral	1312	Open in IMG/M
3300009466\|Ga0126448_1001213	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7490	Open in IMG/M
3300009466\|Ga0126448_1027543	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1347	Open in IMG/M
3300010354\|Ga0129333_10003752	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14251	Open in IMG/M
3300010354\|Ga0129333_10004601	Not Available	12925	Open in IMG/M
3300010354\|Ga0129333_10008623	Not Available	9641	Open in IMG/M
3300010354\|Ga0129333_10014181	Not Available	7574	Open in IMG/M
3300010354\|Ga0129333_10042849	Not Available	4255	Open in IMG/M
3300010354\|Ga0129333_10047855	Not Available	4015	Open in IMG/M
3300010354\|Ga0129333_10142067	Not Available	2205	Open in IMG/M
3300010354\|Ga0129333_10169685	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1996	Open in IMG/M
3300010354\|Ga0129333_10240960	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1633	Open in IMG/M
3300010354\|Ga0129333_10273368	Not Available	1517	Open in IMG/M
3300010354\|Ga0129333_10394102	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1226	Open in IMG/M
3300010354\|Ga0129333_10760581	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	829	Open in IMG/M
3300010370\|Ga0129336_10001652	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13577	Open in IMG/M
3300010370\|Ga0129336_10053730	All Organisms → Viruses → Predicted Viral	2404	Open in IMG/M
3300010370\|Ga0129336_10219792	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1075	Open in IMG/M
3300010885\|Ga0133913_10069977	Not Available	9416	Open in IMG/M
3300011268\|Ga0151620_1008332	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3748	Open in IMG/M
3300012286\|Ga0157137_102880	All Organisms → cellular organisms → Bacteria	1286	Open in IMG/M
3300012352\|Ga0157138_1016475	All Organisms → Viruses → Predicted Viral	1193	Open in IMG/M
3300012352\|Ga0157138_1071667	Not Available	543	Open in IMG/M
3300012663\|Ga0157203_1047923	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	580	Open in IMG/M
3300012665\|Ga0157210_1025216	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	946	Open in IMG/M
3300012968\|Ga0129337_1021667	Not Available	2849	Open in IMG/M
3300012970\|Ga0129338_1300244	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	781	Open in IMG/M
3300012970\|Ga0129338_1351823	Not Available	2641	Open in IMG/M
3300013004\|Ga0164293_10000329	Not Available	36218	Open in IMG/M
3300013004\|Ga0164293_10016363	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	6222	Open in IMG/M
3300013004\|Ga0164293_10085919	All Organisms → Viruses → Predicted Viral	2444	Open in IMG/M
3300013005\|Ga0164292_10931831	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	544	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10017256	Not Available	7064	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10207852	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1225	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10475797	Not Available	691	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10475798	Not Available	691	Open in IMG/M
(restricted) 3300013131\|Ga0172373_10032512	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4974	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10124547	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	2103	Open in IMG/M
3300013372\|Ga0177922_10018881	All Organisms → Viruses → Predicted Viral	2329	Open in IMG/M
3300014819\|Ga0119954_1000433	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14897	Open in IMG/M
3300017788\|Ga0169931_10062336	All Organisms → cellular organisms → Bacteria	3868	Open in IMG/M
3300017788\|Ga0169931_10101500	All Organisms → Viruses → Predicted Viral	2760	Open in IMG/M
3300017788\|Ga0169931_10229944	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1540	Open in IMG/M
3300017788\|Ga0169931_10490395	Not Available	871	Open in IMG/M
3300019146\|Ga0188881_10027771	Not Available	703	Open in IMG/M
3300019784\|Ga0181359_1000964	Not Available	7199	Open in IMG/M
3300019784\|Ga0181359_1043100	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1748	Open in IMG/M
3300019784\|Ga0181359_1181348	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	695	Open in IMG/M
3300020048\|Ga0207193_1032435	Not Available	5982	Open in IMG/M
3300020048\|Ga0207193_1034661	Not Available	5701	Open in IMG/M
3300020074\|Ga0194113_10200337	All Organisms → cellular organisms → Bacteria	1599	Open in IMG/M
3300020074\|Ga0194113_10375179	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1052	Open in IMG/M
3300020141\|Ga0211732_1053829	Not Available	12828	Open in IMG/M
3300020141\|Ga0211732_1172916	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	800	Open in IMG/M
3300020141\|Ga0211732_1287381	All Organisms → Viruses → Predicted Viral	2699	Open in IMG/M
3300020141\|Ga0211732_1525698	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	3561	Open in IMG/M
3300020151\|Ga0211736_10053289	All Organisms → Viruses → Predicted Viral	2227	Open in IMG/M
3300020151\|Ga0211736_10084738	Not Available	5183	Open in IMG/M
3300020151\|Ga0211736_10321492	All Organisms → cellular organisms → Bacteria	2262	Open in IMG/M
3300020151\|Ga0211736_10707038	Not Available	5530	Open in IMG/M
3300020151\|Ga0211736_10962289	All Organisms → Viruses → Predicted Viral	1010	Open in IMG/M
3300020151\|Ga0211736_10995054	Not Available	865	Open in IMG/M
3300020159\|Ga0211734_10033996	All Organisms → Viruses → Predicted Viral	4579	Open in IMG/M
3300020159\|Ga0211734_10233620	Not Available	8724	Open in IMG/M
3300020159\|Ga0211734_10756461	All Organisms → cellular organisms → Bacteria	3037	Open in IMG/M
3300020160\|Ga0211733_11171679	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	521	Open in IMG/M
3300020161\|Ga0211726_10091671	Not Available	997	Open in IMG/M
3300020162\|Ga0211735_10976557	Not Available	690	Open in IMG/M
3300020204\|Ga0194116_10063445	All Organisms → cellular organisms → Bacteria	2529	Open in IMG/M
3300020205\|Ga0211731_10391535	Not Available	741	Open in IMG/M
3300020482\|Ga0208464_101981	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1531	Open in IMG/M
3300020494\|Ga0208326_101939	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	1849	Open in IMG/M
3300020498\|Ga0208050_1026350	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	587	Open in IMG/M
3300020505\|Ga0208088_1033200	Not Available	642	Open in IMG/M
3300020515\|Ga0208234_1006875	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1495	Open in IMG/M
3300020519\|Ga0208223_1001573	All Organisms → Viruses → Predicted Viral	4907	Open in IMG/M
3300020527\|Ga0208232_1004079	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2475	Open in IMG/M
3300020527\|Ga0208232_1010213	All Organisms → Viruses → Predicted Viral	1456	Open in IMG/M
3300020529\|Ga0208233_1004395	All Organisms → Viruses → Predicted Viral	2333	Open in IMG/M
3300020529\|Ga0208233_1029195	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	687	Open in IMG/M
3300020529\|Ga0208233_1044175	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	532	Open in IMG/M
3300020531\|Ga0208487_1033163	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	598	Open in IMG/M
3300020549\|Ga0207942_1005258	All Organisms → Viruses → Predicted Viral	1877	Open in IMG/M
3300020558\|Ga0208362_1000001	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	111438	Open in IMG/M
3300020558\|Ga0208362_1029504	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	954	Open in IMG/M
3300020572\|Ga0207909_1010560	All Organisms → Viruses → Predicted Viral	1851	Open in IMG/M
3300020572\|Ga0207909_1013427	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1582	Open in IMG/M
3300021519\|Ga0194048_10000570	Not Available	17976	Open in IMG/M
3300021961\|Ga0222714_10043574	All Organisms → Viruses → Predicted Viral	3184	Open in IMG/M
3300021961\|Ga0222714_10152316	All Organisms → Viruses → Predicted Viral	1386	Open in IMG/M
3300021962\|Ga0222713_10021176	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5457	Open in IMG/M
3300021962\|Ga0222713_10633835	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	619	Open in IMG/M
3300021963\|Ga0222712_10072479	All Organisms → Viruses → Predicted Viral	2485	Open in IMG/M
3300021963\|Ga0222712_10131597	Not Available	1711	Open in IMG/M
3300021963\|Ga0222712_10519509	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	701	Open in IMG/M
3300021963\|Ga0222712_10648464	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	603	Open in IMG/M
3300023174\|Ga0214921_10000213	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	115201	Open in IMG/M
3300023174\|Ga0214921_10000295	Not Available	98310	Open in IMG/M
3300023174\|Ga0214921_10003731	Not Available	23031	Open in IMG/M
3300023174\|Ga0214921_10091300	Not Available	2340	Open in IMG/M
3300024239\|Ga0247724_1000036	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	43459	Open in IMG/M
3300024289\|Ga0255147_1000246	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	19325	Open in IMG/M
3300024289\|Ga0255147_1030318	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1099	Open in IMG/M
3300024306\|Ga0255148_1039123	Not Available	861	Open in IMG/M
3300024343\|Ga0244777_10636719	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	643	Open in IMG/M
3300024346\|Ga0244775_10001832	Not Available	23992	Open in IMG/M
3300024346\|Ga0244775_10001839	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	23899	Open in IMG/M
3300024346\|Ga0244775_10003054	Not Available	17961	Open in IMG/M
3300024346\|Ga0244775_10022094	Not Available	5773	Open in IMG/M
3300024346\|Ga0244775_10027086	Not Available	5128	Open in IMG/M
3300024346\|Ga0244775_10158941	All Organisms → Viruses → Predicted Viral	1905	Open in IMG/M
3300024346\|Ga0244775_10200095	All Organisms → cellular organisms → Bacteria	1676	Open in IMG/M
3300024346\|Ga0244775_10296403	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	1341	Open in IMG/M
3300024346\|Ga0244775_10419608	All Organisms → cellular organisms → Bacteria	1099	Open in IMG/M
3300024346\|Ga0244775_10576012	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	915	Open in IMG/M
3300024346\|Ga0244775_11378229	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	543	Open in IMG/M
3300024352\|Ga0255142_1051147	Not Available	636	Open in IMG/M
3300024572\|Ga0255268_1146740	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	585	Open in IMG/M
3300025445\|Ga0208424_1017355	All Organisms → cellular organisms → Bacteria	833	Open in IMG/M
3300025585\|Ga0208546_1000026	Not Available	80003	Open in IMG/M
3300025585\|Ga0208546_1143158	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	512	Open in IMG/M
3300026455\|Ga0255155_1066431	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	596	Open in IMG/M
3300027114\|Ga0208009_1001557	Not Available	6480	Open in IMG/M
3300027136\|Ga0255107_1019698	All Organisms → Viruses → Predicted Viral	1217	Open in IMG/M
3300027144\|Ga0255102_1037396	All Organisms → cellular organisms → Bacteria	805	Open in IMG/M
3300027418\|Ga0208022_1033500	All Organisms → Viruses → Predicted Viral	1171	Open in IMG/M
3300027499\|Ga0208788_1035876	All Organisms → Viruses → Predicted Viral	1419	Open in IMG/M
3300027563\|Ga0209552_1000273	Not Available	16393	Open in IMG/M
3300027563\|Ga0209552_1063565	All Organisms → Viruses → Predicted Viral	1028	Open in IMG/M
3300027586\|Ga0208966_1000125	Not Available	24393	Open in IMG/M
3300027631\|Ga0208133_1026127	All Organisms → Viruses → Predicted Viral	1480	Open in IMG/M
3300027656\|Ga0209357_1069920	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1049	Open in IMG/M
3300027689\|Ga0209551_1000504	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	14749	Open in IMG/M
3300027689\|Ga0209551_1027772	All Organisms → Viruses → Predicted Viral	1906	Open in IMG/M
3300027689\|Ga0209551_1257703	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	522	Open in IMG/M
(restricted) 3300027728\|Ga0247836_1011341	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	8106	Open in IMG/M
3300027734\|Ga0209087_1000525	Not Available	24087	Open in IMG/M
3300027760\|Ga0209598_10030888	All Organisms → Viruses → Predicted Viral	2963	Open in IMG/M
3300027769\|Ga0209770_10001068	Not Available	14408	Open in IMG/M
3300027769\|Ga0209770_10006770	Not Available	5369	Open in IMG/M
3300027769\|Ga0209770_10227267	Not Available	729	Open in IMG/M
3300027782\|Ga0209500_10438101	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	517	Open in IMG/M
3300027793\|Ga0209972_10002646	Not Available	14523	Open in IMG/M
3300027797\|Ga0209107_10294110	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	766	Open in IMG/M
3300027804\|Ga0209358_10224537	Not Available	959	Open in IMG/M
3300027805\|Ga0209229_10087249	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1403	Open in IMG/M
3300027836\|Ga0209230_10128902	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1429	Open in IMG/M
3300027836\|Ga0209230_10185381	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1194	Open in IMG/M
3300027892\|Ga0209550_10232570	All Organisms → Viruses → Predicted Viral	1231	Open in IMG/M
3300027892\|Ga0209550_10402051	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	848	Open in IMG/M
3300027892\|Ga0209550_10406488	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	841	Open in IMG/M
3300027892\|Ga0209550_10425570	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	815	Open in IMG/M
3300027973\|Ga0209298_10000218	Not Available	36992	Open in IMG/M
3300028025\|Ga0247723_1000055	Not Available	64365	Open in IMG/M
3300028025\|Ga0247723_1001832	Not Available	11984	Open in IMG/M
3300029930\|Ga0119944_1034425	Not Available	643	Open in IMG/M
3300031758\|Ga0315907_10001579	Not Available	30603	Open in IMG/M
3300031758\|Ga0315907_10090572	All Organisms → Viruses → Predicted Viral	2630	Open in IMG/M
3300031758\|Ga0315907_10154338	Not Available	1943	Open in IMG/M
3300031857\|Ga0315909_10025117	Not Available	5899	Open in IMG/M
3300031951\|Ga0315904_10003074	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	25038	Open in IMG/M
3300031951\|Ga0315904_10013179	Not Available	10378	Open in IMG/M
3300031951\|Ga0315904_10014480	Not Available	9816	Open in IMG/M
3300031951\|Ga0315904_10601424	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	946	Open in IMG/M
3300031951\|Ga0315904_11243404	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	568	Open in IMG/M
3300032092\|Ga0315905_10005602	Not Available	12791	Open in IMG/M
3300032116\|Ga0315903_10825044	Not Available	674	Open in IMG/M
3300033816\|Ga0334980_0000095	Not Available	41955	Open in IMG/M
3300033996\|Ga0334979_0000654	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	26125	Open in IMG/M
3300034013\|Ga0334991_0425139	Not Available	505	Open in IMG/M
3300034018\|Ga0334985_0768636	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	512	Open in IMG/M
3300034022\|Ga0335005_0139568	All Organisms → Viruses → Predicted Viral	1548	Open in IMG/M
3300034066\|Ga0335019_0000027	Not Available	86364	Open in IMG/M
3300034066\|Ga0335019_0001030	Not Available	17874	Open in IMG/M
3300034066\|Ga0335019_0062540	All Organisms → Viruses → Predicted Viral	2532	Open in IMG/M
3300034071\|Ga0335028_0070094	Not Available	2340	Open in IMG/M
3300034072\|Ga0310127_019398	All Organisms → Viruses → Predicted Viral	4237	Open in IMG/M
3300034073\|Ga0310130_0000204	Not Available	49659	Open in IMG/M
3300034073\|Ga0310130_0003909	Not Available	6226	Open in IMG/M
3300034096\|Ga0335025_0002251	Not Available	15041	Open in IMG/M
3300034101\|Ga0335027_0613770	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	660	Open in IMG/M
3300034106\|Ga0335036_0316488	Not Available	1031	Open in IMG/M
3300034200\|Ga0335065_0788095	Not Available	534	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.33%
Host-Associated	Host-Associated	0.67%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	94.98%
Terrestrial	Environmental → Terrestrial	4.35%
Plants	Host-Associated → Plants	0.67%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	70.23%
Marine	Environmental → Aquatic → Marine	24.08%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	4.35%
Unclassified	Environmental → Aquatic → Unclassified	0.67%
Leaf	Host-Associated → Plants → Leaf	0.67%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	32.11%
Lentic	Environmental → Aquatic → Freshwater → Lentic	29.10%
Unclassified	Environmental → Aquatic → Marine → Unclassified	9.36%
Coastal	Environmental → Aquatic → Marine → Coastal	8.03%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	6.69%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	4.35%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	3.68%
River	Environmental → Aquatic → Freshwater → River	2.68%
Lotic	Environmental → Aquatic → Freshwater → Lotic	2.01%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.67%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.67%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.33%
Ice	Environmental → Aquatic → Freshwater → Ice	0.33%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	31.44%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	23.08%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	9.36%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	8.03%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	6.35%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	5.69%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	4.35%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	3.68%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	2.68%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	2.01%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.67%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.67%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.67%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.33%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	0.33%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	0.33%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.33%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	17.73%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	10.70%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	6.35%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	6.69%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	6.69%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	5.69%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	5.35%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	5.35%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	5.02%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	3.68%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	3.01%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	2.68%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	2.68%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	2.34%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	2.01%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	1.67%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.67%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	1.67%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.34%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	1.00%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	1.00%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	1.00%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.67%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.67%
Meromictic Pond	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond	0.67%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.67%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	0.33%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.33%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.33%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	0.33%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	0.33%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.33%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300001968	Marine microbial communities from Lake Gatun, Panama - GS020	Environmental	Open in IMG/M
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300005941	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697	Environmental	Open in IMG/M
3300006030	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300007169	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects	Environmental	Open in IMG/M
3300007171	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects	Environmental	Open in IMG/M
3300007516	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01	Environmental	Open in IMG/M
3300007541	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG	Environmental	Open in IMG/M
3300007545	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3	Environmental	Open in IMG/M
3300007547	Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02	Environmental	Open in IMG/M
3300007557	Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007590	Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02	Environmental	Open in IMG/M
3300007620	Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02	Environmental	Open in IMG/M
3300007622	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02	Environmental	Open in IMG/M
3300007630	Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02	Environmental	Open in IMG/M
3300007639	Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02	Environmental	Open in IMG/M
3300007644	Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008119	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300008258	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008264	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR	Environmental	Open in IMG/M
3300008962	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300009059	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009080	Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300009466	Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011268	Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555	Environmental	Open in IMG/M
3300012286	Freshwater microbial communities from Ausable River, Ontario, Canada - S47	Environmental	Open in IMG/M
3300012352	Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300012968	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012970	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013131 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300014819	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A	Environmental	Open in IMG/M
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental	Open in IMG/M
3300019146	Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020074	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020160	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300020204	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020482	Freshwater microbial communities from Lake Mendota, WI - 13SEPL2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020494	Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020498	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020505	Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020515	Freshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020519	Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020527	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020529	Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020531	Freshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020549	Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020558	Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020572	Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024239	Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E	Environmental	Open in IMG/M
3300024289	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h	Environmental	Open in IMG/M
3300024306	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h	Environmental	Open in IMG/M
3300024343	Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024352	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h	Environmental	Open in IMG/M
3300024572	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025445	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025585	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300026455	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h	Environmental	Open in IMG/M
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental	Open in IMG/M
3300027136	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h	Environmental	Open in IMG/M
3300027144	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h	Environmental	Open in IMG/M
3300027418	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)	Environmental	Open in IMG/M
3300027499	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)	Environmental	Open in IMG/M
3300027563	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027586	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)	Environmental	Open in IMG/M
3300027631	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)	Environmental	Open in IMG/M
3300027656	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027689	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027728 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027760	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027804	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027836	Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)	Environmental	Open in IMG/M
3300027892	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027973	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300029930	Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300033996	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004	Environmental	Open in IMG/M
3300034013	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034	Environmental	Open in IMG/M
3300034018	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021	Environmental	Open in IMG/M
3300034022	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034071	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110	Environmental	Open in IMG/M
3300034072	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A	Environmental	Open in IMG/M
3300034073	Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL	Environmental	Open in IMG/M
3300034096	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098	Environmental	Open in IMG/M
3300034101	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034200	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J14230_100201302	3300001282	Freshwater	MRIKIIKFVVKALGYEWGGDQLKAPVWTVKAKKK*
GOS2236_10448131	3300001968	Marine	IMRIKIIKFVVKVLGYEWSGDELNLPVWQVKAKKKK*
B570J29032_1093164703	3300002408	Freshwater	MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKNKK*
B570J29032_1096457191	3300002408	Freshwater	MRIKIIRFVVKALGYEWSGDELKLPVWQVKAKQKKK*
B570J29032_1098827334	3300002408	Freshwater	MRIKIIKFVVKALGYEWGGDSLKAPIWTVKEKKKK*
B570J29032_1099355139	3300002408	Freshwater	MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKAKKKN*
B570J29032_1099504231	3300002408	Freshwater	MRIKIIKFVVKALGYQWSGDDLKLPVWYVKEKKKVK*
Ga0070374_100015369	3300005517	Freshwater Lake	MRIKIIKFVVKTLGYEWGGDKLNLPYWTVKAKKK*
Ga0070374_100076325	3300005517	Freshwater Lake	MRIKVIRFVVKVLGYEWGGDALNVPVWTVKAKKKK*
Ga0070374_100171235	3300005517	Freshwater Lake	MRIKIIRAMVKLLGYEWGGDNLNAPVWTVKAKKKK*
Ga0070374_100308746	3300005517	Freshwater Lake	MRIKIIKFVVKALGYEWGGDNLNVPVWTVKAKKKK*
Ga0070374_100917463	3300005517	Freshwater Lake	MRIKIIRFVVKALGYQWGGDALSAPVWTVKAKKKK*
Ga0070374_101042083	3300005517	Freshwater Lake	MRIKIIRAVVKLLGYEWGGDSLNAPVWTVKAKKKK*
Ga0070374_101496153	3300005517	Freshwater Lake	MRIKIIKFVVKALGYEWSGDELKLPIWYVKAKKKK*
Ga0070374_101551274	3300005517	Freshwater Lake	MRIKIIRAVVKLLGYEWGGDALNAPIWTVKAKKKK*
Ga0070374_101641564	3300005517	Freshwater Lake	MRIKFIRFVVKALGYDWGGDNLNAPVWTVKAKKKK*
Ga0070374_101852311	3300005517	Freshwater Lake	QVMRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKSK*
Ga0070374_102136632	3300005517	Freshwater Lake	MRIKIIKIVVKLLGYEWGGDNLNAPIWTVKAKKKK*
Ga0070374_103798932	3300005517	Freshwater Lake	MRIKIIRFVVKALGYQWGGDALNAPIWTVKAKKKK*
Ga0070374_105461052	3300005517	Freshwater Lake	MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKAKKKN*
Ga0070374_105665622	3300005517	Freshwater Lake	MRIKIIRSVVKLLGYEWGGDSLNAPVWTVKAKKKK*
Ga0068876_100080676	3300005527	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKSKKKS*
Ga0068876_100206125	3300005527	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK*
Ga0068876_100967352	3300005527	Freshwater Lake	MRIKIIKFVVKALGYEWSGDELKLPVWQVKAKTKKK*
Ga0068876_101680364	3300005527	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKGK*
Ga0068876_103684994	3300005527	Freshwater Lake	MRIKIIKFIVKALGYEWSGDQLNLPVWQVKAKTKKK*
Ga0068876_104925053	3300005527	Freshwater Lake	MRIKIIKAVVKLLGYEWSGDELKLPVWYVKEKKRNR*
Ga0068872_100035486	3300005528	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKTKKK*
Ga0049085_1000141610	3300005583	Freshwater Lentic	MRINIIKFVVKTLGYEWSEHPLKLPVWTIKKKKASSIFDQ*
Ga0049085_1000311413	3300005583	Freshwater Lentic	MRIKIIRFVVKALGYEWGGDALNVPIWTVKAKKKK*
Ga0049085_101959562	3300005583	Freshwater Lentic	MRIKIIRFVVKALGYEWGGDLLNVPIWTVKAKKKK*
Ga0049082_1000012911	3300005584	Freshwater Lentic	MRIKIIRFVVKALGYEWGGDNLNLPYWTVKAKKKK*
Ga0078894_1000223730	3300005662	Freshwater Lake	MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKKK*
Ga0078894_100056056	3300005662	Freshwater Lake	MRIKIIKAVVKLLGYEWSGDELKLPVWYVKEKKKK*
Ga0078894_100387673	3300005662	Freshwater Lake	MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKSK*
Ga0078894_100563712	3300005662	Freshwater Lake	MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKKKK*
Ga0078894_100713402	3300005662	Freshwater Lake	MRIKIIKFVVKALGYEWSGDELKLPVWYIKEKKKK*
Ga0078894_101083473	3300005662	Freshwater Lake	MRIKIIKFVVKALGYEWSGDELRLPVWYVKEKKKK*
Ga0078894_101284513	3300005662	Freshwater Lake	MRIKIIKFVVKALGYDWGGDSLKAPVWTVKAKKKK*
Ga0078894_101426544	3300005662	Freshwater Lake	MRIRIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKK*
Ga0078894_103439171	3300005662	Freshwater Lake	MRIKIIKFVVKALGYEWGGDNLNAPVWTVKAKKKK*
Ga0078894_106048513	3300005662	Freshwater Lake	MRIKIIKFVVKILGYEWGGDNLHAPLWTVKAKKKK*
Ga0078894_107017143	3300005662	Freshwater Lake	VRIKIIRAVVKILGYEWGGDSLKAPIWTVKEKKNKKQ*
Ga0078894_109798302	3300005662	Freshwater Lake	MRIKIIRFVVKALGYEWSGDELKLPVWYVKEKKTKK*
Ga0078894_114666223	3300005662	Freshwater Lake	MRIKIIKSVVKLLGYEWGGDSLKAPVWTVKAKKKK*
Ga0079957_10032785	3300005805	Lake	VAKEDQVMRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK*
Ga0079957_10057277	3300005805	Lake	MRIKIIKFVVKVLGYEWSGDELKLPVWQVKAKQKKK*
Ga0079957_100854710	3300005805	Lake	MRIKIIKAVVKLLGYEWSGDELKLPVWYVKEKKKSK*
Ga0079957_10091482	3300005805	Lake	MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKNKKQK*
Ga0070743_100038587	3300005941	Estuarine	MRINIIKFVVKALGYEWSGDELKLPVWYVKEKKKKK*
Ga0070743_100146402	3300005941	Estuarine	MRIKIIRFVVKALGYDWGGDSLNAPVWTVKAKKKK*
Ga0070743_101111984	3300005941	Estuarine	MRIKIIKFVVKALGYEWGGDSLNAPIWTVKAKKKK*
Ga0070743_101366942	3300005941	Estuarine	MRIKIIKTVVRLLGYEWGGDNLNAPIWTVKAKKKK*
Ga0075470_100001719	3300006030	Aqueous	MRIKIIKFVVKLLGYEWSGDNLNLPIWYVKAKKKK*
Ga0075470_101897053	3300006030	Aqueous	MRLKIIKFVVKALGYEWSGDNVKIPVWYVKEKKKK*
Ga0070744_100032779	3300006484	Estuarine	MRIKIIRFVVKALGYDWGGDNLNAPVWTVKAKKKK*
Ga0070744_100060704	3300006484	Estuarine	MEIGVEMRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK*
Ga0070744_100072784	3300006484	Estuarine	MRIKIIRFVVKALGYDWGGDALNVPVWTVKAKKKK*
Ga0070744_100302606	3300006484	Estuarine	MRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK*
Ga0079301_10039236	3300006639	Deep Subsurface	MRIRIIKTVVKLLGYEWSGDELKLPVWYVKEKKKK*
Ga0079301_10141364	3300006639	Deep Subsurface	MRIKIIKFVVKLLGYEWRGDKLNLPVWTVRAKKK*
Ga0079301_10527581	3300006639	Deep Subsurface	MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKEKKKSK*
Ga0102976_11391214	3300007169	Freshwater Lake	MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKIK*
Ga0102976_11576752	3300007169	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDQLNLPVWQVKAKQKKK*
Ga0102977_10197945	3300007171	Freshwater Lake	MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKTK*
Ga0102977_12135874	3300007171	Freshwater Lake	VRIKIIKFVVKILGYEWSGDNINLPVWQVKAKKKKNR*
Ga0105050_100245532	3300007516	Freshwater	MRIKIIRFVVKALGYEWSGDKLNLPVWYIKEKKK*
Ga0099848_12623593	3300007541	Aqueous	MRIKIIKLVVRLLGYEWSGDNVNLPVWQVKEKRKNKK*
Ga0102873_11927853	3300007545	Estuarine	MRIKIIRFVVKALGYEWGGDNLNAPVWTVKAKKKK*
Ga0102875_11365132	3300007547	Estuarine	MRIKIIKTVVRLLGYEWGGDNLNAPVWTVKAKKKK*
Ga0102821_10973803	3300007557	Estuarine	MRINIIKFVVKALGYEWSGDELKLPVWYVKEKKKK
Ga0102828_11234332	3300007559	Estuarine	MRIRIIRFVVKALGYEWGGDALNVPIWTVKAKKKK*
Ga0102917_10721843	3300007590	Estuarine	MRIKIIRFVVKALGYEWGGDKFNAPIWTVKAKKK*
Ga0102917_12866823	3300007590	Estuarine	MRIKIIKFVVKALGYEWGGDSLNLPYWTVKEKKKK*
Ga0102871_12259262	3300007620	Estuarine	MRIKIIRFVVKALGDDWGGDNLNAPVWTVKAKKKK*
Ga0102863_11581131	3300007622	Estuarine	MRIKIIKFVVKALGYEWGGDNLKLPYWTVKAKKK*
Ga0102863_12659781	3300007622	Estuarine	MRIKIIRFVVKALGYQWGGDLLNAPIWTVKAKKKK*
Ga0102903_12050501	3300007630	Estuarine	VRIKIIKFVVKALGYDWSGDELKLPVWYVKEKKNKK*
Ga0102865_10268072	3300007639	Estuarine	MKGKTMRIKIIRFVVKALGYQWGGDLLNAPIWTVKAKKKK*
Ga0102902_12278612	3300007644	Estuarine	MRIRIIRFVVKALGYQWGGDLLNAPIWTVKAKKKK*
Ga0108970_103690995	3300008055	Estuary	MRIRIIRAVVKLLGYEWGGDALKAPIWTVKEKKKK*
Ga0108970_112815863	3300008055	Estuary	MRIKIIRFVVKALGYEWSGDELKLPVWYVKEKKKK*
Ga0114340_100059910	3300008107	Freshwater, Plankton	MRIKIIRFVVKTLGYEWGGDNLNAPVWTVKAKKKK*
Ga0114343_10396565	3300008110	Freshwater, Plankton	MRIKIIKAVVKLLGYEWSGDELKLPIWYVKEKKSKR*
Ga0114346_10141153	3300008113	Freshwater, Plankton	MRIKIIRFVVKALGYEWGGDILKAPIWTVKAKKK*
Ga0114346_10352942	3300008113	Freshwater, Plankton	MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKEKKKK*
Ga0114346_10364076	3300008113	Freshwater, Plankton	MRIKIIKFVVKALGYEWSGDDLKLPVWYVKEKKKK*
Ga0114347_10087797	3300008114	Freshwater, Plankton	MRIKIIKFVVKALGYEWSGDELKLPVWQVKAKQKKK*
Ga0114347_10980714	3300008114	Freshwater, Plankton	MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKK*
Ga0114350_100042516	3300008116	Freshwater, Plankton	MRIKIIKFVVKFLGYEWSGDNVNLPVWQVKAKKKNK*
Ga0114350_100140026	3300008116	Freshwater, Plankton	MRIKIIKFIVKTLGYEWGGDNLNAPIWTIKAKKKK*
Ga0114350_10041377	3300008116	Freshwater, Plankton	MRIKIIKLVVKLLGYEWSGDNLNLPVWQVKAKKKGK*
Ga0114350_10237344	3300008116	Freshwater, Plankton	MRIKIIKFVVKVLGYEWSGDNLNLPVWQVKAKKKGK*
Ga0114354_12791871	3300008119	Freshwater, Plankton	QIMRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK*
Ga0114355_100597329	3300008120	Freshwater, Plankton	VVKENQIMRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK*
Ga0114840_10551911	3300008258	Freshwater, Plankton	VMRIKIIKFVVKFLGYEWSGDNVNLPVWQVKAKKKNK*
Ga0114336_100246024	3300008261	Freshwater, Plankton	MRIKIIRFVVKALGYQWGGDSLNAPVWTVKAKKKK*
Ga0114353_13974651	3300008264	Freshwater, Plankton	IMRIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKK*
Ga0104242_10882583	3300008962	Freshwater	MRIKIIRFVVKALGYDWGGDNLNAPVWTVKAKKKKKK
Ga0102831_10116843	3300008996	Estuarine	MRIKIIRFVVKALGYQWGGDNLNVPVWTVKAKKKK*
Ga0102831_11249212	3300008996	Estuarine	MRIKIIRFIVKTLGYEWGGDNLNAPVWTVKAKKKK*
Ga0102831_13305033	3300008996	Estuarine	MRIKIIRFVVKALGYEWGGDALKSPIWTVKAKKK*
Ga0102830_12578251	3300009059	Estuarine	IMRIKIIKFVVKALGYEWGGDSLNAPIWTVKAKKKK*
Ga0114973_1000039314	3300009068	Freshwater Lake	MRIKIIRFVVKALGYEWGGDKLNAPIWTVKAKKKN*
Ga0114973_1000060345	3300009068	Freshwater Lake	MRIKIIKFVVKALGYEWGGDALKAPVWTVKAKKK*
Ga0102815_102499452	3300009080	Estuarine	MRINIIKFVVKALGYEWSGDELKLPVWYVKEKKKK*
Ga0114980_1000035647	3300009152	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDNLKLPYWTVKAKKKK*
Ga0114980_100028958	3300009152	Freshwater Lake	MRIKIIRFVVKALGYEWGGDALKAPVWTVKAKKK*
Ga0114980_100112084	3300009152	Freshwater Lake	MRIKIIRFVVKALGYEWGGDNLNAPIWTVKAKKKK*
Ga0114980_102621302	3300009152	Freshwater Lake	MRIKIIRFVVKALGYQWGGDKLNVPVWTVKAKKK*
Ga0114977_102279761	3300009158	Freshwater Lake	MRIKIIRFVVKALGYEWGGDFLNAPIWTVKVKNKR*
Ga0114977_103384593	3300009158	Freshwater Lake	MRIKIIKFIVKMFGYEWDKISLNAQIWTVKVKNKR*
Ga0114978_1000052152	3300009159	Freshwater Lake	MRLKIIKFVVKLLGYEWSGDNLKLPIWYVKEKKKSE*
Ga0114981_1000056030	3300009160	Freshwater Lake	MRIKIIRLVVKALGYEWGGDNLNAPIWTVKAKKKK*
Ga0114976_100020036	3300009184	Freshwater Lake	MRIKIIRFVVKALGYEWGGDFLNAPIWTVKAKKKK*
Ga0114982_100047243	3300009419	Deep Subsurface	MRIKIIKFVVKALGYEWGGDKLNLPYWTVKAKKK*
Ga0114982_10506471	3300009419	Deep Subsurface	MRIRIIRFVVKALGYEWGGDKLNAPVWTVKAKKK*
Ga0126448_10012139	3300009466	Meromictic Pond	MRIKIIRFVVKALGYEWGGDSLNLPYWTVKAKKKDK*
Ga0126448_10275433	3300009466	Meromictic Pond	MRIKIIKFIVKLLGYDWGGDALKAKIWTVKAKKK*
Ga0129333_1000375214	3300010354	Freshwater To Marine Saline Gradient	MRIKIIKFVVKLLGYEWSGDQLNLPVWQVRAKKKK*
Ga0129333_1000460123	3300010354	Freshwater To Marine Saline Gradient	MRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKAK*
Ga0129333_1000862322	3300010354	Freshwater To Marine Saline Gradient	MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKKKK*
Ga0129333_100141817	3300010354	Freshwater To Marine Saline Gradient	MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKKN*
Ga0129333_100428493	3300010354	Freshwater To Marine Saline Gradient	MRIKIIKFVVKLLGYEWSGDNLKLPVWYVKEKKKVK*
Ga0129333_100478556	3300010354	Freshwater To Marine Saline Gradient	MRIKIIKFIVKALGYEWSGDELKLPVWQVKAKTKKK*
Ga0129333_101420677	3300010354	Freshwater To Marine Saline Gradient	WQEGEIMRIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKK*
Ga0129333_101696855	3300010354	Freshwater To Marine Saline Gradient	MRIKIIRFVVKILGYEWSGDQLKLPVWQVKEKTKKK*
Ga0129333_102409605	3300010354	Freshwater To Marine Saline Gradient	MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKVKKK*
Ga0129333_102733682	3300010354	Freshwater To Marine Saline Gradient	MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKR*
Ga0129333_103941021	3300010354	Freshwater To Marine Saline Gradient	MRIKIIKFVVKLLGYEWSGDQLNLPVWQVKAKKKNK*
Ga0129333_107605811	3300010354	Freshwater To Marine Saline Gradient	MRIKFIKFIVKLLGYEWGGDALKAPIWTIKAKAKKK*
Ga0129336_1000165213	3300010370	Freshwater To Marine Saline Gradient	MRIKIIKFVVKLLGYEWSGDQLNLPVWQVKAKKKK*
Ga0129336_100537305	3300010370	Freshwater To Marine Saline Gradient	MRIKIIKFVVKALGYEWSGDELKLPVCQVKAKTKKK*
Ga0129336_102197923	3300010370	Freshwater To Marine Saline Gradient	RIKIIKFVVKILGYEWSGDELKLPVWQVKAKQKKK*
Ga0133913_100699778	3300010885	Freshwater Lake	MRIKIIRFVVKALGYQWSGDELKLPVWYVKEKKKK*
Ga0151620_10083326	3300011268	Freshwater	MRIKIIKTVVKLLGYEWGGDKLNAPIWTVKEKKKSK*
Ga0157137_1028803	3300012286	Freshwater	MMRIKIIKFVVRVLGYEWGGDSLKLPYWTVKEKKK*
Ga0157138_10164751	3300012352	Freshwater	VMRIKIIKCVVKVLGYEWGGDNLTAPIWTVKAKKK*
Ga0157138_10716672	3300012352	Freshwater	MRIKIIRFVVKALGYEWGGDSLKLPYWTVKEKKKDK*
Ga0157203_10479232	3300012663	Freshwater	MKGKSMRIKIIKFVVKILGYEWGGDNLHAPLWTVKAKKKK*
Ga0157210_10252163	3300012665	Freshwater	MRIKIIKFVVKALGYEWGGDTLNAPIWTVKAKKK*
Ga0129337_10216673	3300012968	Aqueous	MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKK*
Ga0129338_13002443	3300012970	Aqueous	MIRIKIIKFVVKILGYEWGGDALRAPVWTVKAKKKK*
Ga0129338_13518233	3300012970	Aqueous	MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKRKKN*
Ga0164293_1000032953	3300013004	Freshwater	MMRIKIIKFVVKALGYQWSGDDLKLPVWYVKEKKKVK*
Ga0164293_100163638	3300013004	Freshwater	MRLKIIKLVVKLLGYEWSGDNLKLPIWYVKEKKKSE*
Ga0164293_100859193	3300013004	Freshwater	MRIKIIKAVVKLLGYEWGGDKLNLPYWTVKEKKKK*
Ga0164292_109318312	3300013005	Freshwater	MRIKIIRFVVKALGYDWGGDSLKAPVWTVKAKKKK*
(restricted) Ga0172367_1001725613	3300013126	Freshwater	MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKTKRNK*
(restricted) Ga0172367_102078522	3300013126	Freshwater	MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKKKK*
(restricted) Ga0172367_104757972	3300013126	Freshwater	MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKTKKK*
(restricted) Ga0172367_104757982	3300013126	Freshwater	MRIKIIKFVVKLLGYEWSGDELKLPVWQIKAKTKKK*
(restricted) Ga0172373_100325126	3300013131	Freshwater	MRIKIIKFIVKLLGYEWSGDELKLPVWQVKAKTKKTK*
(restricted) Ga0172372_101245474	3300013132	Freshwater	MRIKIIKFVVKILGYEWSGDNLNLPVWQVKAKTKKK*
Ga0177922_100188813	3300013372	Freshwater	MRIKIIRFVVKALGYEWGGDNLNVLVWTVKAKKKK*
Ga0119954_100043320	3300014819	Freshwater	MRIKIIKFVVKLLGYEWGGDNLLAPIWTVKAKKK*
Ga0169931_100623365	3300017788	Freshwater	MRIKIIKFVVKILGYEWSGDNLNLPVWQVKAKTKKK
Ga0169931_101015002	3300017788	Freshwater	MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKTKKK
Ga0169931_102299444	3300017788	Freshwater	MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKKKK
Ga0169931_104903952	3300017788	Freshwater	MRIKIIKFVVKLLGYEWSGDGLKLPVWQVKAKQKKK
Ga0188881_100277712	3300019146	Freshwater Lake	MRIKIIKFVVKALGYEWSGDELKLPVWQVKAKTKKK
Ga0181359_10009645	3300019784	Freshwater Lake	MRIKIIRAVVKLLGYEWGGDALNAPIWTVKAKKKK
Ga0181359_10431002	3300019784	Freshwater Lake	MRIKVIRFVVKVLGYEWGGDALNVPVWTVKAKKKK
Ga0181359_11813483	3300019784	Freshwater Lake	MRIKIIRFVVKALGYQWGGDALSAPVWTVKAKKKK
Ga0207193_103243516	3300020048	Freshwater Lake Sediment	MRIKIIRAVVKLLGYEWGGDRLNAPIWTVKEKKKSK
Ga0207193_10346613	3300020048	Freshwater Lake Sediment	MRIKFIRFVVKTLGYDWGGDNLNAPVWTVKAKKKK
Ga0194113_102003376	3300020074	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKTKRNK
Ga0194113_103751794	3300020074	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKTKKK
Ga0211732_10538297	3300020141	Freshwater	MRIKIIRSVVKLLGYEWGGDNLNAPVWTVKAKKKK
Ga0211732_11729163	3300020141	Freshwater	MRIKIIKAVVKLLGYEWLGDELNLPVWYVKEKKKSK
Ga0211732_12873815	3300020141	Freshwater	MRIKIIRSIVKLLGYEWGGDNLNAPVWTVKAKKKK
Ga0211732_15256983	3300020141	Freshwater	MRIKIIKFVVKALGYEWSGDELKLPVWQVKAKQKKK
Ga0211736_100532893	3300020151	Freshwater	MRIKVIRFVVKALGYEWGGDLLNAPIWTVKAKKKK
Ga0211736_100847383	3300020151	Freshwater	MRIKIIKAVVKLLGYEWGGDNLNAPIWTVKAKKKK
Ga0211736_103214922	3300020151	Freshwater	MRIKIIKFVVKALGYQWSGDDLKLPVWYVKEKKKVK
Ga0211736_1070703812	3300020151	Freshwater	MRIKIIKAVVKLLGYEWSGDELKLPIWYVKEKKRKR
Ga0211736_109622892	3300020151	Freshwater	MRIKIIRAVVKLLGYEWGGDNLNAPVWTVKAKKKK
Ga0211736_109950542	3300020151	Freshwater	MRIRIIRFVVKALGYEWGGDLLNAPIWTVKAKKKK
Ga0211734_100339963	3300020159	Freshwater	MRIKLIRFVVKALGYEWGGDLLNAPIWTVKAKKKK
Ga0211734_102336207	3300020159	Freshwater	MRIKIIRAVVKLLGYEWGGDNLNAPIWTVKEKKNKK
Ga0211734_107564617	3300020159	Freshwater	MRLKIIKFVVKLLGYEWSGDNLKLPIWYVKEKKKSE
Ga0211733_111716792	3300020160	Freshwater	MRIKIIRFVVKALGYEWGGDLLNAPIWTVKAKKKK
Ga0211726_100916713	3300020161	Freshwater	MRIKIIRFVVKTLGYEWGGDNLNAPVWTVKAKKKK
Ga0211735_109765574	3300020162	Freshwater	QGKVMRIKIIKAVVKLLGYEWLGDELNLPVWYVKEKKKSK
Ga0194116_100634459	3300020204	Freshwater Lake	IMRIKIIKFVVKLLGYEWSGDELKLPVWQVKAKTKKK
Ga0211731_103915352	3300020205	Freshwater	MRIKIIRFVVKTLGYEWGGDLLNAPIWTVKAKKKK
Ga0208464_1019813	3300020482	Freshwater	MRIKIIRFVVKALGYDWGGDNLNAPVWTVKAKKKK
Ga0208326_1019392	3300020494	Freshwater	MRIKIIKFIVKALGYEWSGDQLNLPVWQVKAKTKKK
Ga0208050_10263503	3300020498	Freshwater	MRIKIIKFVVKALGYEWSGDELKLPVWYIKDKKKK
Ga0208088_10332001	3300020505	Freshwater	MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKS
Ga0208234_10068754	3300020515	Freshwater	MRIKIIRFVVKALGYEWSGDELKLPVWYVKEKKKK
Ga0208223_10015735	3300020519	Freshwater	MRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK
Ga0208232_10040794	3300020527	Freshwater	MMRIKIIKFVVKALGYQWSGDDLKLPVWYVKEKKKVK
Ga0208232_10102134	3300020527	Freshwater	MRIRIIRFVVKSLGYEWGGDLLNAPIWTVKAKKKK
Ga0208233_10043953	3300020529	Freshwater	MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKAKKKN
Ga0208233_10291952	3300020529	Freshwater	MRIKIIKFVVKALGYEWSGDELKLPVWYIKEKKKK
Ga0208233_10441751	3300020529	Freshwater	MGKKGKVMRIKIIKLVVKLLGYEWRGDKLNLPVWTVKAKKK
Ga0208487_10331632	3300020531	Freshwater	MRIKIIRFVVKTLGYEWLGDELNLPVWYVKEKKKSK
Ga0207942_10052584	3300020549	Freshwater	MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKSK
Ga0208362_10000019	3300020558	Freshwater	MRIKIIKFVVKLLGYEWSGDNLKLPVWYVKEKKKK
Ga0208362_10295042	3300020558	Freshwater	MRIKFIRFVVKTLGYEWGGDNLNAPVWTVKAKKKK
Ga0207909_10105605	3300020572	Freshwater	MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKKK
Ga0207909_10134272	3300020572	Freshwater	MRIKIIRAVVKLLGYEWGGDKLNVPIWTVKEKKKK
Ga0194048_100005705	3300021519	Anoxic Zone Freshwater	MRIKIIRFIVKTLGYEWGGDNLNAPVWTVKAKKKK
Ga0222714_100435745	3300021961	Estuarine Water	MRIKIIRFIVKALGYEWSGDELKLPVWQVKAKQKKK
Ga0222714_101523162	3300021961	Estuarine Water	MRIKIIKFVVKVLGYEWSGDELKLPVWQVKAKQKKK
Ga0222713_100211764	3300021962	Estuarine Water	MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKNKK
Ga0222713_106338351	3300021962	Estuarine Water	MIRIKIIKFVVKILGYEWGGDALRAPVWTVKAKKRK
Ga0222712_100724792	3300021963	Estuarine Water	VRIKIIKFVVKALGYEWSGDELKLPIWYVKAKKKK
Ga0222712_101315974	3300021963	Estuarine Water	MRIKIIRFVVKALGYEWGGDKLNLPYWTVKEKKKK
Ga0222712_105195091	3300021963	Estuarine Water	MRIKIIKFVVRLLGYEWSGDELKLPVWYVKEKKKK
Ga0222712_106484643	3300021963	Estuarine Water	MRIKIIRFVVKALGYEWGGDNLNAPIWTVKAKKKK
Ga0214921_10000213134	3300023174	Freshwater	MRIKIIKFVVKVLGYEWGGENLKLPYWTVKGKKRNK
Ga0214921_1000029565	3300023174	Freshwater	MRIKIIRFVVKALGYEWSGDELKLPIWYVKEKKKK
Ga0214921_1000373141	3300023174	Freshwater	MRIKIIRFVVKALGYEWGGDALKAPVWTVKTKKKK
Ga0214921_100913002	3300023174	Freshwater	MMRIKIIKFVVKVLGYQWSGDDLKLPVWYVKEKKKVK
Ga0247724_100003662	3300024239	Deep Subsurface Sediment	MRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKAK
Ga0255147_100024619	3300024289	Freshwater	MRIKIIKLIVKILGYEWSGDELKLPVWQVKAKQKKR
Ga0255147_10303181	3300024289	Freshwater	MRIKIIRFVVKILGYEWSGDQLKLPVWQVKEKTKKK
Ga0255148_10391234	3300024306	Freshwater	RGKIMRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKAK
Ga0244777_106367192	3300024343	Estuarine	MRIKIIKFVVKALGYEWGGDSLNLPYWTVKEKKKK
Ga0244775_1000183263	3300024346	Estuarine	MRIKIIRFVVKALGYEWGGDNLNAPVWTVKAKKKK
Ga0244775_1000183913	3300024346	Estuarine	MRIKIIRFVVKALGYDWGGDALNVPVWTVKAKKKK
Ga0244775_1000305411	3300024346	Estuarine	MEIGVEMRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK
Ga0244775_100220943	3300024346	Estuarine	MRIKIIKFVVKALGYEWGGDSLNAPIWTVKAKKKK
Ga0244775_100270862	3300024346	Estuarine	MRIRIIRFVVKALGYEWGGDALNVPIWTVKAKKKK
Ga0244775_101589412	3300024346	Estuarine	MRIKIIRFVVKALGYDWGGDSLNAPVWTVKAKKKK
Ga0244775_102000951	3300024346	Estuarine	MRIKIIRFVVKALGYQWGGDNLNVPVWTVKAKKKK
Ga0244775_102964031	3300024346	Estuarine	MRIKIIRFVVKALGYEWGGDALNVPIWTVKAKKKK
Ga0244775_104196082	3300024346	Estuarine	MRIRIIRFVVKALGYQWGGDLLNAPIWTVKAKKKK
Ga0244775_105760123	3300024346	Estuarine	MRIKIIKTVVRLLGYEWGGDNLNAPIWTVKAKKKK
Ga0244775_113782293	3300024346	Estuarine	MRIKIIRAMVKLLGYEWGGDSLNAPVWTVKAKKKK
Ga0255142_10511472	3300024352	Freshwater	MRIKIIKFVVKILGYEWSGDELNLPVWQVKAKKKK
Ga0255268_11467403	3300024572	Freshwater	GGKIMRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKAK
Ga0208424_10173551	3300025445	Aqueous	GKIMRIKIIKFVVKLLGYEWSGDNLNLPIWYVKAKKKK
Ga0208546_100002659	3300025585	Aqueous	MRIKIIKFVVKLLGYEWSGDNLNLPIWYVKAKKKK
Ga0208546_11431582	3300025585	Aqueous	MRLKIIKFVVKALGYEWSGDNVKIPVWYVKEKKKK
Ga0255155_10664312	3300026455	Freshwater	VRIKIIKFVVKILGYEWSGDNINLPVWQVKAKKKKNR
Ga0208009_10015578	3300027114	Deep Subsurface	MRIRIIKTVVKLLGYEWSGDELKLPVWYVKEKKKK
Ga0255107_10196982	3300027136	Freshwater	MRIKIIRFVVKALGYEWGGDSLNAPIWTVKAKKKK
Ga0255102_10373963	3300027144	Freshwater	MKGKSMRIKIIKFVVKILGYEWGGDNLHAPLWTVKAKKKK
Ga0208022_10335004	3300027418	Estuarine	MRINIIKFVVKALGYEWSGDELKLPVWYVKEKKKKK
Ga0208788_10358764	3300027499	Deep Subsurface	MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKEKKKSK
Ga0209552_100027318	3300027563	Freshwater Lake	MRIKIIRFVVKALGYQWGGDALNAPIWTVKAKKKK
Ga0209552_10635653	3300027563	Freshwater Lake	MRIKIIKFVVKALGYEWGGDNLNVPVWTVKAKKKK
Ga0208966_100012530	3300027586	Freshwater Lentic	MRIKIIRFVVKALGYEWGGDNLNLPYWTVKAKKKK
Ga0208133_10261275	3300027631	Estuarine	VMRIKIIKFVVKSLGYEWSGDELKLPVWYVKEKKKK
Ga0209357_10699201	3300027656	Freshwater Lake	MRIKIIRFVVKALGYEWGGDALNIPVWTVKAKKKK
Ga0209551_100050428	3300027689	Freshwater Lake	MRIKIIRAMVKLLGYEWGGDNLNAPVWTVKAKKKK
Ga0209551_10277723	3300027689	Freshwater Lake	MRIKIIKFVVKTLGYEWSGDELKLPIWYVKAKKKK
Ga0209551_12577032	3300027689	Freshwater Lake	MRIKIIKIVVKLLGYEWGGDNLNAPIWTVKAKKKK
(restricted) Ga0247836_10113413	3300027728	Freshwater	MRIKIIKFVVNLLGYEWSGDNLKLPVWYVKEKKKK
Ga0209087_100052534	3300027734	Freshwater Lake	MRIKIIRFVVKALGYEWGGDFLNAPIWTVKAKKKK
Ga0209598_100308883	3300027760	Freshwater Lake	MRIKIIRFVVKALGYEWGGDKLNAPIWTVKAKKKN
Ga0209770_1000106822	3300027769	Freshwater Lake	MRIKIIRAVVKLLGYEWGGDSLNAPVWTVKAKKKK
Ga0209770_100067705	3300027769	Freshwater Lake	MRIKIIKFVVKALGYDWGGDSLKAPVWTVKAKKKK
Ga0209770_102272673	3300027769	Freshwater Lake	MRIKIIKFVVKALGYEWSGDELKLPIWYVKAKKKK
Ga0209500_104381011	3300027782	Freshwater Lake	MRIKIIRFVVKALGYQWSGDELKLPVWYVKEKKKK
Ga0209972_1000264621	3300027793	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDNLNLPVWQVKAKKKGK
Ga0209107_102941103	3300027797	Freshwater And Sediment	MRIKIIRAVVKLLGYEWGGDLLNAPIWTVKAKKKK
Ga0209358_102245372	3300027804	Freshwater Lake	MRIKIIRFVVKALGYEWSGDELKLPVWQVKAKQKKK
Ga0209229_100872492	3300027805	Freshwater And Sediment	MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKK
Ga0209230_101289021	3300027836	Freshwater And Sediment	MRIKIIRFVVKTLGYEWGGDQLNLPYWTVKEKKKK
Ga0209230_101853811	3300027836	Freshwater And Sediment	MRIKIIKFVVKTLGYEWGGDQLNLPYWTVKEKKKTK
Ga0209550_102325703	3300027892	Freshwater Lake	KGYQVMRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKSK
Ga0209550_104020513	3300027892	Freshwater Lake	MRIKIIKFVVKALGYEWGGDALNAPVWTVKAKKKK
Ga0209550_104064882	3300027892	Freshwater Lake	MRIKIIRSVVKLLGYEWGGDSLNAPVWTVKAKKKK
Ga0209550_104255703	3300027892	Freshwater Lake	MRIKIIKAVVKLLGYEWSGDELKLPVWYVKEKKKK
Ga0209298_1000021847	3300027973	Freshwater Lake	MRIKIIKFVVKLLGYEWSGDNLKLPYWTVKAKKKK
Ga0247723_1000055116	3300028025	Deep Subsurface Sediment	MRIKIIKFVVKALGYEWGGDSLKAPIWTVKEKKKK
Ga0247723_10018328	3300028025	Deep Subsurface Sediment	MRIKIIRFVVKTLGYEWGGDNLNAPIWTVKAKKKK
Ga0119944_10344253	3300029930	Aquatic	MRIKIIKFVVKILGYEWSGDELKLPVWQVKAKKKIK
Ga0315907_1000157916	3300031758	Freshwater	MRIKIIKFVVKFLGYEWSGDNVNLPVWQVKAKKKNK
Ga0315907_100905723	3300031758	Freshwater	MRIKIIKFIVKTLGYEWGGDNLNAPIWTIKAKKKK
Ga0315907_101543384	3300031758	Freshwater	MRIKIIKLVVKLLGYEWSGDNLNLPVWQVKAKKKGK
Ga0315909_1002511712	3300031857	Freshwater	MRIKIIKFVVKVLGYEWSGDNLNLPVWQVKAKKKGK
Ga0315904_1000307427	3300031951	Freshwater	MRLKIIKFVVKLMGYEWSGDELKLPVWQVKAKKKK
Ga0315904_1001317917	3300031951	Freshwater	MRIKIIKAVVKLLGYEWSGDELKLPVWQVKAKKKK
Ga0315904_1001448023	3300031951	Freshwater	VVKENQIMRIKIIKFVVKLLGYEWSGDNVNLPVWQVKAKKKK
Ga0315904_106014243	3300031951	Freshwater	MRIKIIKFVVKALGYEWSGDELKLPVWYVKEKKKNK
Ga0315904_112434041	3300031951	Freshwater	MRIKIIKFVVKALGYEWSGDELKLPVWQIKAKQKKK
Ga0315905_1000560223	3300032092	Freshwater	MRIKVIKFVVKALGYEWSGDDLKLPVWYVKEKKKK
Ga0315903_108250441	3300032116	Freshwater	IMRIKIIKAVVKLLGYEWSGDELKLPVWQVKAKKKK
Ga0334980_0000095_6251_6361	3300033816	Freshwater	MRIKIIRAVVKLLGYEWGGDKLNAPIWTVKEKKNKK
Ga0334979_0000654_10523_10633	3300033996	Freshwater	MRLKIIKLVVKLLGYEWSGDNLKLPIWYVKEKKKSE
Ga0334991_0425139_236_343	3300034013	Freshwater	MRIKIIKFVVKALGYEWSGDELRLPVWYVKEKKKK
Ga0334985_0768636_259_366	3300034018	Freshwater	MRIRIIRAVVKLLGYEWGGDKLNAPIWTVKEKKKK
Ga0335005_0139568_1212_1322	3300034022	Freshwater	MRIKIIKFVVKALGYEWSGDDLKLPVWYVKEKKKNK
Ga0335019_0000027_69530_69637	3300034066	Freshwater	MRIKIIKAVVKLLGYEWGGDKLNAPIWTVKEKKKK
Ga0335019_0001030_659_766	3300034066	Freshwater	MRIKIIRFVVKALGYDWGGDSLKAPVWTVKAKKKK
Ga0335019_0062540_1337_1459	3300034066	Freshwater	MKGKSMRIKIIRFVVKILGYEWGGDNLHAPIWTVRAKKKK
Ga0335028_0070094_58_171	3300034071	Freshwater	MRIKIIKFVVKALGYEWSGDNLKLPVWYVKEKKKEVK
Ga0310127_019398_899_1009	3300034072	Fracking Water	MRIKIIKFVVKALGYEWSGDELKLPVWYVKAKTKKK
Ga0310130_0000204_36973_37101	3300034073	Fracking Water	VGEKSKMRIKIIKFVVKALGYEWSGDELKLPVWYVKAKKKKK
Ga0310130_0003909_2013_2129	3300034073	Fracking Water	MRIKIIKFVVKILGYQWGGDSLNAPIWTVKAKKNDNKK
Ga0335025_0002251_7905_8015	3300034096	Freshwater	MRIKIIKFVVKLLGYEWSGDNLKLPVWQVKAKTKNK
Ga0335027_0613770_270_380	3300034101	Freshwater	MRIKIIKLVVKLLGYEWSGDDLKLPVWYVKEKKNKK
Ga0335036_0316488_879_989	3300034106	Freshwater	MRIKIIKFVVKALGYEWSGDSLKLPVWYVKEKKKVK
Ga0335065_0788095_95_202	3300034200	Freshwater	MRIKIIKFVVKALGYEWGGDNLNLAYWTVKEKKKK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters