Basic Information | |
---|---|
Family ID | F010727 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 300 |
Average Sequence Length | 41 residues |
Representative Sequence | QENVTIQCKGRVVRTDETGEGGEGRGVACVIDSYEFVRNS |
Number of Associated Samples | 258 |
Number of Associated Scaffolds | 300 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.33 % |
% of genes from short scaffolds (< 2000 bps) | 91.00 % |
Associated GOLD sequencing projects | 242 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.333 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 35.29% Coil/Unstructured: 64.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 300 Family Scaffolds |
---|---|---|
PF00196 | GerE | 46.67 |
PF00248 | Aldo_ket_red | 2.33 |
PF00171 | Aldedh | 2.33 |
PF00072 | Response_reg | 2.00 |
PF02737 | 3HCDH_N | 0.67 |
PF00578 | AhpC-TSA | 0.67 |
PF13432 | TPR_16 | 0.33 |
PF00903 | Glyoxalase | 0.33 |
PF02504 | FA_synthesis | 0.33 |
PF04191 | PEMT | 0.33 |
PF00886 | Ribosomal_S16 | 0.33 |
PF01361 | Tautomerase | 0.33 |
PF08533 | Glyco_hydro_42C | 0.33 |
PF13517 | FG-GAP_3 | 0.33 |
PF00672 | HAMP | 0.33 |
PF01212 | Beta_elim_lyase | 0.33 |
PF03861 | ANTAR | 0.33 |
PF14312 | FG-GAP_2 | 0.33 |
PF12762 | DDE_Tnp_IS1595 | 0.33 |
PF12704 | MacB_PCD | 0.33 |
PF02687 | FtsX | 0.33 |
PF07883 | Cupin_2 | 0.33 |
PF01432 | Peptidase_M3 | 0.33 |
COG ID | Name | Functional Category | % Frequency in 300 Family Scaffolds |
---|---|---|---|
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.33 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.33 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.33 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.67 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.67 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.67 |
COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 0.67 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.67 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.67 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.67 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.33 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.33 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.33 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.33 |
COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 0.33 |
COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.33 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.33 |
COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 0.33 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.33 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.33 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.33 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.33 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.33 |
COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.33 |
COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.33 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.33 |
COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.33 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.33 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.33 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.33 |
COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.33 |
COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.33 |
COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.33 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10115992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 655 | Open in IMG/M |
3300001170|JGI12704J13340_1012332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 687 | Open in IMG/M |
3300001356|JGI12269J14319_10122060 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
3300001356|JGI12269J14319_10223892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 720 | Open in IMG/M |
3300001416|JGI20176J14865_102298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 672 | Open in IMG/M |
3300001661|JGI12053J15887_10399018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 661 | Open in IMG/M |
3300001867|JGI12627J18819_10347675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 599 | Open in IMG/M |
3300002853|draft_1017529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 640 | Open in IMG/M |
3300003320|rootH2_10232847 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300004081|Ga0063454_100438767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 891 | Open in IMG/M |
3300004091|Ga0062387_100161652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1304 | Open in IMG/M |
3300004092|Ga0062389_100175322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2065 | Open in IMG/M |
3300004104|Ga0058891_1554324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 866 | Open in IMG/M |
3300004121|Ga0058882_1000724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 706 | Open in IMG/M |
3300004153|Ga0063455_100948124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 616 | Open in IMG/M |
3300004472|Ga0068974_1386117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 850 | Open in IMG/M |
3300004594|Ga0068976_1235969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 593 | Open in IMG/M |
3300004604|Ga0068943_1286594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 532 | Open in IMG/M |
3300004605|Ga0068952_1314575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 912 | Open in IMG/M |
3300004643|Ga0062591_101854005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 617 | Open in IMG/M |
3300004969|Ga0072327_1272699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 574 | Open in IMG/M |
3300004972|Ga0072325_1321087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 755 | Open in IMG/M |
3300005166|Ga0066674_10308786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 743 | Open in IMG/M |
3300005178|Ga0066688_10673719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 660 | Open in IMG/M |
3300005293|Ga0065715_10097327 | All Organisms → cellular organisms → Bacteria | 3723 | Open in IMG/M |
3300005434|Ga0070709_10921327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 692 | Open in IMG/M |
3300005435|Ga0070714_102151115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 543 | Open in IMG/M |
3300005468|Ga0070707_100046477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4155 | Open in IMG/M |
3300005529|Ga0070741_10035360 | All Organisms → cellular organisms → Bacteria | 6710 | Open in IMG/M |
3300005538|Ga0070731_10883349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 593 | Open in IMG/M |
3300005542|Ga0070732_10319781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 933 | Open in IMG/M |
3300005542|Ga0070732_10523707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 719 | Open in IMG/M |
3300005546|Ga0070696_101573000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 564 | Open in IMG/M |
3300005557|Ga0066704_10618657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 694 | Open in IMG/M |
3300005591|Ga0070761_11088650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 509 | Open in IMG/M |
3300005764|Ga0066903_107002430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 585 | Open in IMG/M |
3300005921|Ga0070766_11296805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 505 | Open in IMG/M |
3300005994|Ga0066789_10071847 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300006028|Ga0070717_11545762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 602 | Open in IMG/M |
3300006031|Ga0066651_10777936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 518 | Open in IMG/M |
3300006041|Ga0075023_100307169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 656 | Open in IMG/M |
3300006041|Ga0075023_100445989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 571 | Open in IMG/M |
3300006046|Ga0066652_101853578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 543 | Open in IMG/M |
3300006052|Ga0075029_100893069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 609 | Open in IMG/M |
3300006052|Ga0075029_101157804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 539 | Open in IMG/M |
3300006086|Ga0075019_10424359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 817 | Open in IMG/M |
3300006163|Ga0070715_11036611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 513 | Open in IMG/M |
3300006172|Ga0075018_10344178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 746 | Open in IMG/M |
3300006176|Ga0070765_101487287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 637 | Open in IMG/M |
3300006755|Ga0079222_12217590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 546 | Open in IMG/M |
3300006797|Ga0066659_10141349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1699 | Open in IMG/M |
3300006800|Ga0066660_10488829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1034 | Open in IMG/M |
3300006800|Ga0066660_10986346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 678 | Open in IMG/M |
3300006804|Ga0079221_10894833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 651 | Open in IMG/M |
3300006903|Ga0075426_11264942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 560 | Open in IMG/M |
3300007788|Ga0099795_10627870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 513 | Open in IMG/M |
3300009038|Ga0099829_10323309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1267 | Open in IMG/M |
3300009038|Ga0099829_10922540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 724 | Open in IMG/M |
3300009089|Ga0099828_10441894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1173 | Open in IMG/M |
3300009090|Ga0099827_10129915 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
3300009093|Ga0105240_10253213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 2035 | Open in IMG/M |
3300009098|Ga0105245_10503768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1227 | Open in IMG/M |
3300009148|Ga0105243_12808737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 527 | Open in IMG/M |
3300009521|Ga0116222_1009145 | All Organisms → cellular organisms → Bacteria | 4714 | Open in IMG/M |
3300009524|Ga0116225_1355706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 652 | Open in IMG/M |
3300009621|Ga0116116_1011933 | All Organisms → cellular organisms → Bacteria | 3607 | Open in IMG/M |
3300009629|Ga0116119_1115580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 672 | Open in IMG/M |
3300009632|Ga0116102_1019203 | All Organisms → cellular organisms → Bacteria | 2385 | Open in IMG/M |
3300009632|Ga0116102_1090158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 894 | Open in IMG/M |
3300009634|Ga0116124_1135901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 689 | Open in IMG/M |
3300009635|Ga0116117_1040186 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300009639|Ga0116122_1153336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 732 | Open in IMG/M |
3300009672|Ga0116215_1079179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1477 | Open in IMG/M |
3300009792|Ga0126374_10715772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 754 | Open in IMG/M |
3300009792|Ga0126374_10732126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 747 | Open in IMG/M |
3300009824|Ga0116219_10661044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 573 | Open in IMG/M |
3300009839|Ga0116223_10014644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5735 | Open in IMG/M |
3300009839|Ga0116223_10514416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 696 | Open in IMG/M |
3300010046|Ga0126384_12275219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 523 | Open in IMG/M |
3300010047|Ga0126382_11654160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 596 | Open in IMG/M |
3300010048|Ga0126373_10314253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1567 | Open in IMG/M |
3300010143|Ga0126322_1173898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 514 | Open in IMG/M |
3300010143|Ga0126322_1202420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 710 | Open in IMG/M |
3300010304|Ga0134088_10544780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 574 | Open in IMG/M |
3300010339|Ga0074046_10082336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2090 | Open in IMG/M |
3300010343|Ga0074044_10086449 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
3300010343|Ga0074044_10179303 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
3300010366|Ga0126379_10168392 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
3300010376|Ga0126381_100606747 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300010379|Ga0136449_103175228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 636 | Open in IMG/M |
3300010398|Ga0126383_10268906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1684 | Open in IMG/M |
3300010398|Ga0126383_11561874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 749 | Open in IMG/M |
3300010401|Ga0134121_13148378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 509 | Open in IMG/M |
3300010860|Ga0126351_1044267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 567 | Open in IMG/M |
3300011060|Ga0138583_1020669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 529 | Open in IMG/M |
3300011080|Ga0138568_1064980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 806 | Open in IMG/M |
3300011085|Ga0138581_1180609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 637 | Open in IMG/M |
3300011120|Ga0150983_11175137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 500 | Open in IMG/M |
3300011120|Ga0150983_11760213 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300011120|Ga0150983_12456077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 597 | Open in IMG/M |
3300011120|Ga0150983_14040493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 882 | Open in IMG/M |
3300011120|Ga0150983_15076723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 636 | Open in IMG/M |
3300012189|Ga0137388_10254786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1598 | Open in IMG/M |
3300012203|Ga0137399_10308083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1309 | Open in IMG/M |
3300012206|Ga0137380_11749660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 505 | Open in IMG/M |
3300012210|Ga0137378_11307943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 641 | Open in IMG/M |
3300012359|Ga0137385_10847586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 758 | Open in IMG/M |
3300012361|Ga0137360_10037423 | All Organisms → cellular organisms → Bacteria | 3409 | Open in IMG/M |
3300012410|Ga0134060_1300373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 502 | Open in IMG/M |
3300012924|Ga0137413_10959714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 668 | Open in IMG/M |
3300012929|Ga0137404_10204080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1676 | Open in IMG/M |
3300012971|Ga0126369_10006101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8961 | Open in IMG/M |
3300012971|Ga0126369_12550867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 596 | Open in IMG/M |
3300014153|Ga0181527_1075738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1671 | Open in IMG/M |
3300014153|Ga0181527_1199047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 837 | Open in IMG/M |
3300014159|Ga0181530_10538444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 577 | Open in IMG/M |
3300014160|Ga0181517_10385026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 722 | Open in IMG/M |
3300014165|Ga0181523_10589195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 611 | Open in IMG/M |
3300014169|Ga0181531_10179973 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300014201|Ga0181537_10688251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 695 | Open in IMG/M |
3300014489|Ga0182018_10603092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 576 | Open in IMG/M |
3300014968|Ga0157379_10539558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1084 | Open in IMG/M |
3300014969|Ga0157376_12684957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 538 | Open in IMG/M |
3300015241|Ga0137418_10757993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 734 | Open in IMG/M |
3300015242|Ga0137412_10211719 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300015245|Ga0137409_11360738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 554 | Open in IMG/M |
3300015264|Ga0137403_11022036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 673 | Open in IMG/M |
3300016705|Ga0181507_1352969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 582 | Open in IMG/M |
3300017822|Ga0187802_10466363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 500 | Open in IMG/M |
3300017924|Ga0187820_1302590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 527 | Open in IMG/M |
3300017925|Ga0187856_1074938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
3300017927|Ga0187824_10368294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 520 | Open in IMG/M |
3300017928|Ga0187806_1365196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 518 | Open in IMG/M |
3300017930|Ga0187825_10086156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1080 | Open in IMG/M |
3300017933|Ga0187801_10128943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 975 | Open in IMG/M |
3300017935|Ga0187848_10330080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 633 | Open in IMG/M |
3300017936|Ga0187821_10307238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 631 | Open in IMG/M |
3300017938|Ga0187854_10263283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 745 | Open in IMG/M |
3300017955|Ga0187817_10108315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1752 | Open in IMG/M |
3300017955|Ga0187817_10331147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 971 | Open in IMG/M |
3300017955|Ga0187817_10393862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 884 | Open in IMG/M |
3300017961|Ga0187778_10869239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 618 | Open in IMG/M |
3300017972|Ga0187781_10076325 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
3300017972|Ga0187781_10176802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1503 | Open in IMG/M |
3300017988|Ga0181520_11150068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 506 | Open in IMG/M |
3300017999|Ga0187767_10376176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 506 | Open in IMG/M |
3300018016|Ga0187880_1090216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1530 | Open in IMG/M |
3300018016|Ga0187880_1364539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 610 | Open in IMG/M |
3300018019|Ga0187874_10120468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1128 | Open in IMG/M |
3300018034|Ga0187863_10004326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10163 | Open in IMG/M |
3300018034|Ga0187863_10122563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1453 | Open in IMG/M |
3300018043|Ga0187887_10932642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 514 | Open in IMG/M |
3300018044|Ga0187890_10214195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1089 | Open in IMG/M |
3300018061|Ga0184619_10328056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 699 | Open in IMG/M |
3300018062|Ga0187784_10988169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 669 | Open in IMG/M |
3300018085|Ga0187772_10199857 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300018088|Ga0187771_10841737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 778 | Open in IMG/M |
3300018090|Ga0187770_10014656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5142 | Open in IMG/M |
3300018090|Ga0187770_11077480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 648 | Open in IMG/M |
3300018433|Ga0066667_10254543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1333 | Open in IMG/M |
3300019258|Ga0181504_1368667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 553 | Open in IMG/M |
3300019270|Ga0181512_1194467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 506 | Open in IMG/M |
3300019278|Ga0187800_1496748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 843 | Open in IMG/M |
3300019284|Ga0187797_1405482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 671 | Open in IMG/M |
3300019786|Ga0182025_1321873 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
3300019878|Ga0193715_1050520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 892 | Open in IMG/M |
3300019879|Ga0193723_1033668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1539 | Open in IMG/M |
3300019887|Ga0193729_1034353 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
3300020006|Ga0193735_1176745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 529 | Open in IMG/M |
3300021046|Ga0215015_10123364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 978 | Open in IMG/M |
3300021086|Ga0179596_10621799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 548 | Open in IMG/M |
3300021178|Ga0210408_11406498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 525 | Open in IMG/M |
3300021180|Ga0210396_11426633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 572 | Open in IMG/M |
3300021403|Ga0210397_10898626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 686 | Open in IMG/M |
3300021403|Ga0210397_11557489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 513 | Open in IMG/M |
3300021404|Ga0210389_10288362 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300021406|Ga0210386_11342659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 601 | Open in IMG/M |
3300021407|Ga0210383_11793343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 500 | Open in IMG/M |
3300021559|Ga0210409_10973427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 723 | Open in IMG/M |
3300021559|Ga0210409_11274856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 611 | Open in IMG/M |
3300021559|Ga0210409_11495624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 551 | Open in IMG/M |
3300021559|Ga0210409_11718759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 504 | Open in IMG/M |
3300021560|Ga0126371_10011799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7908 | Open in IMG/M |
3300021861|Ga0213853_10124936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 817 | Open in IMG/M |
3300022510|Ga0242652_1027124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 643 | Open in IMG/M |
3300022523|Ga0242663_1085388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 609 | Open in IMG/M |
3300022531|Ga0242660_1182236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 568 | Open in IMG/M |
3300022531|Ga0242660_1193918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 555 | Open in IMG/M |
3300022712|Ga0242653_1046852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 693 | Open in IMG/M |
3300022717|Ga0242661_1157060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 514 | Open in IMG/M |
3300022718|Ga0242675_1040101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 749 | Open in IMG/M |
3300022724|Ga0242665_10113018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 820 | Open in IMG/M |
3300023255|Ga0224547_1009506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1219 | Open in IMG/M |
3300024227|Ga0228598_1098354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 590 | Open in IMG/M |
3300025509|Ga0208848_1062753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 781 | Open in IMG/M |
3300025527|Ga0208714_1103929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 558 | Open in IMG/M |
3300025905|Ga0207685_10383265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 717 | Open in IMG/M |
3300025922|Ga0207646_10681725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 920 | Open in IMG/M |
3300025929|Ga0207664_10272347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1483 | Open in IMG/M |
3300025935|Ga0207709_11480549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 563 | Open in IMG/M |
3300025942|Ga0207689_10589877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 934 | Open in IMG/M |
3300025960|Ga0207651_11763288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 557 | Open in IMG/M |
3300026035|Ga0207703_11414695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 669 | Open in IMG/M |
3300026297|Ga0209237_1092471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1351 | Open in IMG/M |
3300026322|Ga0209687_1259401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 541 | Open in IMG/M |
3300026334|Ga0209377_1047206 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
3300026360|Ga0257173_1030362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 715 | Open in IMG/M |
3300026498|Ga0257156_1021783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1275 | Open in IMG/M |
3300026548|Ga0209161_10249121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 926 | Open in IMG/M |
3300027109|Ga0208603_1053101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 615 | Open in IMG/M |
3300027313|Ga0207780_1009348 | All Organisms → cellular organisms → Bacteria | 2113 | Open in IMG/M |
3300027439|Ga0209332_1038495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 892 | Open in IMG/M |
3300027480|Ga0208993_1086876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 572 | Open in IMG/M |
3300027583|Ga0209527_1110674 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300027648|Ga0209420_1179553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 570 | Open in IMG/M |
3300027674|Ga0209118_1218877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 509 | Open in IMG/M |
3300027698|Ga0209446_1178824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 547 | Open in IMG/M |
3300027745|Ga0209908_10146268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 619 | Open in IMG/M |
3300027767|Ga0209655_10035592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1669 | Open in IMG/M |
3300027787|Ga0209074_10121572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 908 | Open in IMG/M |
3300027826|Ga0209060_10410075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 616 | Open in IMG/M |
3300027842|Ga0209580_10671663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 512 | Open in IMG/M |
3300027869|Ga0209579_10049711 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
3300027884|Ga0209275_10321582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 862 | Open in IMG/M |
3300027898|Ga0209067_10394196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 774 | Open in IMG/M |
3300027911|Ga0209698_10027879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5221 | Open in IMG/M |
3300027911|Ga0209698_10529123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 911 | Open in IMG/M |
3300027911|Ga0209698_10847869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 688 | Open in IMG/M |
3300028020|Ga0265351_1001280 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
3300028745|Ga0302267_10385650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 581 | Open in IMG/M |
3300028759|Ga0302224_10074617 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300028759|Ga0302224_10160347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 883 | Open in IMG/M |
3300028906|Ga0308309_10378869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1210 | Open in IMG/M |
3300029636|Ga0222749_10388088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 738 | Open in IMG/M |
3300029916|Ga0302148_1041173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1335 | Open in IMG/M |
3300029943|Ga0311340_10855802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 760 | Open in IMG/M |
3300029993|Ga0302304_10023818 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
3300029999|Ga0311339_11268404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 670 | Open in IMG/M |
3300029999|Ga0311339_11945092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 505 | Open in IMG/M |
3300030007|Ga0311338_11109775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 758 | Open in IMG/M |
3300030007|Ga0311338_11408305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 648 | Open in IMG/M |
3300030020|Ga0311344_10694123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 850 | Open in IMG/M |
3300030056|Ga0302181_10401355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 591 | Open in IMG/M |
3300030058|Ga0302179_10279712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 735 | Open in IMG/M |
3300030506|Ga0302194_10310772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 624 | Open in IMG/M |
3300030524|Ga0311357_10676922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 940 | Open in IMG/M |
3300030549|Ga0210257_10665297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 509 | Open in IMG/M |
3300030580|Ga0311355_10320789 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300030583|Ga0210262_1193340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 567 | Open in IMG/M |
3300030618|Ga0311354_11571772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 579 | Open in IMG/M |
3300030646|Ga0302316_10226488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 764 | Open in IMG/M |
3300030741|Ga0265459_12146095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 675 | Open in IMG/M |
3300030743|Ga0265461_11528638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 724 | Open in IMG/M |
3300030862|Ga0265753_1077672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 638 | Open in IMG/M |
3300031057|Ga0170834_111945972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 693 | Open in IMG/M |
3300031231|Ga0170824_107880611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 693 | Open in IMG/M |
3300031234|Ga0302325_11985969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 718 | Open in IMG/M |
3300031234|Ga0302325_12573160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 605 | Open in IMG/M |
3300031236|Ga0302324_100065549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6395 | Open in IMG/M |
3300031247|Ga0265340_10378937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 624 | Open in IMG/M |
3300031469|Ga0170819_17004287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 772 | Open in IMG/M |
3300031525|Ga0302326_11952887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 760 | Open in IMG/M |
3300031546|Ga0318538_10331921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 820 | Open in IMG/M |
3300031573|Ga0310915_10950004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 601 | Open in IMG/M |
3300031718|Ga0307474_10460096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 995 | Open in IMG/M |
3300031718|Ga0307474_10587313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 877 | Open in IMG/M |
3300031719|Ga0306917_10315969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1209 | Open in IMG/M |
3300031720|Ga0307469_10570964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1005 | Open in IMG/M |
3300031747|Ga0318502_10234848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1067 | Open in IMG/M |
3300031753|Ga0307477_10680104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 689 | Open in IMG/M |
3300031781|Ga0318547_10485457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 762 | Open in IMG/M |
3300031808|Ga0316037_117924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300031823|Ga0307478_10632697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 895 | Open in IMG/M |
3300031823|Ga0307478_10758700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 812 | Open in IMG/M |
3300031823|Ga0307478_10887992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 746 | Open in IMG/M |
3300031823|Ga0307478_10944829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 721 | Open in IMG/M |
3300031859|Ga0318527_10085857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1279 | Open in IMG/M |
3300031894|Ga0318522_10238427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 689 | Open in IMG/M |
3300031897|Ga0318520_10372633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 869 | Open in IMG/M |
3300031962|Ga0307479_10479148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1228 | Open in IMG/M |
3300031996|Ga0308176_11203634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 803 | Open in IMG/M |
3300032001|Ga0306922_10865479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 941 | Open in IMG/M |
3300032072|Ga0326631_113439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 565 | Open in IMG/M |
3300032076|Ga0306924_11685015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 665 | Open in IMG/M |
3300032120|Ga0316053_115192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 571 | Open in IMG/M |
3300032180|Ga0307471_102162347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 700 | Open in IMG/M |
3300032180|Ga0307471_102712063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 628 | Open in IMG/M |
3300032180|Ga0307471_103629377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 546 | Open in IMG/M |
3300032205|Ga0307472_101917985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 591 | Open in IMG/M |
3300032421|Ga0310812_10226248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 818 | Open in IMG/M |
3300032515|Ga0348332_12859016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 822 | Open in IMG/M |
3300032783|Ga0335079_11354957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 708 | Open in IMG/M |
3300032805|Ga0335078_10886717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1074 | Open in IMG/M |
3300032805|Ga0335078_11796232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 667 | Open in IMG/M |
3300032892|Ga0335081_12728549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 503 | Open in IMG/M |
3300032955|Ga0335076_11662931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 527 | Open in IMG/M |
3300033402|Ga0326728_10164507 | All Organisms → cellular organisms → Bacteria | 2354 | Open in IMG/M |
3300033500|Ga0326730_1089937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 573 | Open in IMG/M |
3300034090|Ga0326723_0288782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 735 | Open in IMG/M |
3300034199|Ga0370514_115856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 686 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.00% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.33% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.33% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.33% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.33% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.00% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.67% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.33% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.67% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.33% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.33% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.67% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.67% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.67% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.33% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.33% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.33% |
Hydrocarbon Resource Environments | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.33% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.33% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.33% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.33% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.33% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.33% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.33% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.33% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.33% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.33% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.33% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.33% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.33% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001416 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002853 | PDIso9.ppmwps2 | Environmental | Open in IMG/M |
3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004121 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004472 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004594 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004604 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 31 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004605 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004969 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004972 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011060 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030549 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030583 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031808 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033500 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fraction | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_101159921 | 3300000597 | Forest Soil | VVIQCRGRVVRTDEPASGSKSPEARGVACVIDSYEFVRNT* |
JGI12704J13340_10123322 | 3300001170 | Forest Soil | RGRVVRTDEPNAAAGSGDNRGVACVIDSYEFVRNS* |
JGI12269J14319_101220603 | 3300001356 | Peatlands Soil | IQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNS* |
JGI12269J14319_102238921 | 3300001356 | Peatlands Soil | QCRGRVVRTDEPAAGSSSTPAEARGVACVIDSYDFVRHS* |
JGI20176J14865_1022981 | 3300001416 | Arctic Peat Soil | EMTGGQENVTIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRNS* |
JGI12053J15887_103990182 | 3300001661 | Forest Soil | GAKEGVVIQCRGRVVRTDEPDGGSPTEARGVACVIDSYDFVRH* |
JGI12627J18819_103476752 | 3300001867 | Forest Soil | MTGGQENVTIQCKGRVVRADETGQGGEGRGVACVIDSYEFTRNS* |
draft_10175291 | 3300002853 | Hydrocarbon Resource Environments | ENVTVQCKVRVVRTDEPATGGSSNPAEARGVACVIDSYDFVRHS* |
rootH2_102328472 | 3300003320 | Sugarcane Root And Bulk Soil | MTGAKDNVIIQCRGRVVRADEASGDKDSRGVACVIDSYDFVRHS* |
Ga0063454_1004387671 | 3300004081 | Soil | MTGAKDNVIIQCRGRVVRTDEPAGSSPTEARGVACVIDSYDFVRHT* |
Ga0062387_1001616521 | 3300004091 | Bog Forest Soil | AQESVVIQCKGRVVRTDPTGSSTDGKGVACVIDSYEFVRN* |
Ga0062389_1001753221 | 3300004092 | Bog Forest Soil | EPVLVKCKGRVVRKDEPDGNSASDTRGVACVIDSYDFVRRS* |
Ga0058891_15543241 | 3300004104 | Forest Soil | GAKENVTVQCKGRVVRTDEPATGGSSPAEARGVACVIDSYDFVRHP* |
Ga0058882_10007242 | 3300004121 | Forest Soil | QENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNS* |
Ga0063455_1009481242 | 3300004153 | Soil | PEMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDTYEFVRNS* |
Ga0068974_13861171 | 3300004472 | Peatlands Soil | AKENVTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRHT* |
Ga0068976_12359692 | 3300004594 | Peatlands Soil | VIQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS* |
Ga0068943_12865941 | 3300004604 | Peatlands Soil | DVVIQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS* |
Ga0068952_13145752 | 3300004605 | Peatlands Soil | VTGAKENVTVQCKGRVVRTDEPATGGSSSPAEARGVACVIDSYDFVRHT* |
Ga0062591_1018540051 | 3300004643 | Soil | GAKENVVIQCRGRVVRTDEPAGSKPAEGRGVACVIDSYEFVRNS* |
Ga0072327_12726992 | 3300004969 | Peatlands Soil | GKEDVVIQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS* |
Ga0072325_13210871 | 3300004972 | Peatlands Soil | EDVVIQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS* |
Ga0066674_103087862 | 3300005166 | Soil | AKENVVVKCQGRVVRTDQPAGAGQDSRGVACVIDSYDFVRR* |
Ga0066688_106737191 | 3300005178 | Soil | ITLPPDVTGGKEDVIIQCRGRVIRTDEPPASSPAEARGVACVIDTYEFVRNS* |
Ga0065715_100973271 | 3300005293 | Miscanthus Rhizosphere | ENVVIQCRGRVVRTDEPPSGSTPDEGRGVACVIDSYEFVRNS* |
Ga0070709_109213271 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TGAKEGVVIQCRGRVVRTDEPDGGSPTEARGVACVIDSYDFVRH* |
Ga0070714_1021511152 | 3300005435 | Agricultural Soil | PPEVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS* |
Ga0070707_1000464775 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EMTGGTENVTIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRNS* |
Ga0070741_100353601 | 3300005529 | Surface Soil | GGQENVTIQCKGRVVRADETGGGGEGRGVACVIDTYEFVRNS* |
Ga0070731_108833491 | 3300005538 | Surface Soil | KGRVVRTDEPASGGSSTSAEARGVACVIDSYDFVRHP* |
Ga0070732_103197811 | 3300005542 | Surface Soil | PEVTGAKENVTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRHT* |
Ga0070732_105237072 | 3300005542 | Surface Soil | GQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0070696_1015730001 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ENVVIQCRGRVVRTDEPAGSKPAEGRGVACVIDSYEFVRNS* |
Ga0066704_106186572 | 3300005557 | Soil | NVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS* |
Ga0070761_110886502 | 3300005591 | Soil | KENVTVQCKGRVVRTDEPATGGSTSPAEARGVACVIDSYDFVRHT* |
Ga0066903_1070024301 | 3300005764 | Tropical Forest Soil | QCRGRVVRTDEPVTNNPKQARGVACVIDSYDFVRRE* |
Ga0070766_112968052 | 3300005921 | Soil | PEMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0066789_100718471 | 3300005994 | Soil | AKDNVVVRCRGRVVRTDEPGGAPAESRGVACVIDSYDFVRHP* |
Ga0070717_115457622 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0066651_107779361 | 3300006031 | Soil | VVVKCQGRVVRTDQPAGAGQDSRGVACVIDSYDFVRR* |
Ga0075023_1003071692 | 3300006041 | Watersheds | PEVTGGKENVVIQCRGRVVRTDESSTDPEGTRGVACVIDSYEFVRNS* |
Ga0075023_1004459891 | 3300006041 | Watersheds | PEVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS* |
Ga0066652_1018535782 | 3300006046 | Soil | VIQCRGRVVRTDEPAAGAAPGDNRGVACVIDSYEFVRNS* |
Ga0075029_1008930692 | 3300006052 | Watersheds | VIQCRGRVVRTDEPSAGSAPADNRGVACVIDSYEFVRNS* |
Ga0075029_1011578041 | 3300006052 | Watersheds | VIQCRGRVVRTDEPSAGGASADNRGVACVIDSYEFVRNS* |
Ga0075019_104243592 | 3300006086 | Watersheds | IQCRGRVVRTDEPNAGTAQGESRGVACVIDSYEFVRNS* |
Ga0070715_110366112 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TGGQEHVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRKS* |
Ga0075018_103441782 | 3300006172 | Watersheds | TIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0070765_1014872871 | 3300006176 | Soil | MTGAKEGVVIQCRGRVVRTDEPTGGPSEARGVACVIDSYDFVRH* |
Ga0079222_122175901 | 3300006755 | Agricultural Soil | TGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0066659_101413491 | 3300006797 | Soil | TGGTENVKIQCKGRVVRTDESGKADEGRGVACVIDSYEFIRNS* |
Ga0066660_104888293 | 3300006800 | Soil | IIQCRGRVIRTDEPPASTPAEARGVACVIDTYEFVRNS* |
Ga0066660_109863462 | 3300006800 | Soil | QCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0079221_108948332 | 3300006804 | Agricultural Soil | GAKEGVAIQCRGRVVRTDEPAGSPTEARGVACVIDSYDFVRH* |
Ga0075426_112649421 | 3300006903 | Populus Rhizosphere | QENVTIQCKGRVVRADETGEGGEGRGVACVIDTYEFVRNS* |
Ga0099795_106278701 | 3300007788 | Vadose Zone Soil | EDVVIQCRGRVVRTDEPAGGAASGDNRGVACVIDSYEFVRNS* |
Ga0099829_103233091 | 3300009038 | Vadose Zone Soil | QCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS* |
Ga0099829_109225401 | 3300009038 | Vadose Zone Soil | CRGRVVRTDDPAAGSSPTEARGVACVIDSYDFVRH* |
Ga0099828_104418941 | 3300009089 | Vadose Zone Soil | CRGRVVRTDEPASGGSAEARGVACVIDSYEFVRNS* |
Ga0099827_101299154 | 3300009090 | Vadose Zone Soil | IIQCHGRVVRTDDPASGSSPTGARGVACVIDSYDFVRH* |
Ga0105240_102532133 | 3300009093 | Corn Rhizosphere | GAKEGVVIQCRGRVVRTDEPAGGPTEARGVACVIDSYDFVRH* |
Ga0105245_105037682 | 3300009098 | Miscanthus Rhizosphere | VVIQCRGRVVRTDEPAGGPTEARGVACVIDSYDFVRH* |
Ga0105243_128087371 | 3300009148 | Miscanthus Rhizosphere | KDNVIIQCRGRVVRADEASGSSDSRGVACVIDSYDFVRHS* |
Ga0116222_10091456 | 3300009521 | Peatlands Soil | QENVVIQCKGRVVRTDPTGGSADGKGVACVIDSYEFVRN* |
Ga0116225_13557062 | 3300009524 | Peatlands Soil | GQENVVIQCKGRVVRSDPTGASEEGKGVACVIDSYEFVRNS* |
Ga0116116_10119331 | 3300009621 | Peatland | QENVVIQCKGRVVRTDPTGASADGKGVACVIDSYEFVRNA* |
Ga0116119_11155802 | 3300009629 | Peatland | RGRVVRTDEPNGSAESGDSRGVACVIDSYEFVRNG* |
Ga0116102_10192034 | 3300009632 | Peatland | QENVVIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS* |
Ga0116102_10901582 | 3300009632 | Peatland | CRGRVVRTDEPDASTEPGDSRGVACVIDSYEFVRNS* |
Ga0116124_11359012 | 3300009634 | Peatland | IQCRGRVVRTDEPNASDESGDSRGVACVIDSYEFVRNS* |
Ga0116117_10401863 | 3300009635 | Peatland | PEMTGGQENVTIQCKGRVVRADETGKDGEGRGVACVIDSYEFVRK* |
Ga0116122_11533362 | 3300009639 | Peatland | VIHCRGRVVRTDEPNAGAASGDNRGVACVIDSYEFVRNS* |
Ga0116215_10791791 | 3300009672 | Peatlands Soil | KGRVVRTDEPATGGSSSPAEARGVACVIDSYDFVRHT* |
Ga0126374_107157721 | 3300009792 | Tropical Forest Soil | GGQENVTIQCKGTVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0126374_107321261 | 3300009792 | Tropical Forest Soil | AKENVVVQCRGRVVRTDEPSAKAGDSRGVACVIDSYDFVRH* |
Ga0116219_106610441 | 3300009824 | Peatlands Soil | QENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0116223_100146441 | 3300009839 | Peatlands Soil | NVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0116223_105144161 | 3300009839 | Peatlands Soil | KENVTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRHP* |
Ga0126384_122752191 | 3300010046 | Tropical Forest Soil | EVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS* |
Ga0126382_116541602 | 3300010047 | Tropical Forest Soil | GAKDNVIIQCRGRVVRADEASGDKDSRGVACVIDSYDFVRHS* |
Ga0126373_103142533 | 3300010048 | Tropical Forest Soil | VVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS* |
Ga0126322_11738981 | 3300010143 | Soil | IQGRGRVVRTDNPPPGRNGENYRGVACVIDSYEFVRNT* |
Ga0126322_12024202 | 3300010143 | Soil | CRGRVVRTDEPASGSKSADARGVACVIDSYEFVRNS* |
Ga0134088_105447802 | 3300010304 | Grasslands Soil | PDVTGGKEDVIIQCRGRVIRTDEPPASSPAEARGVACVIDTYEFVRNS* |
Ga0074046_100823363 | 3300010339 | Bog Forest Soil | AKDNVIVQCRGRVVRTDEPAAGGKTTEARGVACVIDSYDFVRHS* |
Ga0074044_100864491 | 3300010343 | Bog Forest Soil | QENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNT* |
Ga0074044_101793031 | 3300010343 | Bog Forest Soil | MTGGQENVTIQCKGRVVRADATGSGGEGRGVACVIDSYEFVRNS* |
Ga0126379_101683921 | 3300010366 | Tropical Forest Soil | KDTATTENVKIQCKGRVVRTDESGKGDEGRGVACVIDSYEFIRNS* |
Ga0126381_1006067471 | 3300010376 | Tropical Forest Soil | IQCRGRVVRTDESGQTSGSRGVACVIDSYEFVRNS* |
Ga0136449_1031752281 | 3300010379 | Peatlands Soil | IRCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRQ* |
Ga0126383_102689061 | 3300010398 | Tropical Forest Soil | CRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS* |
Ga0126383_115618741 | 3300010398 | Tropical Forest Soil | KGRVVRTDEPATGGASAEARGVACVIDSYDFIRQP* |
Ga0134121_131483782 | 3300010401 | Terrestrial Soil | RGRVVRTDTPPPGHNGDANYRGVACVIDSYEFVRNT* |
Ga0126351_10442671 | 3300010860 | Boreal Forest Soil | DVTGGQENVVIRCKGRVVRTDPTGASPDGKGVACVIDSYEFVRNT* |
Ga0138583_10206692 | 3300011060 | Peatlands Soil | VTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRQT* |
Ga0138568_10649801 | 3300011080 | Peatlands Soil | GRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS* |
Ga0138581_11806091 | 3300011085 | Peatlands Soil | QCKGRVVRSDETGEGGEGRGVACVIDTYEFVRNS* |
Ga0150983_111751372 | 3300011120 | Forest Soil | DMTGGTENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0150983_117602132 | 3300011120 | Forest Soil | VTIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK* |
Ga0150983_124560772 | 3300011120 | Forest Soil | PEVTGGQENVVIACKGRVVRTDPTGASPDGKGVACVIDSYEFVRNS* |
Ga0150983_140404932 | 3300011120 | Forest Soil | PEVTGAKENVTVQCKGRVVRTDEPASGGSSASAEARGVACVIDSYDFVRHP* |
Ga0150983_150767232 | 3300011120 | Forest Soil | VTGGQENVTIQCKGRVVRTDPTGTSPDGKGVACVIDSYEFVRKS* |
Ga0137388_102547861 | 3300012189 | Vadose Zone Soil | VIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS* |
Ga0137399_103080831 | 3300012203 | Vadose Zone Soil | GGKENVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS* |
Ga0137380_117496602 | 3300012206 | Vadose Zone Soil | QCRGRVVRTDEPAAGAAPGDNRGVACVIDSYEFVRNS* |
Ga0137378_113079431 | 3300012210 | Vadose Zone Soil | PPEMTGAKDNVIIQCRGRVVRTDEPAGSSPTEARGVACVIDSYDFVRHT* |
Ga0137385_108475861 | 3300012359 | Vadose Zone Soil | GGPENVTIQCKERVVRADEPGEGGEGRGVACMIDSYEFVRNS* |
Ga0137360_100374231 | 3300012361 | Vadose Zone Soil | MTGAKEGVVIQCRGRVVRTDEPTGGPTEARGVACVIDSYDFVRH* |
Ga0134060_13003731 | 3300012410 | Grasslands Soil | ITLPPDVTGGKEDVIIQCRGRVIRTDEPPASTPAEARGVACVIDTYEFVRNS* |
Ga0137413_109597141 | 3300012924 | Vadose Zone Soil | RGRVVRTDEPAAGAAPGDNRGVACVIDSYEFVRNS* |
Ga0137404_102040801 | 3300012929 | Vadose Zone Soil | VVIQCRGRVVRADEASGSKDARGVACVIDSYDFVRHS* |
Ga0126369_100061011 | 3300012971 | Tropical Forest Soil | NVVIQCRGRVVRTDEPAGSSTEARGVACVIDSYDFVRHN* |
Ga0126369_125508671 | 3300012971 | Tropical Forest Soil | VTIQCKGRVVRSDESGEGGEGRGVACVIDSYEFVRNS* |
Ga0181527_10757383 | 3300014153 | Bog | RGRVVRTDEPDASAETGDSRGVACVIDSYEFVRNS* |
Ga0181527_11990472 | 3300014153 | Bog | KDNVVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS* |
Ga0181530_105384441 | 3300014159 | Bog | CRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS* |
Ga0181517_103850262 | 3300014160 | Bog | QCRGRVVRTDEPHDGAGSGDNRGVACVIDSYEFVRNS* |
Ga0181523_105891951 | 3300014165 | Bog | DVVIQCRGRVVRTDEPNTSADSGDSRGVACVIDSYEFVRNS* |
Ga0181531_101799731 | 3300014169 | Bog | IQCKGRVVRADATGEGGEGRGVACVIDSYEFVRNS* |
Ga0181537_106882511 | 3300014201 | Bog | KEPVLVQCKGRVVRTDEPAAGTEARGVACVIDSYDFVRHE* |
Ga0182018_106030922 | 3300014489 | Palsa | GGQENVVIQCKGRVVRTDQTGSNDEGRGVACVIDSYEFVRNS* |
Ga0157379_105395581 | 3300014968 | Switchgrass Rhizosphere | MTGAKEGVVIQCRGRVVRTDEPAGGPTEARGVACVIDSYDFVRH* |
Ga0157376_126849571 | 3300014969 | Miscanthus Rhizosphere | QENVVIACRGRVVRTDDSKADAAGTRGVACVIDSYEFVRNS* |
Ga0137418_107579931 | 3300015241 | Vadose Zone Soil | GRENVTIQCKGRVVRSDPTGSSPDGKGVACVIDSYEFVRKS* |
Ga0137412_102117191 | 3300015242 | Vadose Zone Soil | GGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS* |
Ga0137409_113607381 | 3300015245 | Vadose Zone Soil | GTENVKIQCKGRVVRTDESGKGDEGRGVACVIDSYEFIRNS* |
Ga0137403_110220362 | 3300015264 | Vadose Zone Soil | KIQCKGRVVRADETGSGGEGRGVACVIDTYEFVRNS* |
Ga0181507_13529692 | 3300016705 | Peatland | GGQENVTIQCKGRVVRADATGEGGEGRGVACVIDSYEFVRNS |
Ga0187802_104663631 | 3300017822 | Freshwater Sediment | VVVQCRGRVVRTDEPGGSNAESRGVACVIDSYDFIRHP |
Ga0187820_13025901 | 3300017924 | Freshwater Sediment | IVQCRGRVVRTDEPAAGSSSTPAEARGVACVIDSYDFVRHS |
Ga0187856_10749381 | 3300017925 | Peatland | KDNVVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS |
Ga0187824_103682941 | 3300017927 | Freshwater Sediment | KMTGGPENVTIQCKGRVVRSDETGTGGEGRGVACVIDSYEFVRK |
Ga0187806_13651961 | 3300017928 | Freshwater Sediment | ENVIVQCRGRVVRTDEPAAGGATEARGVACVIDSYDFIRHD |
Ga0187825_100861563 | 3300017930 | Freshwater Sediment | QGRGRVVRTDTPPPGHNGDANYRGVACVIDSYEFVRNT |
Ga0187801_101289431 | 3300017933 | Freshwater Sediment | IQCRGRVVRTDEPNASAGSGDSRGVACVIDSYEFVRNS |
Ga0187848_103300802 | 3300017935 | Peatland | VVIQCRGRVVRTDEPNGSAGSGDNRGVACVIDSYEFVRNS |
Ga0187821_103072381 | 3300017936 | Freshwater Sediment | PEHVTIQCKGRVVRSDETGTGGEGRGVACVIDSYEFVRKS |
Ga0187854_102632831 | 3300017938 | Peatland | GQENVIIQCKGRVVRTDPTGSSAEGKGVACVIDSYEFVRNS |
Ga0187817_101083151 | 3300017955 | Freshwater Sediment | GGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0187817_103311472 | 3300017955 | Freshwater Sediment | VVIQCRGRVVRTDEPSAGSASADNRGVACVIDSYEFVRNS |
Ga0187817_103938622 | 3300017955 | Freshwater Sediment | KENVIVQCRGRVVRTDEPAAGGATEARGVACVIDSYDFIRHD |
Ga0187778_108692391 | 3300017961 | Tropical Peatland | PENVTIQCKGRVVRSDPTGSGGEGRGVACVIDSYEFVGNS |
Ga0187781_100763251 | 3300017972 | Tropical Peatland | TIQCKGRVVRTDDTGKGGEGRGVACVIDSYEFVRNS |
Ga0187781_101768022 | 3300017972 | Tropical Peatland | PEVTGAKENVIVQCRGRVVRTDEPAAGGKTTEARGVACVIDSYDFVRHS |
Ga0181520_111500682 | 3300017988 | Bog | QCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS |
Ga0187767_103761761 | 3300017999 | Tropical Peatland | IVQCRGRVVRTDEPVTNNPKQARGVACVIDSYDFVRRE |
Ga0187880_10902161 | 3300018016 | Peatland | VVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS |
Ga0187880_13645392 | 3300018016 | Peatland | QENVVIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS |
Ga0187874_101204683 | 3300018019 | Peatland | CRGRVVRTDEPDASTEPGDSRGVACVIDSYEFVRNS |
Ga0187863_1000432611 | 3300018034 | Peatland | PDVTGGKDNVVIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS |
Ga0187863_101225631 | 3300018034 | Peatland | KENVTVQCKGRVVRTDEPATGGSSSPAEARGVACVIDSYDFVRHP |
Ga0187887_109326421 | 3300018043 | Peatland | CRGRVVRTDEPTGGVNSTEARGVACVIDSYDFVRHS |
Ga0187890_102141951 | 3300018044 | Peatland | VIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS |
Ga0184619_103280562 | 3300018061 | Groundwater Sediment | CKGRVVRSDDPASGGSGGEYRGVACVIDSYDFVRR |
Ga0187784_109881692 | 3300018062 | Tropical Peatland | QENVTIQCKGRVVRADESGKGGEGRGVACVIDSYEFVRNS |
Ga0187772_101998573 | 3300018085 | Tropical Peatland | GGQENVTIQCKGRVVRSDETGAGGEGRGVACVIDSYEFVRNTDH |
Ga0187771_108417371 | 3300018088 | Tropical Peatland | VIVQCRGRVVRTDEPASGNAKEPRGVACVIDSYDFLRRE |
Ga0187770_100146561 | 3300018090 | Tropical Peatland | DNVIVQCRGRVVRTDEPASGGKTTEARGVACVIDSYDFVRHS |
Ga0187770_110774801 | 3300018090 | Tropical Peatland | DVVIQCRGRVVRTDEPHGSAAPTEIRGVACVIDSYEFVRNS |
Ga0066667_102545431 | 3300018433 | Grasslands Soil | TGGKEDVIIQCRGRVIRTDEPPASTPAEARGVACVIDTYEFVRNS |
Ga0181504_13686672 | 3300019258 | Peatland | TIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK |
Ga0181512_11944672 | 3300019270 | Peatland | DVTGGRENVVIACKGRVVRADPSGASEDGRGVACVIDSYEFVRNG |
Ga0187800_14967482 | 3300019278 | Peatland | QENVTIQCKGRVVRTDETGEGGEGRGVACVIDSYEFVRNS |
Ga0187797_14054822 | 3300019284 | Peatland | MTGGQENVTIQCKGRVVRADETGGGGEGRGVACVIDTYEFVRNT |
Ga0182025_13218735 | 3300019786 | Permafrost | MTGGQENVTIQCKGRVVRADETGKGGEGRGVACVIDSYEFVRNS |
Ga0193715_10505202 | 3300019878 | Soil | IHCKGRVVRSDDPASGGSGGESRGVACVIDSYDFVRR |
Ga0193723_10336681 | 3300019879 | Soil | QCRGRVVRTDESSIDPDGTRGVACVIDSYEFVRNS |
Ga0193729_10343534 | 3300019887 | Soil | PERTGAKEGVVIQCRGRVVRTDEPTGGPTEARGVACVIDSYDFVRH |
Ga0193735_11767452 | 3300020006 | Soil | NVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS |
Ga0215015_101233641 | 3300021046 | Soil | NVTLQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS |
Ga0179596_106217992 | 3300021086 | Vadose Zone Soil | GKEDVVIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS |
Ga0210408_114064982 | 3300021178 | Soil | VVIQCRGRVVRTDESKVDPDGTRGVACVIDSYEFVRNS |
Ga0210396_114266332 | 3300021180 | Soil | EMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRKS |
Ga0210397_108986262 | 3300021403 | Soil | KEGVVIQCRGRVVRTDEPAGSSPTEARGVACVIDSYDFVRH |
Ga0210397_115574892 | 3300021403 | Soil | PEMTGGTENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRS |
Ga0210389_102883621 | 3300021404 | Soil | EMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0210386_113426591 | 3300021406 | Soil | QEHVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNE |
Ga0210383_117933432 | 3300021407 | Soil | CKGRVVRTDEPATGGSSNPAEARGVACVIDSYDFVRHT |
Ga0210409_109734272 | 3300021559 | Soil | DHVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRKS |
Ga0210409_112748561 | 3300021559 | Soil | TIQCKGRVVRTDPTGSSPDGKGVACVIDSYEFVRKS |
Ga0210409_114956241 | 3300021559 | Soil | EVTGAKEVVVVQCKGRVVRKDEPAGNSATDTRGVACVIDSYDFVRRS |
Ga0210409_117187592 | 3300021559 | Soil | TENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0126371_100117998 | 3300021560 | Tropical Forest Soil | QENVTIQCKGRVVRADESGEGGEGRGVACVIDSYEFVRNS |
Ga0213853_101249361 | 3300021861 | Watersheds | GAKEGVVIQCRGRVVRTDEPTGSSPTEARGVACVIDSYDFVRH |
Ga0242652_10271241 | 3300022510 | Soil | ENVTVQCKGRVVRTDEPATGGSSASAEARGVACVIDSYDFVRHP |
Ga0242663_10853881 | 3300022523 | Soil | IQCRGRVVRTDEPNASAGSGDNRGVACVIDSYEFVRNS |
Ga0242660_11822361 | 3300022531 | Soil | EMTGGQENVTIQCKGRVVRADATGTGGEGRGVACVIDSYEFVRNS |
Ga0242660_11939182 | 3300022531 | Soil | ENVTIQCKGRVVRTDPTGSSPDGKGVACVIDSYEFVRKS |
Ga0242653_10468522 | 3300022712 | Soil | KENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS |
Ga0242661_11570602 | 3300022717 | Soil | GKDDVVIQCRGRVVRTDEPNTSAESGDSRGVACVIDSYEFVRNS |
Ga0242675_10401011 | 3300022718 | Soil | QCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS |
Ga0242665_101130181 | 3300022724 | Soil | GGKENVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS |
Ga0224547_10095062 | 3300023255 | Soil | SQENVKIACKGRVVRSDPTGASPDGKGVACVIDSYEFVRNS |
Ga0228598_10983541 | 3300024227 | Rhizosphere | TVQCKGRVVRTDEPATGGSSSPAEARGVACVIDSYDFVRHT |
Ga0208848_10627532 | 3300025509 | Arctic Peat Soil | TIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRNS |
Ga0208714_11039291 | 3300025527 | Arctic Peat Soil | PEMTGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0207685_103832652 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | AKEGVVIQCRGRVVRTDEPDGGSPTEARGVACVIDSYDFVRH |
Ga0207646_106817252 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EGVVIQCRGRVVRTDEPTGGPTEARGVACVIDSYDFVRH |
Ga0207664_102723473 | 3300025929 | Agricultural Soil | PPEVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS |
Ga0207709_114805491 | 3300025935 | Miscanthus Rhizosphere | DNVIIQCRGRVVRADEASGSSDSRGVACVIDSYDFVRHS |
Ga0207689_105898771 | 3300025942 | Miscanthus Rhizosphere | AKENVVIQCRGRVVRTDEPPSGSTPDEGRGVACVIDSYEFVRNS |
Ga0207651_117632882 | 3300025960 | Switchgrass Rhizosphere | VTGAKDSVIIQCRGRVVRTDEAGSAEGPADSRGVACVIDSYDFVRHS |
Ga0207703_114146951 | 3300026035 | Switchgrass Rhizosphere | AKEGVVIQCRGRVVRTDEPDGGPADARGVACVIDSYDFVRH |
Ga0209237_10924713 | 3300026297 | Grasslands Soil | IIQCHGRVVRTDDPASGSSPTGARGVACVIDSYDFVRH |
Ga0209687_12594012 | 3300026322 | Soil | CRGRVIRTDEPASGGSSAEGRGVACVIDSYEFVRNS |
Ga0209377_10472064 | 3300026334 | Soil | HCKGRVVRSDDPASSSGGGDSRGVACVIDSYDFVRR |
Ga0257173_10303621 | 3300026360 | Soil | KEGVVIQCRGRVVRTDEPTGSPTEARGVACVIDSYDFVRH |
Ga0257156_10217831 | 3300026498 | Soil | IQCRGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS |
Ga0209161_102491212 | 3300026548 | Soil | EVTGGKENVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS |
Ga0208603_10531012 | 3300027109 | Forest Soil | PPDVTGGQQNVTIQCKGRVVRSDPTGSSPDGKGVACVIDSYEFVRKS |
Ga0207780_10093484 | 3300027313 | Tropical Forest Soil | TGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0209332_10384952 | 3300027439 | Forest Soil | RGRVVRTDEPNASAESGDNRGVACVIDSYEFVRNS |
Ga0208993_10868761 | 3300027480 | Forest Soil | EMTGGTENVTIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRNS |
Ga0209527_11106742 | 3300027583 | Forest Soil | EDVVIQCRGRVVRTDEPNTSADSGESRGVACVIDSYEFVRNS |
Ga0209420_11795532 | 3300027648 | Forest Soil | EDVVIQCRGRVVRTDEPNTSAESGDNRGVACVIDSYEFVRNG |
Ga0209118_12188772 | 3300027674 | Forest Soil | PEVTGAKEPVMVKCIGRVVRTDEPASGGKSSEARGVACVIDSYDFVRHE |
Ga0209446_11788241 | 3300027698 | Bog Forest Soil | NVTVQCKGRVVRTDEPATGSSSTPAEARGVACVIDSYDFVRHP |
Ga0209908_101462682 | 3300027745 | Thawing Permafrost | GAKESVTVQCRGRVVRTDEPAGASSAESRGVACVIDSYDFVRHS |
Ga0209655_100355923 | 3300027767 | Bog Forest Soil | VIQCRGRVVRTDEPNASTEPGQSRGVACVIDSYEFVRNS |
Ga0209074_101215722 | 3300027787 | Agricultural Soil | VTIQGRGRVVRTDNPPPGRNGENYRGVACVIDSYEFVRNT |
Ga0209060_104100752 | 3300027826 | Surface Soil | KENVIVQCRGRVVRTDEPTSGKGEGRGVACVIDSYDFVRHE |
Ga0209580_106716631 | 3300027842 | Surface Soil | GQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVSNS |
Ga0209579_100497114 | 3300027869 | Surface Soil | PEMTGGQENVTIQCKGRVVRADETGQGGEGRGVACVIDSYEFTRNS |
Ga0209275_103215821 | 3300027884 | Soil | LPPDVTGGQENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRTS |
Ga0209067_103941961 | 3300027898 | Watersheds | RGRVVRTDEPTGGVNSREARGVACVIDSYDFIRHS |
Ga0209698_100278795 | 3300027911 | Watersheds | IQCKGRVVRADEAGKGGEGRGVACVIDTYEFVRNS |
Ga0209698_105291231 | 3300027911 | Watersheds | PEVTGGKENVVIQCRGRVVRTDESSTDPDGTRGVACVIDSYEFVRNS |
Ga0209698_108478692 | 3300027911 | Watersheds | ENVTIHCNGRVVRTDEPAGKDSDNRGVACVIDSYEFVRNS |
Ga0265351_10012803 | 3300028020 | Soil | GQENVTIQCKGRVVRADATGTGGEGRGVACVIDSYEFVRS |
Ga0302267_103856501 | 3300028745 | Bog | GGQENVVIQCKGRVVRTDPTGASADGKGVACVIDSYEFVRNA |
Ga0302224_100746171 | 3300028759 | Palsa | PDVTGGQESVVIQCKGRVVRTDPTGASAEGKGVACVIDSYEFVRNS |
Ga0302224_101603471 | 3300028759 | Palsa | DVTGGQENVTIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK |
Ga0308309_103788691 | 3300028906 | Soil | GGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFIRNS |
Ga0222749_103880881 | 3300029636 | Soil | RVVRTDEPATGGSTSPAEARGVACVIDSYDFVRQS |
Ga0302148_10411733 | 3300029916 | Bog | GKDDVVIQCRGRVVRTDEPKGSAGSGDDLGVACVIDSYEFVRNS |
Ga0311340_108558022 | 3300029943 | Palsa | IQCKGRVVRTDPTGASADGKGVACVIDSYEFVRNS |
Ga0302304_100238181 | 3300029993 | Palsa | VVIQCKGRVVRTDPTGASADGKGVACVIDSYEFVRNS |
Ga0311339_112684041 | 3300029999 | Palsa | ENVTVQCKGRVVRTDEPATGGSSTPAEARGVACVIDSYDFVRHP |
Ga0311339_119450921 | 3300029999 | Palsa | NVTIQCKGRVVRADETGKDGEGRGVACVIDSYEFVRK |
Ga0311338_111097751 | 3300030007 | Palsa | TGGQEHVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0311338_114083052 | 3300030007 | Palsa | IQCRGRVVRTDEPNASTEPGDHRGVACVIDSYEFVRNS |
Ga0311344_106941232 | 3300030020 | Bog | PDVTGGQENVTIQCKGRVVRADPTGSSPDGKGVACVIDSYEFVRK |
Ga0302181_104013552 | 3300030056 | Palsa | GKDSVVIQCRGRVVRTDEPHASTEPGDSRGVACVIDSYEFVRNS |
Ga0302179_102797121 | 3300030058 | Palsa | VVTGGSESVTIQCKGRVVRTDPTGTSPDGKGVACVIDSYEFVRK |
Ga0302194_103107722 | 3300030506 | Bog | ENVTIQCKGRVVRADPTGSSPDGKGVACVIDSYEFVRK |
Ga0311357_106769221 | 3300030524 | Palsa | QCRGRVVRTDEPNGSAESGENRGVACVIDSYEFVRNS |
Ga0210257_106652972 | 3300030549 | Soil | PDVTGGQENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNS |
Ga0311355_103207893 | 3300030580 | Palsa | EPVTIQCKGRVVRSDETGEGGEGRGVACVIDSYEFVRKS |
Ga0210262_11933402 | 3300030583 | Soil | QENVVIQCKGRVVRADPTGTSEEGRGVACVIDSYEFVRNS |
Ga0311354_115717722 | 3300030618 | Palsa | QENVVIQCKGRVVRTDPSGANDEGRGVACVIDSYEFVRNS |
Ga0302316_102264881 | 3300030646 | Palsa | VTIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK |
Ga0265459_121460952 | 3300030741 | Soil | VIQCRGRVVRTDEPNASAASGDNRGVACVIDSYEFVRNT |
Ga0265461_115286382 | 3300030743 | Soil | QENVVIQCKGRVVRADPTGTSEEGRGVSCVIDSYEFVRNS |
Ga0265753_10776722 | 3300030862 | Soil | ENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRS |
Ga0170834_1119459721 | 3300031057 | Forest Soil | NVTIQCKGRVVRADETGKGGEGRGVACVIDSYEFVRNS |
Ga0170824_1078806112 | 3300031231 | Forest Soil | MTGAKEGVVIQCRGRVVRTDEPAGGSPTEARGVACVIDSYDFVRH |
Ga0302325_119859691 | 3300031234 | Palsa | VVIQCRGRVVRTDEPHASTEPGDSRGVACVIDSYEFVRNS |
Ga0302325_125731601 | 3300031234 | Palsa | QEHVVIQCKGRVVRTDPSGASAEGKGVACVIDSYEFVRNS |
Ga0302324_1000655495 | 3300031236 | Palsa | GKDDVVIQCRGRVVRTDEPNSSTEAGEHRGVACVIDSYEFVRNS |
Ga0265340_103789372 | 3300031247 | Rhizosphere | IQCRGRVVRTDEPKASAESGDSRGVACVIDSYEFVRNS |
Ga0170819_170042871 | 3300031469 | Forest Soil | IQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0302326_119528872 | 3300031525 | Palsa | EVTGAKEDVIVQCKGRVVRTDEPAGHGPKETRGVACVIDTYDFVRRS |
Ga0318538_103319212 | 3300031546 | Soil | ENVVIQCRGRVVRTDENSTDAAGTRGVACVIDSYEFVRNT |
Ga0310915_109500041 | 3300031573 | Soil | ENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0307474_104600961 | 3300031718 | Hardwood Forest Soil | GQENVVIACKGRVVRTDPTGASPDGKGVACVIDSYEFVRNS |
Ga0307474_105873131 | 3300031718 | Hardwood Forest Soil | TIQCKGRVVRADETGSGGEGRGVACVIDSYEFVRKS |
Ga0306917_103159691 | 3300031719 | Soil | GAKEPVIVQCRGRVVRTDEPVTNNPKQARGVACVIDSYDFVRRE |
Ga0307469_105709641 | 3300031720 | Hardwood Forest Soil | VIQCRGRVVRTDESSTDPDGSRGVACVIDSYEFVRNS |
Ga0318502_102348481 | 3300031747 | Soil | VIQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS |
Ga0307477_106801041 | 3300031753 | Hardwood Forest Soil | IQCRGRVVRTDESKVDPDGTRGVACVIDSYEFVRNS |
Ga0318547_104854571 | 3300031781 | Soil | PEVTGGKENVVIQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS |
Ga0316037_1179242 | 3300031808 | Soil | ENVVIQCKGRVVRTDPTGASEDGKGVACVIDSYEFVRNA |
Ga0307478_106326972 | 3300031823 | Hardwood Forest Soil | VTGGMENVVIQCKGRVVRTDPTGATADGKGVACVIDSYEFVRNS |
Ga0307478_107587001 | 3300031823 | Hardwood Forest Soil | TGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNE |
Ga0307478_108879922 | 3300031823 | Hardwood Forest Soil | DVTGGQENVVIQCKGRVVRTDPTGASEEGKGVACVIDSYEFVRNS |
Ga0307478_109448292 | 3300031823 | Hardwood Forest Soil | GGQENVTIQCKGRVVRADETGKGGEGRGVACVIDTYEFVRNS |
Ga0318527_100858571 | 3300031859 | Soil | IQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS |
Ga0318522_102384272 | 3300031894 | Soil | KENVVIQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS |
Ga0318520_103726332 | 3300031897 | Soil | FIQCRGRVVRTDESDVDPDGTRGVACVIDSYEFVRNS |
Ga0307479_104791483 | 3300031962 | Hardwood Forest Soil | EPVMVKCIGRVVRTDEPASGGKSSEARGVACVIDSYDFVRHE |
Ga0308176_112036342 | 3300031996 | Soil | TGGQENVTIQCKGRVVRADETGEGGEGRGVACVIDTYEFVRNS |
Ga0306922_108654792 | 3300032001 | Soil | TGGKDDVVIQCRGRVVRRDEVASGKETEAGGVACVIDSYEFVRNS |
Ga0326631_1134391 | 3300032072 | Soil | MTGGTENVKIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRS |
Ga0306924_116850152 | 3300032076 | Soil | QENVTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0316053_1151921 | 3300032120 | Soil | PDVTGGQESVTIQCKGRVVRSDATGASADGKGVACVIDSYEFVRKP |
Ga0307471_1021623471 | 3300032180 | Hardwood Forest Soil | AIGGKENITIQCRGRVVRKDAPAGGDPAESHGVACVIDSYEFIRNS |
Ga0307471_1027120631 | 3300032180 | Hardwood Forest Soil | GQENVVIQCKGRVVRTDPTGSSADGKGVACVIDTYEFVRNT |
Ga0307471_1036293772 | 3300032180 | Hardwood Forest Soil | RGRVVRADETGSTNNPTEARGVACVIDSYDFVRHS |
Ga0307472_1019179852 | 3300032205 | Hardwood Forest Soil | EVTGGQENVTIQCKGRVVRTDEAGNEGRGVACVIDSYEFVRNS |
Ga0310812_102262482 | 3300032421 | Soil | EMTGGQENVTIQCKGRVVRADETGEGGKGRGVACVIDTYEFVRNS |
Ga0348332_128590161 | 3300032515 | Plant Litter | VTGGQENVTIQCKGRVVRSDPTGTSPDGKGVACVIDSYEFVRK |
Ga0335079_113549572 | 3300032783 | Soil | TGAKENVIIQCKGRVVRTDEPGTESPDSRGVACVIDSYDFVRNS |
Ga0335078_108867173 | 3300032805 | Soil | AKEPVLVQCRGRVVRTDEPGTGEAKDTRGVACVIDSYDFIRRE |
Ga0335078_117962321 | 3300032805 | Soil | VTIQCKGRVVRADETGEGGEGRGVACVIDSYEFVRNS |
Ga0335081_127285492 | 3300032892 | Soil | ENVVIQCRGRVVRTDEPPSGSQPTEARGVACVIDSYDFVRHS |
Ga0335076_116629312 | 3300032955 | Soil | ENVTIQCKGRVVRSDETGEGGEGRGVACVIDSYEFVRNS |
Ga0326728_101645071 | 3300033402 | Peat Soil | VIQCRGRVVRTDEPNASAESGDSRGVACVIDSYEFVRNS |
Ga0326730_10899372 | 3300033500 | Peat Soil | VVIQCRGRVVRADEAAGGGSPEARGVACVIDSYEFVRNS |
Ga0326723_0288782_2_121 | 3300034090 | Peat Soil | VIQCRGRVVRTDEPAAGAAPGDNRGVACVIDSYEFVRNP |
Ga0370514_115856_566_679 | 3300034199 | Untreated Peat Soil | VTIQCKGRVVRADETGKGGEGRGVACVIDSYEFVRNS |
⦗Top⦘ |