NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F010579

Metagenome Family F010579

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F010579
Family Type Metagenome
Number of Sequences 302
Average Sequence Length 52 residues
Representative Sequence IFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Number of Associated Samples 194
Number of Associated Scaffolds 302

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.32 %
% of genes near scaffold ends (potentially truncated) 29.80 %
% of genes from short scaffolds (< 2000 bps) 87.75 %
Associated GOLD sequencing projects 168
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (59.934 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(29.470 % of family members)
Environment Ontology (ENVO) Unclassified
(36.755 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.384 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 37.66%    β-sheet: 0.00%    Coil/Unstructured: 62.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 302 Family Scaffolds
PF07883Cupin_2 34.77
PF00270DEAD 23.51
PF00034Cytochrom_C 5.30
PF00271Helicase_C 4.64
PF07494Reg_prop 3.31
PF13229Beta_helix 1.32
PF03880DbpA 0.99
PF00196GerE 0.66
PF07730HisKA_3 0.33
PF00297Ribosomal_L3 0.33
PF05188MutS_II 0.33
PF13231PMT_2 0.33
PF13568OMP_b-brl_2 0.33
PF03706LPG_synthase_TM 0.33
PF00701DHDPS 0.33
PF07691PA14 0.33
PF07687M20_dimer 0.33
PF07495Y_Y_Y 0.33

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 302 Family Scaffolds
COG3292Periplasmic ligand-binding sensor domainSignal transduction mechanisms [T] 3.31
COG0513Superfamily II DNA and RNA helicaseReplication, recombination and repair [L] 2.98
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 0.66
COG0087Ribosomal protein L3Translation, ribosomal structure and biogenesis [J] 0.33
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 0.33
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 0.33
COG0642Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.33
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.33
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.33
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.33
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.33


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.55 %
UnclassifiedrootN/A32.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig98933Not Available787Open in IMG/M
3300000559|F14TC_100322407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium931Open in IMG/M
3300000559|F14TC_100756755Not Available979Open in IMG/M
3300000559|F14TC_101287481Not Available621Open in IMG/M
3300000559|F14TC_103659772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1116Open in IMG/M
3300000956|JGI10216J12902_101573943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium838Open in IMG/M
3300000956|JGI10216J12902_110928770Not Available997Open in IMG/M
3300002090|JGI24806J26614_1000698All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis11038Open in IMG/M
3300002128|JGI24036J26619_10019715Not Available1247Open in IMG/M
3300004114|Ga0062593_100474240All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1150Open in IMG/M
3300004114|Ga0062593_101396309All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium748Open in IMG/M
3300004114|Ga0062593_102265134All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300004114|Ga0062593_102663146Not Available569Open in IMG/M
3300004156|Ga0062589_100109989All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1783Open in IMG/M
3300004157|Ga0062590_100667110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium929Open in IMG/M
3300004157|Ga0062590_101298232All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium717Open in IMG/M
3300004157|Ga0062590_101976766Not Available604Open in IMG/M
3300004463|Ga0063356_102101409Not Available857Open in IMG/M
3300004463|Ga0063356_103958860Not Available638Open in IMG/M
3300004480|Ga0062592_100177642All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae1468Open in IMG/M
3300004480|Ga0062592_101528571All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium642Open in IMG/M
3300005290|Ga0065712_10157186All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1326Open in IMG/M
3300005294|Ga0065705_11125020Not Available517Open in IMG/M
3300005295|Ga0065707_10546742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium724Open in IMG/M
3300005295|Ga0065707_10859761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium579Open in IMG/M
3300005330|Ga0070690_101206457All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium604Open in IMG/M
3300005330|Ga0070690_101529585All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium540Open in IMG/M
3300005331|Ga0070670_100223867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1637Open in IMG/M
3300005333|Ga0070677_10436044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium698Open in IMG/M
3300005334|Ga0068869_100207437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1548Open in IMG/M
3300005337|Ga0070682_100023023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3697Open in IMG/M
3300005340|Ga0070689_101031977All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium733Open in IMG/M
3300005340|Ga0070689_102027595Not Available526Open in IMG/M
3300005340|Ga0070689_102205905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium505Open in IMG/M
3300005343|Ga0070687_100938797All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium623Open in IMG/M
3300005355|Ga0070671_100396093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1181Open in IMG/M
3300005440|Ga0070705_101871697All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium510Open in IMG/M
3300005444|Ga0070694_101347897All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium601Open in IMG/M
3300005456|Ga0070678_100610425Not Available975Open in IMG/M
3300005456|Ga0070678_101770929All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium582Open in IMG/M
3300005459|Ga0068867_100648907All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium926Open in IMG/M
3300005518|Ga0070699_100693529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium930Open in IMG/M
3300005526|Ga0073909_10148182Not Available976Open in IMG/M
3300005577|Ga0068857_100157693All Organisms → cellular organisms → Bacteria2058Open in IMG/M
3300005616|Ga0068852_100945442Not Available880Open in IMG/M
3300005617|Ga0068859_100424046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae1427Open in IMG/M
3300005617|Ga0068859_100644037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1152Open in IMG/M
3300005618|Ga0068864_100186331All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1900Open in IMG/M
3300005719|Ga0068861_100374764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1256Open in IMG/M
3300005834|Ga0068851_10179600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1172Open in IMG/M
3300005841|Ga0068863_101134597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium787Open in IMG/M
3300005841|Ga0068863_102738834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300005844|Ga0068862_100942647All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium851Open in IMG/M
3300006031|Ga0066651_10659747All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1559Open in IMG/M
3300006046|Ga0066652_100002099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae10751Open in IMG/M
3300006163|Ga0070715_10304587All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1854Open in IMG/M
3300006791|Ga0066653_10564149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium576Open in IMG/M
3300006844|Ga0075428_100579514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1199Open in IMG/M
3300006845|Ga0075421_100330510Not Available1846Open in IMG/M
3300006881|Ga0068865_101917297All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300006894|Ga0079215_10371909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium829Open in IMG/M
3300009011|Ga0105251_10443587All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1601Open in IMG/M
3300009094|Ga0111539_10019200All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8445Open in IMG/M
3300009094|Ga0111539_10320824Not Available1803Open in IMG/M
3300009094|Ga0111539_10984032Not Available981Open in IMG/M
3300009100|Ga0075418_10459322Not Available1365Open in IMG/M
3300009156|Ga0111538_10162216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2839Open in IMG/M
3300009156|Ga0111538_12366176All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium667Open in IMG/M
3300009156|Ga0111538_13904625Not Available515Open in IMG/M
3300009162|Ga0075423_12465790All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1567Open in IMG/M
3300009174|Ga0105241_11345284All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium682Open in IMG/M
3300009176|Ga0105242_10019032All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5379Open in IMG/M
3300009176|Ga0105242_10239843Not Available1629Open in IMG/M
3300009176|Ga0105242_10341973All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1379Open in IMG/M
3300009176|Ga0105242_11798956Not Available651Open in IMG/M
3300009177|Ga0105248_11514962All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium759Open in IMG/M
3300009553|Ga0105249_11567338Not Available731Open in IMG/M
3300009553|Ga0105249_12305610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium611Open in IMG/M
3300009610|Ga0105340_1258550Not Available748Open in IMG/M
3300009678|Ga0105252_10539570Not Available538Open in IMG/M
3300009678|Ga0105252_10573970All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1520Open in IMG/M
3300010036|Ga0126305_10006388All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5718Open in IMG/M
3300010037|Ga0126304_10160311Not Available1460Open in IMG/M
3300010037|Ga0126304_10800376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium639Open in IMG/M
3300010337|Ga0134062_10241390All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1837Open in IMG/M
3300010364|Ga0134066_10243309All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium619Open in IMG/M
3300011119|Ga0105246_10735931Not Available868Open in IMG/M
3300011412|Ga0137424_1066798All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1692Open in IMG/M
3300011421|Ga0137462_1067796Not Available804Open in IMG/M
3300011422|Ga0137425_1021094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1369Open in IMG/M
3300011429|Ga0137455_1047110Not Available1213Open in IMG/M
3300011442|Ga0137437_1223893Not Available654Open in IMG/M
3300011444|Ga0137463_1292673All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1598Open in IMG/M
3300012163|Ga0137355_1029817Not Available1002Open in IMG/M
3300012514|Ga0157330_1078589Not Available524Open in IMG/M
3300012882|Ga0157304_1007931Not Available1127Open in IMG/M
3300012882|Ga0157304_1011620Not Available997Open in IMG/M
3300012883|Ga0157281_1002391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1613Open in IMG/M
3300012883|Ga0157281_1026022Not Available776Open in IMG/M
3300012884|Ga0157300_1032571Not Available750Open in IMG/M
3300012885|Ga0157287_1015569Not Available937Open in IMG/M
3300012892|Ga0157294_10043032Not Available996Open in IMG/M
3300012893|Ga0157284_10000395All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae7785Open in IMG/M
3300012893|Ga0157284_10012014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1545Open in IMG/M
3300012893|Ga0157284_10336007All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300012895|Ga0157309_10016035All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1579Open in IMG/M
3300012895|Ga0157309_10134473All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium720Open in IMG/M
3300012896|Ga0157303_10007837Not Available1537Open in IMG/M
3300012896|Ga0157303_10013183Not Available1285Open in IMG/M
3300012897|Ga0157285_10047804Not Available1032Open in IMG/M
3300012898|Ga0157293_10048124Not Available938Open in IMG/M
3300012898|Ga0157293_10173159All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1629Open in IMG/M
3300012899|Ga0157299_10000067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae8876Open in IMG/M
3300012899|Ga0157299_10052477Not Available919Open in IMG/M
3300012900|Ga0157292_10098697All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium867Open in IMG/M
3300012900|Ga0157292_10166685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium714Open in IMG/M
3300012900|Ga0157292_10223880Not Available641Open in IMG/M
3300012901|Ga0157288_10387955Not Available518Open in IMG/M
3300012903|Ga0157289_10034673Not Available1201Open in IMG/M
3300012904|Ga0157282_10035299Not Available1140Open in IMG/M
3300012905|Ga0157296_10049029Not Available986Open in IMG/M
3300012905|Ga0157296_10085066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium831Open in IMG/M
3300012905|Ga0157296_10356110Not Available532Open in IMG/M
3300012906|Ga0157295_10014500Not Available1469Open in IMG/M
3300012906|Ga0157295_10118141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium753Open in IMG/M
3300012906|Ga0157295_10129860Not Available730Open in IMG/M
3300012906|Ga0157295_10130772All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium728Open in IMG/M
3300012906|Ga0157295_10203214All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1633Open in IMG/M
3300012907|Ga0157283_10043178Not Available996Open in IMG/M
3300012913|Ga0157298_10052001Not Available948Open in IMG/M
3300012914|Ga0157297_10108524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium845Open in IMG/M
3300012914|Ga0157297_10404247Not Available548Open in IMG/M
3300012916|Ga0157310_10013873All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1992Open in IMG/M
3300012916|Ga0157310_10302041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium628Open in IMG/M
3300012984|Ga0164309_10080406All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1996Open in IMG/M
3300012985|Ga0164308_10870593Not Available791Open in IMG/M
3300012988|Ga0164306_11868914All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300013306|Ga0163162_10887725All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300013306|Ga0163162_10966966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium962Open in IMG/M
3300013308|Ga0157375_11086126All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium936Open in IMG/M
3300013308|Ga0157375_11589960All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium773Open in IMG/M
3300014325|Ga0163163_11781778Not Available676Open in IMG/M
3300014326|Ga0157380_10150103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2013Open in IMG/M
3300014326|Ga0157380_10275481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1536Open in IMG/M
3300014326|Ga0157380_10604098Not Available1086Open in IMG/M
3300014326|Ga0157380_10633622Not Available1063Open in IMG/M
3300014326|Ga0157380_10817090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium951Open in IMG/M
3300014326|Ga0157380_11285395All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium778Open in IMG/M
3300014745|Ga0157377_10702038All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1735Open in IMG/M
3300014875|Ga0180083_1075706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium719Open in IMG/M
3300014968|Ga0157379_10042793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4044Open in IMG/M
3300014969|Ga0157376_11816347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium646Open in IMG/M
3300015077|Ga0173483_10355715All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1737Open in IMG/M
3300015200|Ga0173480_10014023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3263Open in IMG/M
3300015200|Ga0173480_10414866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium785Open in IMG/M
3300015200|Ga0173480_10544416All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1703Open in IMG/M
3300015201|Ga0173478_10001342All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae5018Open in IMG/M
3300015201|Ga0173478_10039407All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1485Open in IMG/M
3300015201|Ga0173478_10160096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium905Open in IMG/M
3300015201|Ga0173478_10463367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium625Open in IMG/M
3300015371|Ga0132258_12073795All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1430Open in IMG/M
3300015371|Ga0132258_12761923Not Available1224Open in IMG/M
3300015372|Ga0132256_101910415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium701Open in IMG/M
3300015373|Ga0132257_101045332Not Available1029Open in IMG/M
3300015373|Ga0132257_101803716Not Available786Open in IMG/M
3300015374|Ga0132255_102598605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium774Open in IMG/M
3300015374|Ga0132255_103027869Not Available717Open in IMG/M
3300015374|Ga0132255_105221492All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1550Open in IMG/M
3300017792|Ga0163161_10708400Not Available839Open in IMG/M
3300017792|Ga0163161_10712142All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium837Open in IMG/M
3300017792|Ga0163161_11725735Not Available555Open in IMG/M
3300018051|Ga0184620_10033643Not Available1361Open in IMG/M
3300018067|Ga0184611_1001897All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4657Open in IMG/M
3300018067|Ga0184611_1339950All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1516Open in IMG/M
3300018072|Ga0184635_10136376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium978Open in IMG/M
3300018072|Ga0184635_10138937Not Available968Open in IMG/M
3300018073|Ga0184624_10013432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2910Open in IMG/M
3300018074|Ga0184640_10167276All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium986Open in IMG/M
3300018082|Ga0184639_10188498All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300018083|Ga0184628_10208980Not Available1022Open in IMG/M
3300018083|Ga0184628_10383365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium736Open in IMG/M
3300018469|Ga0190270_10070049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2546Open in IMG/M
3300018469|Ga0190270_10400689Not Available1270Open in IMG/M
3300018469|Ga0190270_10956160Not Available879Open in IMG/M
3300018476|Ga0190274_10473573Not Available1242Open in IMG/M
3300018476|Ga0190274_10893716Not Available955Open in IMG/M
3300018476|Ga0190274_10942429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes933Open in IMG/M
3300018476|Ga0190274_11811191All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1705Open in IMG/M
3300018481|Ga0190271_10006569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae7803Open in IMG/M
3300018481|Ga0190271_10386120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1491Open in IMG/M
3300018481|Ga0190271_12661298All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1600Open in IMG/M
3300019356|Ga0173481_10036453All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1615Open in IMG/M
3300019356|Ga0173481_10076546Not Available1226Open in IMG/M
3300019356|Ga0173481_10284582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1761Open in IMG/M
3300019361|Ga0173482_10058101All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1282Open in IMG/M
3300019361|Ga0173482_10081272All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1134Open in IMG/M
3300019361|Ga0173482_10119922Not Available983Open in IMG/M
3300019361|Ga0173482_10184441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium842Open in IMG/M
3300019361|Ga0173482_10412747Not Available631Open in IMG/M
3300019362|Ga0173479_10129628Not Available979Open in IMG/M
3300019362|Ga0173479_10207175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium832Open in IMG/M
3300019362|Ga0173479_10211825All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1826Open in IMG/M
3300019362|Ga0173479_10442434Not Available639Open in IMG/M
3300019871|Ga0193702_1001774All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3945Open in IMG/M
3300019871|Ga0193702_1004426All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1988Open in IMG/M
3300019876|Ga0193703_1000793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4447Open in IMG/M
3300019884|Ga0193741_1027877All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Flavihumibacter1454Open in IMG/M
3300019996|Ga0193693_1022404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1162Open in IMG/M
3300020000|Ga0193692_1011730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2149Open in IMG/M
3300020000|Ga0193692_1080880All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium708Open in IMG/M
3300020009|Ga0193740_1001552All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4857Open in IMG/M
3300020016|Ga0193696_1002139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5836Open in IMG/M
3300020020|Ga0193738_1000244All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes37264Open in IMG/M
3300020020|Ga0193738_1001574All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae9143Open in IMG/M
3300020020|Ga0193738_1002612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6752Open in IMG/M
3300021082|Ga0210380_10140814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1080Open in IMG/M
3300021415|Ga0193694_1000005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes238039Open in IMG/M
3300022756|Ga0222622_10223355All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1262Open in IMG/M
3300022756|Ga0222622_10984166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium619Open in IMG/M
3300022886|Ga0247746_1026776All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1271Open in IMG/M
3300022886|Ga0247746_1077300Not Available793Open in IMG/M
3300022898|Ga0247745_1096450All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1508Open in IMG/M
3300022899|Ga0247795_1006668All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1851Open in IMG/M
3300022899|Ga0247795_1006828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1831Open in IMG/M
3300022899|Ga0247795_1044579Not Available739Open in IMG/M
3300022903|Ga0247774_1182413All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300022906|Ga0247766_1101086Not Available744Open in IMG/M
3300023057|Ga0247797_1011154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1073Open in IMG/M
3300023057|Ga0247797_1026663Not Available768Open in IMG/M
3300023062|Ga0247791_1007034Not Available1659Open in IMG/M
3300023062|Ga0247791_1054212All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1637Open in IMG/M
3300023069|Ga0247751_1103280All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium515Open in IMG/M
3300023077|Ga0247802_1029035All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium811Open in IMG/M
3300023078|Ga0247756_1112857Not Available534Open in IMG/M
3300023260|Ga0247798_1009645All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1139Open in IMG/M
3300023263|Ga0247800_1013594All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300023263|Ga0247800_1056129All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes729Open in IMG/M
3300023265|Ga0247780_1013113All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1909Open in IMG/M
3300023266|Ga0247789_1136684All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium508Open in IMG/M
3300024055|Ga0247794_10033326All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae1345Open in IMG/M
3300025321|Ga0207656_10064183Not Available1618Open in IMG/M
3300025893|Ga0207682_10049730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1731Open in IMG/M
3300025893|Ga0207682_10252318Not Available821Open in IMG/M
3300025899|Ga0207642_10487809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium752Open in IMG/M
3300025905|Ga0207685_10187170All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300025910|Ga0207684_10669282All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium884Open in IMG/M
3300025911|Ga0207654_11300846All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300025918|Ga0207662_10378338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium956Open in IMG/M
3300025925|Ga0207650_10101031All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2220Open in IMG/M
3300025926|Ga0207659_10673433Not Available885Open in IMG/M
3300025930|Ga0207701_11156000All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300025933|Ga0207706_10526809Not Available1019Open in IMG/M
3300025934|Ga0207686_10000669All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes21197Open in IMG/M
3300025934|Ga0207686_10123297All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1767Open in IMG/M
3300025934|Ga0207686_11061660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium659Open in IMG/M
3300025937|Ga0207669_10588534All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium903Open in IMG/M
3300025940|Ga0207691_11018518All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium691Open in IMG/M
3300025940|Ga0207691_11412414All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300025941|Ga0207711_10392445Not Available1289Open in IMG/M
3300025942|Ga0207689_10011193All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes7697Open in IMG/M
3300025961|Ga0207712_10038460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3272Open in IMG/M
3300025981|Ga0207640_11072700All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium711Open in IMG/M
3300025986|Ga0207658_10565109All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1019Open in IMG/M
3300026035|Ga0207703_10631043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1015Open in IMG/M
3300026041|Ga0207639_11170820All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium721Open in IMG/M
3300026088|Ga0207641_10335992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1436Open in IMG/M
3300026089|Ga0207648_10097991All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2566Open in IMG/M
3300026095|Ga0207676_10380730Not Available1313Open in IMG/M
3300026095|Ga0207676_11490025All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium673Open in IMG/M
3300026116|Ga0207674_10106592All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2780Open in IMG/M
3300026142|Ga0207698_10365195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1368Open in IMG/M
3300027639|Ga0209387_1156577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium600Open in IMG/M
3300027886|Ga0209486_10005790All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes5380Open in IMG/M
3300027907|Ga0207428_10121816Not Available2000Open in IMG/M
3300027907|Ga0207428_10136731Not Available1873Open in IMG/M
3300027909|Ga0209382_10561383Not Available1248Open in IMG/M
3300028380|Ga0268265_12580133Not Available514Open in IMG/M
3300028381|Ga0268264_10657343All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1038Open in IMG/M
3300031226|Ga0307497_10253974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium787Open in IMG/M
3300031538|Ga0310888_10062345Not Available1786Open in IMG/M
3300031538|Ga0310888_10343157All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium864Open in IMG/M
3300031538|Ga0310888_11084015Not Available506Open in IMG/M
3300031716|Ga0310813_10466835Not Available1098Open in IMG/M
3300031847|Ga0310907_10388251All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium725Open in IMG/M
3300031854|Ga0310904_10041058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2238Open in IMG/M
3300031908|Ga0310900_11290468All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium610Open in IMG/M
3300031908|Ga0310900_11467267All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1574Open in IMG/M
3300031940|Ga0310901_10264177Not Available711Open in IMG/M
3300031943|Ga0310885_10321461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium805Open in IMG/M
3300032012|Ga0310902_10079389All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1697Open in IMG/M
3300032012|Ga0310902_11013854All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium577Open in IMG/M
3300032013|Ga0310906_10577107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium772Open in IMG/M
3300032075|Ga0310890_10500751All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium923Open in IMG/M
3300032075|Ga0310890_10627960All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium834Open in IMG/M
3300032075|Ga0310890_10764851All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Bdelloidea → Rotaria → unclassified Rotaria → Rotaria sp. Silwood1762Open in IMG/M
3300032075|Ga0310890_11753331Not Available516Open in IMG/M
3300032122|Ga0310895_10607966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium561Open in IMG/M
3300032144|Ga0315910_10000025All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae338301Open in IMG/M
3300032179|Ga0310889_10115053All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1165Open in IMG/M
3300032211|Ga0310896_10394904Not Available738Open in IMG/M
3300032211|Ga0310896_10400731All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium733Open in IMG/M
3300034115|Ga0364945_0169810Not Available659Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil29.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.30%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.30%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.31%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.32%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.66%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.32%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.32%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.99%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.66%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.66%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.66%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.33%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.33%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.33%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.33%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.33%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002090Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDAEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012163Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2EnvironmentalOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019871Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300019996Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2EnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022903Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6EnvironmentalOpen in IMG/M
3300022906Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L223-509R-6EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023078Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300023265Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_157502802124908045SoilVILGGTNAEHMPVVKSKSSEGSDKDVFHDFLFFASHLYQ
F14TC_10032240723300000559SoilMIVINTIIILGGTHAEHIPVVKSKPVEGSEKEVFPDLIFFASYLYQ*
F14TC_10075675523300000559SoilMIVINTIIIFGGTNAENMPVVKNKPAEGSENDVFPDLIFFASYIYQ*
F14TC_10128748113300000559SoilMIVVNTIVILGGTHAEHMPVIKSKPVEGSENDVFPDLLHFASYLYQ*
F14TC_10365977223300000559SoilMIVINTIIILGGTHAEHIPVVKSKSVEGSEKEVFPDLIFFASYLYQ*
JGI10216J12902_10157394323300000956SoilMIVINSIIVLGGTHAEHLPEVKTRPAQETEKDVLPGMMFFASFLYE*
JGI10216J12902_11092877013300000956SoilMKHYKLVKIFLLIVVNTIVILGGTNAEHMPVVKSKPSEGSDKDVFHDFLFFASHLYQ*
JGI24806J26614_100069883300002090SoilMIVINTIIVLGGTHAEHIKVIKKEPAAGSEKDVFPDLLYFASYLYQ*
JGI24036J26619_1001971533300002128Corn, Switchgrass And Miscanthus RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFF
Ga0062593_10047424013300004114SoilMIVVNTIIILGGTQAEHIRSAKAKPAEGPGKDIFPDHIFFASYLYQ*
Ga0062593_10139630923300004114SoilMIVVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0062593_10226513413300004114SoilMKQYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPVDGSENDVFPDMLYFASYLYQ*
Ga0062593_10266314623300004114SoilMKRYKLIKIFLMIVINTIIMLGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYLYQ*
Ga0062589_10010998923300004156SoilMIAINTIMILGGTHAEHMPVVKSKPVEGSEKEVFPDLIFFASYLYQ*
Ga0062590_10066711023300004157SoilMKNYRLIKIFLMIVVNTIIILGGTQAEHIRSAKAKPAEGPGKDIFPDHIFFASYLYQ*
Ga0062590_10129823213300004157SoilMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ*
Ga0062590_10197676623300004157SoilMKNYRLIKIFLMTAINTIMILGGTHAEHMPVVKTKPVKGSEKEVFPDLIFFASYLYQ*
Ga0063356_10210140913300004463Arabidopsis Thaliana RhizosphereMIVMNTIVILGGTHAEHMPVVKSKPPGGSEKDVFPDLLYFASYLYQ*
Ga0063356_10395886013300004463Arabidopsis Thaliana RhizosphereMIVINTIIILGGTHAEHIPVVKNKPVDESEKDVFPDHIFFASYLYQ*
Ga0062592_10017764233300004480SoilLIYQFLKMKNYKLVKIFLMIVINTIVMLGGTHAEHIPVVKSKSAEGSEKDIYPDHIFFASYLYQ*
Ga0062592_10152857123300004480SoilFSNKAYLFYQFFKMKHYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFASYLYQ*
Ga0065712_1015718633300005290Miscanthus RhizosphereMIVINTIIVLGGTHAEHIQVVKKEPAAGSEKDVFPDLLYFASCLYQ*
Ga0065705_1112502013300005294Switchgrass RhizosphereMIVINTIIILGGTHAEHIPVVKNKPVVVSEKEVFPDLIFFASYLYQ*
Ga0065707_1054674213300005295Switchgrass RhizosphereMIVINTIIILGGTHAEHIPVVKNKPVVVSEKEVFPDLIFFASYFYQ*
Ga0065707_1085976113300005295Switchgrass RhizosphereHYKLAKIFLMIVVNTIVILGGTHPEHIPVAKNKPVEGSENDVFPDLLYFASYFYQ*
Ga0070690_10120645723300005330Switchgrass RhizosphereKHYKLIKIFLMIVVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0070690_10152958523300005330Switchgrass RhizosphereHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ*
Ga0070670_10022386723300005331Switchgrass RhizosphereMTAINTIMILGGTHAEHMPVVKSKPVEGSEKEVSPDLIFFASYLYQ*
Ga0070677_1043604423300005333Miscanthus RhizosphereMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFASYLYQ*
Ga0068869_10020743723300005334Miscanthus RhizosphereMIVINTIIILGGTHAEHIPIVKNEPAVVSEKEVFPDLIFFASYLYQ*
Ga0070682_10002302333300005337Corn RhizosphereMIVINTIVILGGTHAEHMPVVKSKPVDGSENDVFPDLLYFASYLYQ*
Ga0070689_10103197723300005340Switchgrass RhizosphereLMIVVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0070689_10202759513300005340Switchgrass RhizosphereFLVYQFFKMKNYKLIKIFLMIVINTIIIFGATHAEHIPEIKSKPVEGLEKEVFPDLIFFASYLYQ*
Ga0070689_10220590513300005340Switchgrass RhizosphereMIVMNTIVILGGTHAEHMPVVKSKPSGGSEKDVFPDLLYFASYLYQ*
Ga0070687_10093879713300005343Switchgrass RhizosphereKMKHYKRIKIFLMIVMNTIVILGGTHAEHMPVVKSKPSGGSEKDVFPDLLYFASYLYQ*
Ga0070671_10039609323300005355Switchgrass RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPPAGSEKDVFPDLLFFANHLYQ*
Ga0070705_10187169723300005440Corn, Switchgrass And Miscanthus RhizosphereFLMIVVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0070694_10134789723300005444Corn, Switchgrass And Miscanthus RhizosphereFKMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ*
Ga0070678_10061042513300005456Miscanthus RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPPAGSEKDVFPDLLFFATYLYQ*
Ga0070678_10177092923300005456Miscanthus RhizosphereMIVINTIIVLGGTHAEHIQVVKKEPAAGSEKDVFPDLLYFASYLYQ*
Ga0068867_10064890723300005459Miscanthus RhizosphereMKHYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFASYLYQ*
Ga0070699_10069352913300005518Corn, Switchgrass And Miscanthus RhizosphereIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ*
Ga0073909_1014818213300005526Surface SoilLIIVVNTIVILGGTHAEHMPIVKSKPVEGSEKDVFPDLLFFASYLYQ*
Ga0068857_10015769323300005577Corn RhizosphereMTAINTIMILGGTHAEHMPVVKSKPVEGSEKEVFPDLIFFASYLYQ*
Ga0068852_10094544213300005616Corn RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPD
Ga0068859_10042404613300005617Switchgrass RhizosphereKRYKLIKIFLMIVINTIIMLGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYLYQ*
Ga0068859_10064403723300005617Switchgrass RhizosphereMKNYKLIKILLIIVINTIIIFGATHAEHMPEVKSKPMVGSEKEVFPDLIFFASYLYQ*
Ga0068864_10018633123300005618Switchgrass RhizosphereMIVINTIIIFGATHAEHIPEIKSKPVEGLEKEVFPDLIFFASYLYQ*
Ga0068861_10037476423300005719Switchgrass RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPVDGSENDVFPDLLYFASYLYQ*
Ga0068851_1017960023300005834Corn RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0068863_10113459743300005841Switchgrass RhizosphereMIVMNTIVVLGGTHAEHMPVVKSKPSGGSEKDVFPDLLYFASYLYQ*
Ga0068863_10273883413300005841Switchgrass RhizosphereMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPRDASEKDVFPDLLFFANHLYQ*
Ga0068862_10094264723300005844Switchgrass RhizosphereMIVINTIIILGGTQAEHIRSAKAKPAEGPGKDIFPDHIFFASYLYQ*
Ga0066651_1065974723300006031SoilMVVINTIIILGGTHAEHIHVIKNEPVERSQKDVYPDLIL
Ga0066652_10000209963300006046SoilMVVINTIIILGGTHAEHIHVIKNEPVERSQKDVYPDLILFASYLYQ*
Ga0070715_1030458723300006163Corn, Switchgrass And Miscanthus RhizosphereMIVVNTIVILGGTHAEHMPVVKNKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0066653_1056414923300006791SoilIKMKQYKLIKIFLMIVINTIIILGGTHAEHIQVLKKEPVRDSEKDVFPDLLYFASYLYQ*
Ga0075428_10057951423300006844Populus RhizosphereMVVINTIIILGGTYAEHIPVIKSKPVAVPEQEVFPDIMFFANFLYQ*
Ga0075421_10033051033300006845Populus RhizosphereMIVINTVIILGGTHAEHMPVVKTKPVERSEKDIFPDHLFFASHLYQ*
Ga0068865_10191729713300006881Miscanthus RhizosphereVILGGTHAEHMPVVKSKPVDGSENDVFPDLLYFASYLYQ*
Ga0079215_1037190923300006894Agricultural SoilMKHYKLIKIFLLIVINTIVILGGTHAEHMPAVKGKPVEGSEKDVYPDFLFFASHLYQ*
Ga0105251_1044358723300009011Switchgrass RhizosphereMKHYKRIKIFLMIVMNTIVILGGTHAEHMPVVKSKPPAGSEKDVFPDLLYFAGYLYQ*
Ga0111539_1001920063300009094Populus RhizosphereMKHYKLIKIFLLIVINTIIILGGTHAEHIQVVKKEPVRDSEKDVFPDLLYFASYLYQ*
Ga0111539_1032082433300009094Populus RhizosphereMKNYKLLKIFLLIVVNTIVILGGTHAEHMQVVKSKPVEGSDKDDFHDFLFFASHLYQ*
Ga0111539_1098403223300009094Populus RhizosphereMRNNKLIKIFLMIVINTIIILGGTHAEHMPVVKTRPPEGSEKEVFPDFMFFASFLYQ*
Ga0075418_1045932223300009100Populus RhizosphereMKNYKLIKIFLMVVINTIIILGGTYAEHIPVIKSKPVAVPEQEVFPDIMFFANFLYQ*
Ga0111538_1016221633300009156Populus RhizosphereMIVINTIIILGGTHAEHMPVVKTRPPEGSEKEVFPDFMFFASFLYQ*
Ga0111538_1236617613300009156Populus RhizosphereMKHYKLVKIFLLIVVNTVVILGGTHAEHIPLIKSKPVEESEKDVFPDLLFFASYLYQ*
Ga0111538_1390462513300009156Populus RhizosphereMKNNKLIKISLMIIINTIVILGGTHAEHIPAVKTKPVEGSEKDIYPDHIFFASYLYQ*
Ga0075423_1246579013300009162Populus RhizosphereMKHYKLIKIFLLIVINTIIILGGTHAEHIQVVKKEPVRDSEKDVFPDL
Ga0105241_1134528413300009174Corn RhizosphereKMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0105242_1001903253300009176Miscanthus RhizosphereQFFKMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0105242_1023984323300009176Miscanthus RhizosphereMKHYKLIKIFLMIVINTIIVLGGTHAEHMQGAKKEAAIGSEKDVFPDFLFFASYLYQ*
Ga0105242_1034197313300009176Miscanthus RhizosphereMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPPAGSEKDVFPDLLFFANHLYQ*
Ga0105242_1179895613300009176Miscanthus RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPPEVSEKDVYPDLLFFASHLYQ*
Ga0105248_1151496223300009177Switchgrass RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLYFASYLYQ*
Ga0105249_1156733823300009553Switchgrass RhizosphereMKNYKLIKIFLMIVINAIIIFGATHAEHIPEVKSKPMVGSEKEVFPDLIFFASYLYQ*
Ga0105249_1230561023300009553Switchgrass RhizosphereMIVVNTIVILGGTHAEHMPVVKTKPVEGSENDVFPDLLYFASYLYQ*
Ga0105340_125855013300009610SoilMKNYKLLKIFLLIVVNTIVILGGTHAEHIPVVKSKPVEGSDKDDFHDFLFFANHLYQ*
Ga0105252_1053957023300009678SoilMKNYKLLKIFLLIVVNTIVILGGTHAEHMPAVKSKPVEGSEKDVYPDFLFFASHLYQ*
Ga0105252_1057397013300009678SoilMKNYKLLKIFLLIVVNTIVILGGTHAEHMPVVKSKPVEGSDKDDFHDFLFFASHLYQ*
Ga0126305_1000638853300010036Serpentine SoilMKNNKLIKIFLMIVINTIVILGGTHAEHIPVVKSKPAEGSEKDIYPDHIFFASYLYQ*
Ga0126304_1016031113300010037Serpentine SoilMKHYKLIKIFLMVVVNTIVILGGTHAEHMPIIKNKPVEGSENDVFPDLLYFASYLYQ*
Ga0126304_1080037613300010037Serpentine SoilKLIKIFLMIVINTIIILGGTHAEHMPVIKSKPVEELQKDVFPDFLFFASYLYQ*
Ga0134062_1024139023300010337Grasslands SoilMKHYKIIKIFLMVVINTIIIMGGTQAEHIHVIKNEPVERSQKDVYPDLILFASYLYQ*
Ga0134066_1024330913300010364Grasslands SoilKIFLMVVINTIIILGGTHAEHIHVIKNEPVERSQKDVYPDLILFASYLYQ*
Ga0105246_1073593113300011119Miscanthus RhizosphereMKNYRLIKIFLMIVINTIIILGGTHAEHIPIVKNEPAVVSEKEVFPDLIFFASYLY
Ga0137424_106679823300011412SoilMKNYKLLKIFLLIVVNTIVILGGTHAEHMPVVKSKPVEGSDKDDFHDLLFFASHLYQ*
Ga0137462_106779623300011421SoilMKHYKLIKIFLLIVVNTIVILGGTHAEHMPVVKSKPVEGLEKDVYPDFLFFASQLYQ*
Ga0137425_102109423300011422SoilMKNYKLLKIFLLIVVNTIVILGGTHAEHMPVVKSKAVEGSDKDDFHDILFFANHLYQ*
Ga0137455_104711023300011429SoilMKHYKLAKIFLMIVVNTIVILGGTHAEHIAVVKSKPVEGTEKEVFPDLIFFASYLYQ*
Ga0137437_122389323300011442SoilMKNYKLIKILLMIVINTIIILGGTHAEHMPVVKSKQVDGSEKEVFPDLIFFASYLYQ*
Ga0137463_129267313300011444SoilMKNYKLIKIFLIIVINTIIILGTTHAEHIPEVKSKPVEGSEKEVLQDLIFFASYLY*
Ga0137355_102981723300012163SoilMKNYKLLKIFLLIVVNTIVILGGTHAEHMPVVKSKPAEGSDKDDFHDFLFFASHLYQ*
Ga0157330_107858913300012514SoilMIVINTVIILGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYLYQ*
Ga0157304_100793123300012882SoilMKHYKLAKIFLMIIVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0157304_101162023300012882SoilMKHYKLVKIFLLIVVNTVVILGGTHAEHIPVIKSKPVEGSEKDVFPDLLFFASYLYQ*
Ga0157281_100239113300012883SoilRLIKIFLMTAINTIMILGGTHAEHMPVVKSKPVESSEKEVFPNLIFFDSYLYQ*
Ga0157281_102602223300012883SoilMKNYKLLKIFLLIVVNTIVILGGTHAEHMPVVKSKPVEGSDKDDFHDLLFFANHLYQ*
Ga0157300_103257123300012884SoilMKNYRLIKVFLMIAINTIMILGGTHAEHMPVVKTKPVKGSEKEVFPDLIFFASYLYQ*
Ga0157287_101556923300012885SoilMIVVNTIVILGGTHAEHMPVVKSKPVEGLENDVFPDMLYFASYLYQ*
Ga0157294_1004303213300012892SoilMIVMNTIVILGGTHAEHMPVVKSKPVEGSENDVFPDLLYFASYLYQ*
Ga0157284_1000039543300012893SoilMKNYRLIKIFLMIAINTIMILGGTHAEYMPVVKSKPVEGSEKEVFPDLIFFASYLYQ*
Ga0157284_1001201433300012893SoilQFLKMKNYRLIKIFLMIVVNTIIILGGTQAEHIRSAKAKPAEGPGKDIFPDHIFFASYLYQ*
Ga0157284_1033600713300012893SoilKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFASYLYQ*
Ga0157309_1001603533300012895SoilMKHYKLVKIFLLIVVNTVVILGGTHAEHIPLIKSKPVEESEKEVFPDLLFFASYLYQ*
Ga0157309_1013447323300012895SoilMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVKSKPVEGLENDVFPDMLYFASYLYQ*
Ga0157303_1000783733300012896SoilMKNYRLIKIFLMIAINTIMILGGTHAEHMPVVKSKPVEGSEKEVFPDLIFFASYLYQ*
Ga0157303_1001318323300012896SoilMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVKNKPVEGSENDVFPDLLYFASYLYQ*
Ga0157285_1004780423300012897SoilMIVVNTILILGGTHAEHMPVVKSKPVEGSDKDDFHDFLFFANHLYQ*
Ga0157293_1004812413300012898SoilMKNYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEPAAGSEKDVFPDLLYFASYLYQ*
Ga0157293_1017315923300012898SoilMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVKNKPVEGSENDVFPDLIDFASYLYQ*
Ga0157299_1000006753300012899SoilMKNYRLIKIFLMIAINTIMILGGTHAEHMPVVKTKPVKGSEKEVFPDLIFFASYLYQ*
Ga0157299_1005247723300012899SoilMKHYKLAKIFLMIVVNTIVILGGTYAEHMPVVKNKPAEGSENDVFPDLL
Ga0157292_1009869713300012900SoilMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVKSKPVEGSENDVFPDLLYFASYLYQ*
Ga0157292_1016668523300012900SoilMIVMNTIVILGGTHAEHMPVVKSKPVDGSENDVFPDLLYFASYLYQ**
Ga0157292_1022388023300012900SoilMIVINTIVILGGTHAEHMPVVKSKPVDGSENDVFPD
Ga0157288_1038795513300012901SoilMKHYKLIKIFLMIVINTIIVLGGTHAEHVQAVKKEPAGGLEKEVFPDLLFFASYLYQ*
Ga0157289_1003467323300012903SoilMKHYKLVKIFLLIVVNTVVILGGTRAEHIPLIKSKSVEESEKDVFPDLLFFASYLYQ*
Ga0157282_1003529933300012904SoilMKNYRLIKIFLMIAINTIMILGGTHAEHMPVVKSKPVKGSEKEVFPDLIFFASYLYQ*
Ga0157296_1004902923300012905SoilMKHYKLAKIFLMIVVNTIVILGGTYAEHMPVVKSKPVEGSDKDDFHDLLFFANHLYQ*
Ga0157296_1008506613300012905SoilMKHYKLVKIFLLIVVNTVVILGGTHAEHIPLITRKSVEESEKDVFPDLLFFASYLYQ*
Ga0157296_1035611013300012905SoilMKNYRLIKIFLMIAINTIIILGGTHAEHMPVVKTKPAEGSEKEVFPDLIFFASYLYQ*
Ga0157295_1001450023300012906SoilMKNYKLVKIFLMIVINTIVMLGGTHAEHIPVVKSKSAEGSEKDIYPDHIFFASYLYQ*
Ga0157295_1011814113300012906SoilTHAEHMPVVKSKPVDGSENDVFPDMLYFASYLYQ*
Ga0157295_1012986013300012906SoilMKQYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPPGGSEKDVFPDL
Ga0157295_1013077213300012906SoilMKHYKLIKIFLLIVINTIIILGGTHAEHMPVVKPRPVEGSEKDVFPDLLFFASYLYQ*
Ga0157295_1020321413300012906SoilMIVINTIIILGGTQAEHIRSAKAKPAEGPGKDIFPDHIFFASYLYQRTFAITI*
Ga0157283_1004317813300012907SoilMKQYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPVEGSENDVFPDMLYFASYLYQ*
Ga0157298_1005200123300012913SoilMKHYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEVVGGSEKDVFPDLLYFASYLYQ*
Ga0157297_1010852423300012914SoilMIVVNTIVILGGTHAEHMPVVKSKPVDGSENDVFPDMLYFASYLYQ*
Ga0157297_1040424723300012914SoilIVILGGTHAEHMPVVKSKPVEGSDSDVFNDFLFFANHLYQ*
Ga0157310_1001387333300012916SoilMKHYKLVKIFLLIVVNTVVILGGTHAEHIPLIKSKSVEESEKDVFPDLLFFASYLYQ*
Ga0157310_1030204113300012916SoilMIVINTIVILGGTYAEHMPVVKSKPVDGSENDVFPDLLYFASYLYQ*
Ga0164309_1008040623300012984SoilMKHYKLIKIFWMIVVNTIVILGGTHAEHLPVIKTKPVEGSEKEVFPDLIFFASYLYQ*
Ga0164308_1087059313300012985SoilMKHYKLIKIFLMIVINTIIVLGGTHAEHMRVDKKEPSGGSEKDVFPDLLYFASYLYQ*
Ga0164306_1186891423300012988SoilDYYYKPYLFNQFFKMKHYKLIKIFLMIVINTIVILGGTHAEHMPVVKSKPVDGSENDVFPDLLYFASYLYQ*
Ga0163162_1088772523300013306Switchgrass RhizosphereMIVVNTIVILGGTHAEHMPVVKNNPPAGSEKDVFPDLLFFANHLYQ*
Ga0163162_1096696633300013306Switchgrass RhizosphereIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0157375_1108612613300013308Miscanthus RhizosphereMIVMNTIVILGGTHAEHIEVVKKEPAGASEKDVFPDLLYFASYLYQ*
Ga0157375_1158996023300013308Miscanthus RhizosphereLLKIFLMIVVNTIIILGGTQAEHMPSVKTKPAEVPGKDIFPDHIFFASYLYQ*
Ga0163163_1178177813300014325Switchgrass RhizosphereTHAEHIPEIKSKPVEGLEKEVFPDLIFFASYLYQ*
Ga0157380_1015010323300014326Switchgrass RhizosphereMKNYRLIKIFLMIVINTIIILGGTHAEHIPIVKNEPAVVSEKEVFPDLIFFASYLYQ*
Ga0157380_1027548133300014326Switchgrass RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPVEGSENDVFPDLLYFASYLYQ*
Ga0157380_1060409813300014326Switchgrass RhizosphereMKHYKLAKIFLMIVINTIVILGGTNAEHMPVVKSKSAEGSENDVFPDLLYFASYLYQ*
Ga0157380_1063362213300014326Switchgrass RhizosphereMKHYKLIKIFLLIVINTIIILGGTHAEHIQGVKKEAAGGSEKDVFPDFLFFASYLYQ*
Ga0157380_1081709013300014326Switchgrass RhizosphereMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVKTKPVEGSENDVFPDLLYFASYLYQ*
Ga0157380_1128539523300014326Switchgrass RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVLPDLLYFASYLYQ*
Ga0157377_1070203823300014745Miscanthus RhizosphereMKRYKLIKIFLMIVINTIIMLGGTHAEHIQVVKKEPAAGSEKDVFPDLLYFASYLYQ*
Ga0180083_107570613300014875SoilMKNYRLVKIFLMIVINTIIILGGTHAEHIPVVKNKSTVVSEKEVFPDLIFFASYLYQ*
Ga0157379_1004279333300014968Switchgrass RhizosphereMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFAGYLYQ*
Ga0157376_1181634723300014969Miscanthus RhizosphereHYKRIKIFLMIVMNTIVILGGTHAEHMPVVKSKPSGGSEKDVFPDLLYFASYLYQ*
Ga0173483_1035571523300015077SoilMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVRNEPAKGPEKDAFPDLIFFASYLYQ*
Ga0173480_1001402333300015200SoilMKHYKLIKIFLMIVMNTIVILGGTHAEHMPVVKSKPPGGSEKDVFPDLLYFASYLYQ*
Ga0173480_1041486623300015200SoilMLGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYLYQ*
Ga0173480_1054441623300015200SoilMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVKSKPAEGSENDVFPDLLYFASYLYQ*
Ga0173478_1000134223300015201SoilMKNYRLIKIFLMTAINTIMILGGTHAEHMPVVKSKPVESSEKEVFPNLIFFDSYLYQ*
Ga0173478_1003940713300015201SoilSALTCYRNGFYNKAYLFYQFFKMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVKSKPAEGSENDVFPDLLYFASYLYQ*
Ga0173478_1016009613300015201SoilSALTCYRNGFYNKAYLFYQFFKMKHYKLAKIFLMIVVNTIVILGGTYAEHMPVVKNKPVEGSENDVFPDLLYFASYLY*
Ga0173478_1046336713300015201SoilILGGTHAEHMPVVKSKPVEGSENDVFPDMLYFASYLYQ*
Ga0132258_1207379523300015371Arabidopsis RhizosphereMKNYKLIKIFLMIVINTIIIFGATHAEHIPEVKSKPVEGSEKEVFPDLIFFASYLYQ*
Ga0132258_1276192323300015371Arabidopsis RhizosphereMLGGTHAEHMPVVKSKPVEGLEKDVFPDLLFFASYLYQ*
Ga0132256_10191041523300015372Arabidopsis RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPPAGSEKDVFPDLLFFASYLYQ*
Ga0132257_10104533223300015373Arabidopsis RhizosphereMLGGTHAEHMPVVKSKPVEGSEKDVFPDLLFFASYLYQ*
Ga0132257_10180371623300015373Arabidopsis RhizosphereKNYKLIKILLMIVINTIIIFGATHAEHMPEVKSKPMVGSEKEVFPDLIFFASYLYQ*
Ga0132255_10259860513300015374Arabidopsis RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPPEVSEKDVFPDLLFFANHLYQ*
Ga0132255_10302786913300015374Arabidopsis RhizosphereIIVINTVIILGGTHAEHMPIVKSKPVEVSEKEAFPDLIFFASYLYQ*
Ga0132255_10522149213300015374Arabidopsis RhizosphereMKHYKLIKIFLLIVVNTIVMLGGTHAEHMPVVKSKPVEGLEKDVFPDLLFFASYLYQ*
Ga0163161_1070840013300017792Switchgrass RhizosphereMIVINTIVILGGTHAEHMPVVKGKPVEGSENDVFPDLLYFASYLYQ
Ga0163161_1071214213300017792Switchgrass RhizosphereFFKMKHYKLIKIFLMIVVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLYQ
Ga0163161_1172573513300017792Switchgrass RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPVDGSENDVFPDMLYFASYLYQ
Ga0184620_1003364323300018051Groundwater SedimentMKNYKLIKIFLMIVINTIIVLGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Ga0184611_100189723300018067Groundwater SedimentMIVVNTIVILGGTHAEHMPVVKTKPVEGSENDVFPDLLYFASYLYQ
Ga0184611_133995023300018067Groundwater SedimentMIVINTIIILGGTHAEHIHVVKKEPSGGSEKDVFPDLLHFASYLYQ
Ga0184635_1013637613300018072Groundwater SedimentMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVKTKPVEGSENDVFPDLLYFASYLYQ
Ga0184635_1013893713300018072Groundwater SedimentMKRYKLIKIFLMIVINTIIMLGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYLYQ
Ga0184624_1001343233300018073Groundwater SedimentKLLKIFLLIVVNTIVILGGTHAEHMPVIKTKPLEGSENDVFPDLLYFASYLYQ
Ga0184640_1016727613300018074Groundwater SedimentKGFSNKAYLFYRFFKMKHYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFASYLYQ
Ga0184639_1018849823300018082Groundwater SedimentMKHYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLFFASYLYQ
Ga0184628_1020898023300018083Groundwater SedimentMKHYKLIKIFLLIVVNTIVILGGTHAEHMPVVKSKPVEGSDSDVFNDFLFFANHLYQ
Ga0184628_1038336523300018083Groundwater SedimentMIVINTIVILGGTHAEHMPVVKSKPVEGLENEVFPDMLYFASYLYQ
Ga0190270_1007004933300018469SoilMKHYKLIKIFLLIVVNTIVILGGTHAEHMPEVKSKPAEGSEKDVFPDLLFFASYLYQ
Ga0190270_1040068913300018469SoilMIVINTVIILGGIHAEHMPVVKTNHVEGPENEVFPDHIFFASYLYQ
Ga0190270_1095616023300018469SoilMKHYKLIKIFLLIVVNTIVILGGTHAEHMPVVKSKPVEGSDKDVSPDFLFFASHLYQ
Ga0190274_1047357323300018476SoilMNNYKLAKIFLMIVVNTIVMLGGTHAEHMPVAKSKPEEGSENDVIPDLLFFASYFYQ
Ga0190274_1089371623300018476SoilYLFYQFFKMKHYKLIKIFLLIVINTIIILGGTHAEHIQGVKKEAAGGSEKDVFPDFLFFASYLYQ
Ga0190274_1094242923300018476SoilMIVINTIIVLGGTHAEHIQAVKKDATGGPEKDVFPDLLYFASYLYQ
Ga0190274_1181119123300018476SoilMIVVNTIVILGGSHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Ga0190271_1000656933300018481SoilMKHYKLIKIFLLIVINTIVILGGTHAEHMPAVKGKPVEGSEKDVYPDFLFFASHLYQ
Ga0190271_1038612033300018481SoilLLIVVNTIVILGGTHAEHMPVVKSKPVEGSDKDDFHDLLFFASHLYE
Ga0190271_1266129823300018481SoilMKHYKLIKIFLLIVVNTIVILGGTHAEHIPAVKSKPVEGSEKDVYPDFLFFASHLYQ
Ga0173481_1003645343300019356SoilMKNYKLLKIFLLIVVNTIVILGGTHAEHMPVVKSKPVEGSDKDDFHDLLFFANHLYQ
Ga0173481_1007654633300019356SoilMIAINTIMILGGTHAEHMPVVKSKPVKGSEKEVFPDLIFFASYLYQ
Ga0173481_1028458223300019356SoilMKHYKLAKIFLMIVVNTIVILGGTHAEHMPVVKNKPVEGSENDVFPDLLYFASYLYQ
Ga0173482_1005810123300019361SoilMKHYKLVKIFLLIVVNTVVILGGTHAEHIPVIKSKPVEGSEKDVFPDLLFFASYLYQ
Ga0173482_1008127233300019361SoilAYLFYQFFKMKQYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPVDGSENDVFPDMLYFASYLYQ
Ga0173482_1011992213300019361SoilMIVINTIIVLGGTHAEHIQVVKKEPAAESEKDVFPDLLYFASYLYQ
Ga0173482_1018444113300019361SoilMLGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYLYQ
Ga0173482_1041274713300019361SoilMKNYKLAKIFLMIVVNTIVILGGTHAEHMPVVKNKLVEGSENDVFPDLLYFASYLYQ
Ga0173479_1012962823300019362SoilMIVINTIIVLGGTHAEHMRVDKKEPSGGSEKDVFPDLLYFAS
Ga0173479_1020717523300019362SoilMIVVNTIIILGGTQAEHIRSAKAKPAEGPGKDIFPDHIFFASYLYQ
Ga0173479_1021182513300019362SoilMIVVNTIVILGGTHAEHMPVVKSKPVEGLENDVFPDMLYFASYLYQ
Ga0173479_1044243413300019362SoilMKHYKLAKIFLMIVVNTIVILGGTYAEHMPVVKNKPAEGSENDVFPDLLYFASYLYQ
Ga0193702_100177433300019871SoilMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Ga0193702_100442613300019871SoilFRSMIVINTIIMLGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYLYQ
Ga0193703_100079333300019876SoilLSYQFFNMKRYKLIKIFLMIVINTIIMLGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYLYQ
Ga0193741_102787723300019884SoilMKNYKLLKIFLLIVVNTIVILGGTHAEHMPVVKSKAVEGSDKDDFHDILFFANHLYQ
Ga0193693_102240423300019996SoilMIVINTIIMLGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYLYQ
Ga0193692_101173023300020000SoilMIVINTIIVLGGTHAEHMQGAKKEAAIGSEKDVFPDFLFFAGYLYQ
Ga0193692_108088023300020000SoilLYNKPYLFYQFFKMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPVEGPENDVFPDLLYFASYLYQ
Ga0193740_100155233300020009SoilMKHYKLIKIFLLIVVNTIVILGGTHAEHMPVVKSKPVEESDKDVSPDFLFFASHLYQ
Ga0193696_100213953300020016SoilMIVVNTIVILGGTHAERMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Ga0193738_1000244153300020020SoilMKHYKLIKIFLLIVLNTIVILGGTHAEHMPVVKNEPAEGSEKDVYPDFLFFASHLYQ
Ga0193738_100157433300020020SoilMKHYKLAKILLLIVVNTIVILGGTHAEHMPVVKSKPVEGTENDVFPDLLYFASYLYQ
Ga0193738_100261273300020020SoilMKHYKLIKIFLLIVANTIVILGGTHAEHMPVVKTKPVEGSDTDVFHDFLFFANHLYQ
Ga0210380_1014081413300021082Groundwater SedimentINFLKMKHYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEPAAESEKDVFPDLLYFASYLYQ
Ga0193694_1000005143300021415SoilMKHYKIIKIFLLIVVNTIVILEGTHAEHMPIVKSKPVEGSEKDVFPDLLFFASYLYQ
Ga0222622_1022335523300022756Groundwater SedimentMKHYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFASYLYQ
Ga0222622_1098416623300022756Groundwater SedimentMIVINTIIVLGGTHAEHIQVDKKEPAGASEKDVFPDLLYFASYLYQ
Ga0247746_102677623300022886SoilMIVVNTIVILGGTYAEHMPVVKNKPVEGSENDVFPDLLYFASYLY
Ga0247746_107730013300022886SoilMIAINTIMILGGTHAEHMPVVKTKPVKGSEKEVFPDLIFFASYLYQ
Ga0247745_109645023300022898SoilMLGGTHAEHIQVVKKEPAGGSEKDVFPDLLYFASYL
Ga0247795_100666833300022899SoilMIVVNTIVILGGTYAEHMPVVKNKPVEGSENDVFPDLLYFASYLYQ
Ga0247795_100682813300022899SoilMIVVNTIVILGGTHAEHMPVVKNNPPAGSEKDVFPDLLFFANHLYQ
Ga0247795_104457913300022899SoilMIAINTIIILGGTHAERMPVVKSKQVEGSEKEVSPDLIFFASYLYQ
Ga0247774_118241313300022903Plant LitterLFNQFFKMKHYKLIKIFLMIVINTIVILGGTHAEHMPVVKSKPVDGSENDVFPDLLYFASYLYQX
Ga0247766_110108613300022906Plant LitterMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFA
Ga0247797_101115413300023057SoilMRNNKLIKIFLMIVINTIIILGGTHAEHMPVVKPRPVEGSEKDVFPDFMFFASFLYQ
Ga0247797_102666323300023057SoilMIVINTIIILGGTHAEHIPVVKNKPVDESEKDVFPDHIF
Ga0247791_100703423300023062SoilMKHYKLAKIFLMIVVNTIVILGGTYAEHMPVVKNKPVEGSENDVFPDLLYFASYLYQ
Ga0247791_105421213300023062SoilMIVVNTIVILGGTHAEHMPVVKSKPVDGSENDVFPDMLYFAS
Ga0247751_110328023300023069SoilQFFKMKHYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFASYLY
Ga0247802_102903523300023077SoilFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Ga0247756_111285713300023078Plant LitterMIVINTIVILGGTHAEHMPVVKSKPVDGSENDVFPDLLYFASYLYQ
Ga0247798_100964523300023260SoilMIVVNTIVILGGTHAEHIPLIKSKSVEESEKDVFPDLLFFASYLYQ
Ga0247800_101359433300023263SoilKMKNYKLVKIFLMIVINTIVMLGGTHAEHIPVVKSKSAEGSEKDIYPDHIFFASYLYQ
Ga0247800_105612913300023263SoilGTHAEHMPVVKSKPVEGSDKDDFHDLLFFANHLYQ
Ga0247780_101311333300023265Plant LitterMIVVNTIVILGGTHAEHMPVVKSKPVDGSENDVFPDLLYFASYLYQ
Ga0247789_113668423300023266SoilGGTHAEHIPVVKSKSAEGSEKDIYPDHIFFASYLYQ
Ga0247794_1003332633300024055SoilIFLMIVVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLYQ
Ga0207656_1006418323300025321Corn RhizosphereMIVVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLYQ
Ga0207682_1004973033300025893Miscanthus RhizosphereKMKNYKLIKIFLIIVINTIIVLGGTHAEHIQVDKKEPAGASEKDVFPDLLYFASYLYQ
Ga0207682_1025231813300025893Miscanthus RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFDSYLYQ
Ga0207642_1048780923300025899Miscanthus RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLYFASYLYQ
Ga0207685_1018717023300025905Corn, Switchgrass And Miscanthus RhizosphereMIVVNTIVILGGTHAEHMPVVKNKPLEGSEKDVFPDLLFFAGYLYQ
Ga0207684_1066928213300025910Corn, Switchgrass And Miscanthus RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLL
Ga0207654_1130084613300025911Corn RhizosphereFKMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFAGYLYQ
Ga0207662_1037833823300025918Switchgrass RhizosphereMIVVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLYFASYLYQ
Ga0207650_1010103143300025925Switchgrass RhizosphereFLMIVINTIIIFGATHAEHIPEIKSKPVEGLEKEVFPDLIFFASYLYQ
Ga0207659_1067343323300025926Miscanthus RhizosphereMKHYKFVKIFLLIVVNTVVILGGTHAEHIPVIKSKPVEGSEKDVFPDLLFFASYLYQ
Ga0207701_1115600023300025930Corn, Switchgrass And Miscanthus RhizosphereAFIKKHICPINFFKMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Ga0207706_1052680923300025933Corn RhizosphereMKHYKLAKIFLLIVVNTIVILGGTHAEHIPAVKTKPVEGSEKDIYPDHIFFASYLYQ
Ga0207686_10000669143300025934Miscanthus RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFAGYLYQ
Ga0207686_1012329713300025934Miscanthus RhizosphereKAYLFYQFFKMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPPEVSEKDVYPDLLFFASHLYQ
Ga0207686_1106166023300025934Miscanthus RhizosphereVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Ga0207669_1058853423300025937Miscanthus RhizosphereMKHYKLIKIFLMIVINTIIVLGGTHAEHIQVVKKEPAAGSEKDVFPDLLYFASYLYQ
Ga0207691_1101851813300025940Miscanthus RhizosphereFLMIVINTIIVLGGTHAEHIQVVKKEPAAGSEKDVFPDLLYFASYLYQ
Ga0207691_1141241423300025940Miscanthus RhizosphereMKNYKLIKIFLIIVINTIIVLGGTHAEHIQVDKKEPAGASEKDVFPDLLYFASYLYQ
Ga0207711_1039244513300025941Switchgrass RhizosphereMIVMNTIVILGGTHAEHMPVVKSKPSGGSEKDVFPDLLYFASYLY
Ga0207689_1001119373300025942Miscanthus RhizosphereMIVINTIIILGGTHAEHIPIVKNEPAVVSEKEVFPDLIFFASYLYQ
Ga0207712_1003846013300025961Switchgrass RhizosphereQFFKMKHYKLIKIFLMIVVNTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLY
Ga0207640_1107270023300025981Corn RhizosphereMKHYKLIKIFLMIVINTIIVLGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Ga0207658_1056510913300025986Switchgrass RhizosphereTIIVLGGTNAEHIQVVKKEPAAGSEKEVFPDLLYFASYLYQ
Ga0207703_1063104313300026035Switchgrass RhizosphereMIVINTIVILGGTHAEHMPVVKSKPSGGSEKDVFPDLLYFASYLYQ
Ga0207639_1117082023300026041Corn RhizosphereMKHYKLIKIFLMIVMNTIVILGGTHAEHMPVVKSKPSGGSEKDVFPDLLFFASYLYQ
Ga0207641_1033599223300026088Switchgrass RhizosphereMIVINTIIIFGATHAEHIPEIKSKPVEGLEKEVFPDLIFFASYLYQ
Ga0207648_1009799123300026089Miscanthus RhizosphereMIVINTIIVLGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFASYLYQ
Ga0207676_1038073013300026095Switchgrass RhizosphereMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFAG
Ga0207676_1149002513300026095Switchgrass RhizosphereKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPLEGSEKDVFPDLLFFASYLYQ
Ga0207674_1010659243300026116Corn RhizosphereMTAINTIMILGGTHAEHMPVVKSKPVEGSEKEVFPDLIFFASYLYQ
Ga0207698_1036519533300026142Corn RhizosphereMIVINTIVILGGTHAEHIPVVKSKPLEGSEKDVFPDLLFFAGYLYQ
Ga0209387_115657723300027639Agricultural SoilKAYLFYQFLTMKHYKLIKIFLLIVINTIVILGGTHAEHMPAVKGKPVEGSEKDVYPDFLFFASHLYQ
Ga0209486_1000579053300027886Agricultural SoilMKHYKLIKIFLLIVVNTIVLLGGTHAEHMPDVKTKPVEGSEKDIYPDFLFFASQLYQ
Ga0207428_1012181623300027907Populus RhizosphereMIVINTIIILGGTHAEHMPVVKTRPPEGSEKEVFPDFMFFASFLYQ
Ga0207428_1013673123300027907Populus RhizosphereMKHYKLIKIFLMIVINTIIILGGTHAEHIQVVKKEPVRDSEKDVFPDLLYFASYLYQ
Ga0209382_1056138313300027909Populus RhizosphereMIVINTVIILGGTHAEHMPVVKTKPVERSEKDIFPDHLFFASHLYQ
Ga0268265_1258013313300028380Switchgrass RhizosphereTIMILGGTHAEHMPVVKSKPVESSEKEVFPDLILFASYLYQ
Ga0268264_1065734333300028381Switchgrass RhizosphereNICTIKFLKMKHYKRIKIFLMIVMNTIVILGGTHAEHMPVVKSKPSGGSEKDVFPDLLYFASYLYQ
Ga0307497_1025397413300031226SoilYNKAYLSYQFFKMKHYKLIKIFLMIVVNTIVILGGTHAEHMPVVKSKPSEGSEKDAFPDLIFFASYFYQ
Ga0310888_1006234513300031538SoilMKHYKLIKIFLMIVINTIIVLGGTHAEHIKVVKNQPTEGSEKDVFPDLLYFASYLYQ
Ga0310888_1034315713300031538SoilMKHYKLIKIFLLIVVNTIVILGGTHAEHMPVVKSKPAEGSENDVFPDLLYFASYLYQ
Ga0310888_1108401513300031538SoilMKNYRLIKIFLMIVINTIIIFGGTHAEHMPIVKDKPVEGSEKEVFPDLIFFASYLYQ
Ga0310813_1046683523300031716SoilMIVVNTIIILGGTQAEHIRSIKTKAAEGQGKDIFPDHLFFASYLYQ
Ga0310907_1038825123300031847SoilIVLGGTHAEHIKVVKNQPTGGSEKDVFPDLLYFASYLYQ
Ga0310904_1004105823300031854SoilMKHYKLIKIFLMIVINTIIVLGGTHAEHIKVVKNQPTGGSEKDVFPDLLYFASYLYQ
Ga0310900_1129046813300031908SoilIVVNTVVILGGTHAEHIPLIKSKPVEESEKDVFPDLLFFASYLYQ
Ga0310900_1146726723300031908SoilMIVINTIIIFGGTHAEHMPIVKVKPVEGSEKEVFPDLIFFASYLYQ
Ga0310901_1026417723300031940SoilMIVINTIIVLGGTHAEHIQVVKKEAVGGAEKDVFPD
Ga0310885_1032146123300031943SoilILLGGTHAEHIKVVKNQPTEGSEKDVFPDLLYFASYLYQ
Ga0310902_1007938923300032012SoilMKHYKLIKIFLMIVINTIIVLGGTHAEHIKVVKNQPTEGLEKDVFPDLLYFASYLYQ
Ga0310902_1101385413300032012SoilGGTHAEHIQVVKKEAVGGSEKDVFPDLLYFASYLYQ
Ga0310906_1057710723300032013SoilMKNYRFIKIFLLIIIKTIIIFGGTHAEHIPVVESKPVKESEKEVFPDHLFFASYLYQ
Ga0310890_1050075113300032075SoilMIVINTIIVLGGTNAEHIQVVKKEPAAGSEKEVFPDLLYFASYLYQ
Ga0310890_1062796023300032075SoilINTIIILGGTHAEHIPVVESKPVKESEKEVFPDHLFFASYLYQ
Ga0310890_1076485123300032075SoilMIVINTIIIFGGTHAEHMPIVKDKPVEGSEKEVFPDLIFFASYLYQ
Ga0310890_1175333113300032075SoilMKNYKLIKIFLMIVINTIIIFGATHAEHIPEVKSRPMVGSEKEVFPDLIFFASYLYQ
Ga0310895_1060796613300032122SoilGTHAEHIKVVKNQPTEGSEKDVFPDLLYFASYLYQ
Ga0315910_100000251293300032144SoilMRNNKLIKIFLLVVINTIIILGGTHAEHATAVKVKPVEDLEKDDFPDHIFFASFLYQ
Ga0310889_1011505313300032179SoilMKHYKLVKIFLLIVVNTIVILGGTHAEHIPVIKSKPVEGSEKDVFPDLLFFASYLYQ
Ga0310896_1039490413300032211SoilMKNYRLIKIFLMIVINTIIIFGGTHAEHIPIVKDKPVEGSEKEVFPDLIFFASYLYQ
Ga0310896_1040073113300032211SoilMIVINTIIVLGGTHAEHIKVVKNQPTEGSEKDVFPDLLYFASYLYQ
Ga0364945_0169810_296_4363300034115SedimentMIVINTIIILGGTHAEHIPVVKSKPVEGSEKEVFPDLIFFASYLYQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.