Basic Information | |
---|---|
Family ID | F009930 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 311 |
Average Sequence Length | 42 residues |
Representative Sequence | QTKVSYYAPAALAARHHLDADLAAKLAGIDPLTDALVAQ |
Number of Associated Samples | 235 |
Number of Associated Scaffolds | 311 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.95 % |
% of genes near scaffold ends (potentially truncated) | 95.82 % |
% of genes from short scaffolds (< 2000 bps) | 89.39 % |
Associated GOLD sequencing projects | 219 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (51.768 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.154 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.334 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.158 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.81% β-sheet: 0.00% Coil/Unstructured: 61.19% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 311 Family Scaffolds |
---|---|---|
PF07690 | MFS_1 | 19.29 |
PF04261 | Dyp_perox | 6.43 |
PF13191 | AAA_16 | 5.79 |
PF13224 | DUF4032 | 4.50 |
PF04525 | LOR | 3.54 |
PF02656 | DUF202 | 2.57 |
PF02580 | Tyr_Deacylase | 2.25 |
PF00892 | EamA | 1.61 |
PF00291 | PALP | 1.61 |
PF10009 | DUF2252 | 1.61 |
PF03625 | DUF302 | 1.61 |
PF00196 | GerE | 1.29 |
PF00708 | Acylphosphatase | 1.29 |
PF04454 | Linocin_M18 | 1.29 |
PF13424 | TPR_12 | 1.29 |
PF12867 | DinB_2 | 1.29 |
PF00106 | adh_short | 0.96 |
PF12680 | SnoaL_2 | 0.96 |
PF00270 | DEAD | 0.96 |
PF02322 | Cyt_bd_oxida_II | 0.96 |
PF00175 | NAD_binding_1 | 0.64 |
PF14542 | Acetyltransf_CG | 0.64 |
PF07784 | DUF1622 | 0.64 |
PF07859 | Abhydrolase_3 | 0.64 |
PF02614 | UxaC | 0.64 |
PF13302 | Acetyltransf_3 | 0.64 |
PF07592 | DDE_Tnp_ISAZ013 | 0.64 |
PF00296 | Bac_luciferase | 0.64 |
PF02502 | LacAB_rpiB | 0.32 |
PF03976 | PPK2 | 0.32 |
PF03091 | CutA1 | 0.32 |
PF04199 | Cyclase | 0.32 |
PF14690 | zf-ISL3 | 0.32 |
PF08281 | Sigma70_r4_2 | 0.32 |
PF13278 | Obsolete Pfam Family | 0.32 |
PF13602 | ADH_zinc_N_2 | 0.32 |
PF04542 | Sigma70_r2 | 0.32 |
PF03060 | NMO | 0.32 |
PF07992 | Pyr_redox_2 | 0.32 |
PF03116 | NQR2_RnfD_RnfE | 0.32 |
PF00230 | MIP | 0.32 |
PF01842 | ACT | 0.32 |
PF00111 | Fer2 | 0.32 |
PF01740 | STAS | 0.32 |
PF00211 | Guanylate_cyc | 0.32 |
PF13659 | Obsolete Pfam Family | 0.32 |
PF00355 | Rieske | 0.32 |
PF13671 | AAA_33 | 0.32 |
PF00313 | CSD | 0.32 |
PF09660 | DUF2397 | 0.32 |
PF00004 | AAA | 0.32 |
PF01027 | Bax1-I | 0.32 |
PF03631 | Virul_fac_BrkB | 0.32 |
PF06500 | FrsA-like | 0.32 |
PF14027 | Questin_oxidase | 0.32 |
PF01654 | Cyt_bd_oxida_I | 0.32 |
PF04715 | Anth_synt_I_N | 0.32 |
PF06737 | Transglycosylas | 0.32 |
PF08241 | Methyltransf_11 | 0.32 |
PF08240 | ADH_N | 0.32 |
PF01648 | ACPS | 0.32 |
PF00165 | HTH_AraC | 0.32 |
PF02467 | Whib | 0.32 |
PF00083 | Sugar_tr | 0.32 |
PF13378 | MR_MLE_C | 0.32 |
PF01425 | Amidase | 0.32 |
COG ID | Name | Functional Category | % Frequency in 311 Family Scaffolds |
---|---|---|---|
COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 6.43 |
COG4894 | Putative phospholipid scramblase YxjI, Tubby2 superfamily | Lipid transport and metabolism [I] | 3.54 |
COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 2.57 |
COG1490 | D-aminoacyl-tRNA deacylase | Translation, ribosomal structure and biogenesis [J] | 2.25 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 1.61 |
COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.96 |
COG1904 | Glucuronate isomerase | Carbohydrate transport and metabolism [G] | 0.64 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.64 |
COG4828 | Uncharacterized membrane protein | Function unknown [S] | 0.64 |
COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 0.64 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.64 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.32 |
COG1324 | Divalent cation tolerance protein CutA | Inorganic ion transport and metabolism [P] | 0.32 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.32 |
COG1805 | Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrB | Energy production and conversion [C] | 0.32 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.32 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.32 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.32 |
COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.32 |
COG4658 | Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfD subunit | Energy production and conversion [C] | 0.32 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.32 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.32 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.32 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.32 |
COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 0.32 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.32 |
COG1271 | Cytochrome bd-type quinol oxidase, subunit 1 | Energy production and conversion [C] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 51.77 % |
Unclassified | root | N/A | 48.23 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000156|NODE_c0451918 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300001976|JGI24752J21851_1041685 | Not Available | 615 | Open in IMG/M |
3300003368|JGI26340J50214_10167593 | Not Available | 547 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10051316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1568 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10214180 | Not Available | 782 | Open in IMG/M |
3300005332|Ga0066388_102651915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
3300005332|Ga0066388_108113584 | Not Available | 525 | Open in IMG/M |
3300005337|Ga0070682_100587095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 877 | Open in IMG/M |
3300005434|Ga0070709_10009998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5244 | Open in IMG/M |
3300005435|Ga0070714_101258257 | Not Available | 722 | Open in IMG/M |
3300005439|Ga0070711_101846974 | Not Available | 530 | Open in IMG/M |
3300005445|Ga0070708_100136894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2269 | Open in IMG/M |
3300005445|Ga0070708_100315115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1474 | Open in IMG/M |
3300005467|Ga0070706_101008655 | Not Available | 767 | Open in IMG/M |
3300005538|Ga0070731_10209760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1293 | Open in IMG/M |
3300005545|Ga0070695_100322466 | Not Available | 1149 | Open in IMG/M |
3300005559|Ga0066700_10835014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 617 | Open in IMG/M |
3300005561|Ga0066699_10653556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 753 | Open in IMG/M |
3300005568|Ga0066703_10130597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1499 | Open in IMG/M |
3300005569|Ga0066705_10983395 | Not Available | 500 | Open in IMG/M |
3300005602|Ga0070762_10790445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia datiscae | 641 | Open in IMG/M |
3300005610|Ga0070763_10147858 | Not Available | 1224 | Open in IMG/M |
3300005610|Ga0070763_10291852 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300005764|Ga0066903_103018038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 912 | Open in IMG/M |
3300005764|Ga0066903_103801811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 811 | Open in IMG/M |
3300005841|Ga0068863_100299878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. | 1559 | Open in IMG/M |
3300005842|Ga0068858_100633355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1038 | Open in IMG/M |
3300005844|Ga0068862_100670332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1002 | Open in IMG/M |
3300006046|Ga0066652_101838489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
3300006057|Ga0075026_100245453 | Not Available | 959 | Open in IMG/M |
3300006163|Ga0070715_10086191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1436 | Open in IMG/M |
3300006173|Ga0070716_100069895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2059 | Open in IMG/M |
3300006175|Ga0070712_101725087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
3300006176|Ga0070765_100990498 | Not Available | 795 | Open in IMG/M |
3300006755|Ga0079222_10340082 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300006755|Ga0079222_12501517 | Not Available | 518 | Open in IMG/M |
3300006800|Ga0066660_11580155 | Not Available | 519 | Open in IMG/M |
3300006806|Ga0079220_10878735 | Not Available | 692 | Open in IMG/M |
3300006954|Ga0079219_11830979 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300009088|Ga0099830_10911028 | Not Available | 727 | Open in IMG/M |
3300009088|Ga0099830_11689738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 528 | Open in IMG/M |
3300009090|Ga0099827_12005734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 502 | Open in IMG/M |
3300009098|Ga0105245_13150841 | Not Available | 511 | Open in IMG/M |
3300009101|Ga0105247_10219225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1287 | Open in IMG/M |
3300009137|Ga0066709_101643742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 916 | Open in IMG/M |
3300009672|Ga0116215_1125754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1144 | Open in IMG/M |
3300009672|Ga0116215_1542904 | Not Available | 502 | Open in IMG/M |
3300009700|Ga0116217_10804410 | Not Available | 579 | Open in IMG/M |
3300010048|Ga0126373_13018641 | Not Available | 525 | Open in IMG/M |
3300010152|Ga0126318_10611861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
3300010341|Ga0074045_10773634 | Not Available | 608 | Open in IMG/M |
3300010358|Ga0126370_11747037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
3300010360|Ga0126372_10086099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2306 | Open in IMG/M |
3300010361|Ga0126378_10773992 | Not Available | 1070 | Open in IMG/M |
3300010361|Ga0126378_11018749 | Not Available | 931 | Open in IMG/M |
3300010361|Ga0126378_12565248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
3300010366|Ga0126379_11548813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
3300010379|Ga0136449_100544117 | Not Available | 1999 | Open in IMG/M |
3300010379|Ga0136449_101275553 | Not Available | 1148 | Open in IMG/M |
3300010379|Ga0136449_101955956 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300010379|Ga0136449_102222570 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300010379|Ga0136449_102570950 | Not Available | 727 | Open in IMG/M |
3300010398|Ga0126383_10264161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1698 | Open in IMG/M |
3300010398|Ga0126383_11242309 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300010398|Ga0126383_13056121 | Not Available | 546 | Open in IMG/M |
3300010398|Ga0126383_13402109 | Not Available | 520 | Open in IMG/M |
3300010400|Ga0134122_10145509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1921 | Open in IMG/M |
3300010876|Ga0126361_10409638 | Not Available | 613 | Open in IMG/M |
3300010876|Ga0126361_10484287 | Not Available | 1397 | Open in IMG/M |
3300010876|Ga0126361_10928318 | Not Available | 701 | Open in IMG/M |
3300011119|Ga0105246_11880454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 574 | Open in IMG/M |
3300011269|Ga0137392_10762231 | Not Available | 800 | Open in IMG/M |
3300012096|Ga0137389_11634058 | Not Available | 540 | Open in IMG/M |
3300012199|Ga0137383_11362736 | Not Available | 503 | Open in IMG/M |
3300012200|Ga0137382_10090826 | All Organisms → cellular organisms → Bacteria | 1998 | Open in IMG/M |
3300012201|Ga0137365_11213251 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300012206|Ga0137380_10198152 | Not Available | 1822 | Open in IMG/M |
3300012206|Ga0137380_11714721 | Not Available | 512 | Open in IMG/M |
3300012209|Ga0137379_10025590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5674 | Open in IMG/M |
3300012210|Ga0137378_10717420 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300012210|Ga0137378_11852675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
3300012350|Ga0137372_10993111 | Not Available | 586 | Open in IMG/M |
3300012359|Ga0137385_10186167 | Not Available | 1817 | Open in IMG/M |
3300012929|Ga0137404_12139457 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300013105|Ga0157369_12218143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 557 | Open in IMG/M |
3300013307|Ga0157372_10532370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1369 | Open in IMG/M |
3300013768|Ga0120155_1075197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 965 | Open in IMG/M |
3300014165|Ga0181523_10330748 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300014168|Ga0181534_10079596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1627 | Open in IMG/M |
3300014501|Ga0182024_11029812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 979 | Open in IMG/M |
3300014654|Ga0181525_10429538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
3300014969|Ga0157376_10368054 | Not Available | 1381 | Open in IMG/M |
3300016294|Ga0182041_11590313 | Not Available | 603 | Open in IMG/M |
3300016319|Ga0182033_10224256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1511 | Open in IMG/M |
3300016341|Ga0182035_10127456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1915 | Open in IMG/M |
3300016387|Ga0182040_11709152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. TBRC 11911 | 537 | Open in IMG/M |
3300016387|Ga0182040_11854287 | Not Available | 517 | Open in IMG/M |
3300016404|Ga0182037_10545116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 978 | Open in IMG/M |
3300016445|Ga0182038_10318304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1278 | Open in IMG/M |
3300016445|Ga0182038_10486882 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300017821|Ga0187812_1142715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
3300017823|Ga0187818_10356803 | Not Available | 646 | Open in IMG/M |
3300017823|Ga0187818_10365179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 638 | Open in IMG/M |
3300017924|Ga0187820_1002164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4464 | Open in IMG/M |
3300017924|Ga0187820_1246376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 572 | Open in IMG/M |
3300017926|Ga0187807_1031003 | Not Available | 1655 | Open in IMG/M |
3300017932|Ga0187814_10006359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4744 | Open in IMG/M |
3300017937|Ga0187809_10145404 | Not Available | 818 | Open in IMG/M |
3300017942|Ga0187808_10051013 | Not Available | 1751 | Open in IMG/M |
3300017970|Ga0187783_10311332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1148 | Open in IMG/M |
3300018009|Ga0187884_10471444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 504 | Open in IMG/M |
3300018012|Ga0187810_10254165 | Not Available | 721 | Open in IMG/M |
3300018044|Ga0187890_10324751 | Not Available | 864 | Open in IMG/M |
3300018085|Ga0187772_10345147 | Not Available | 1028 | Open in IMG/M |
3300018085|Ga0187772_10683510 | Not Available | 735 | Open in IMG/M |
3300018086|Ga0187769_11387971 | Not Available | 531 | Open in IMG/M |
3300020581|Ga0210399_11062794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 649 | Open in IMG/M |
3300020582|Ga0210395_10318304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. T12-5 | 1170 | Open in IMG/M |
3300021171|Ga0210405_10494951 | Not Available | 958 | Open in IMG/M |
3300021180|Ga0210396_10777753 | Not Available | 823 | Open in IMG/M |
3300021181|Ga0210388_11175317 | Not Available | 652 | Open in IMG/M |
3300021388|Ga0213875_10569267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 546 | Open in IMG/M |
3300021401|Ga0210393_10126934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2043 | Open in IMG/M |
3300021401|Ga0210393_10441121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1062 | Open in IMG/M |
3300021402|Ga0210385_10974893 | Not Available | 651 | Open in IMG/M |
3300021403|Ga0210397_11010320 | Not Available | 645 | Open in IMG/M |
3300021404|Ga0210389_11408705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinomycetospora | 532 | Open in IMG/M |
3300021405|Ga0210387_10792225 | Not Available | 838 | Open in IMG/M |
3300021407|Ga0210383_11339126 | Not Available | 597 | Open in IMG/M |
3300021475|Ga0210392_10715773 | Not Available | 746 | Open in IMG/M |
3300021478|Ga0210402_10974551 | Not Available | 775 | Open in IMG/M |
3300021560|Ga0126371_10001139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 22333 | Open in IMG/M |
3300024254|Ga0247661_1044915 | Not Available | 805 | Open in IMG/M |
3300025703|Ga0208357_1009093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4635 | Open in IMG/M |
3300025900|Ga0207710_10427926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 682 | Open in IMG/M |
3300025906|Ga0207699_10280159 | Not Available | 1158 | Open in IMG/M |
3300025916|Ga0207663_10240834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1327 | Open in IMG/M |
3300025922|Ga0207646_10528130 | Not Available | 1062 | Open in IMG/M |
3300025927|Ga0207687_10740969 | Not Available | 836 | Open in IMG/M |
3300025928|Ga0207700_10110122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2214 | Open in IMG/M |
3300025934|Ga0207686_10387607 | Not Available | 1061 | Open in IMG/M |
3300025935|Ga0207709_10036241 | All Organisms → cellular organisms → Bacteria | 2923 | Open in IMG/M |
3300025938|Ga0207704_10425189 | Not Available | 1054 | Open in IMG/M |
3300025939|Ga0207665_10662671 | Not Available | 819 | Open in IMG/M |
3300026317|Ga0209154_1324170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 505 | Open in IMG/M |
3300026374|Ga0257146_1029728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 887 | Open in IMG/M |
3300026529|Ga0209806_1028452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2793 | Open in IMG/M |
3300026529|Ga0209806_1043914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2139 | Open in IMG/M |
3300027018|Ga0208475_1009928 | Not Available | 933 | Open in IMG/M |
3300027043|Ga0207800_1038691 | Not Available | 670 | Open in IMG/M |
3300027110|Ga0208488_1040132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia datiscae | 837 | Open in IMG/M |
3300027604|Ga0208324_1171632 | Not Available | 584 | Open in IMG/M |
3300027663|Ga0208990_1123863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
3300027680|Ga0207826_1214602 | Not Available | 517 | Open in IMG/M |
3300027725|Ga0209178_1391231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
3300027853|Ga0209274_10131658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1251 | Open in IMG/M |
3300027853|Ga0209274_10203995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1006 | Open in IMG/M |
3300027854|Ga0209517_10454298 | Not Available | 707 | Open in IMG/M |
3300027869|Ga0209579_10409895 | Not Available | 735 | Open in IMG/M |
3300027884|Ga0209275_10397950 | Not Available | 777 | Open in IMG/M |
3300028718|Ga0307307_10262907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
3300028784|Ga0307282_10062552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. ATCC PTA-5024 | 1679 | Open in IMG/M |
3300028784|Ga0307282_10188468 | Not Available | 984 | Open in IMG/M |
3300028800|Ga0265338_10131794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1972 | Open in IMG/M |
3300028819|Ga0307296_10018670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3645 | Open in IMG/M |
3300028877|Ga0302235_10441322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 555 | Open in IMG/M |
3300028906|Ga0308309_10603821 | Not Available | 952 | Open in IMG/M |
3300028906|Ga0308309_11259819 | Not Available | 636 | Open in IMG/M |
3300029943|Ga0311340_10284793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1586 | Open in IMG/M |
3300029951|Ga0311371_12131467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
3300029999|Ga0311339_10534905 | Not Available | 1183 | Open in IMG/M |
3300030007|Ga0311338_10606247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1125 | Open in IMG/M |
3300030013|Ga0302178_10450285 | Not Available | 567 | Open in IMG/M |
3300030054|Ga0302182_10388967 | Not Available | 584 | Open in IMG/M |
3300030056|Ga0302181_10105577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1392 | Open in IMG/M |
3300030056|Ga0302181_10489520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 520 | Open in IMG/M |
3300030490|Ga0302184_10392963 | Not Available | 540 | Open in IMG/M |
3300030520|Ga0311372_12954111 | Not Available | 516 | Open in IMG/M |
3300030580|Ga0311355_10292018 | Not Available | 1643 | Open in IMG/M |
3300030617|Ga0311356_10651236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1014 | Open in IMG/M |
3300030712|Ga0307921_1005784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1261 | Open in IMG/M |
3300030739|Ga0302311_10242659 | Not Available | 1339 | Open in IMG/M |
3300031057|Ga0170834_101952577 | Not Available | 1422 | Open in IMG/M |
3300031199|Ga0307495_10223023 | Not Available | 529 | Open in IMG/M |
3300031236|Ga0302324_100187207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3325 | Open in IMG/M |
3300031525|Ga0302326_11969012 | Not Available | 756 | Open in IMG/M |
3300031525|Ga0302326_13660565 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031543|Ga0318516_10285502 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300031543|Ga0318516_10867464 | Not Available | 509 | Open in IMG/M |
3300031544|Ga0318534_10211435 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300031544|Ga0318534_10702442 | Not Available | 571 | Open in IMG/M |
3300031546|Ga0318538_10584181 | Not Available | 606 | Open in IMG/M |
3300031561|Ga0318528_10693008 | Not Available | 545 | Open in IMG/M |
3300031564|Ga0318573_10799984 | Not Available | 506 | Open in IMG/M |
3300031640|Ga0318555_10014761 | Not Available | 3549 | Open in IMG/M |
3300031668|Ga0318542_10131893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1230 | Open in IMG/M |
3300031668|Ga0318542_10182328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1054 | Open in IMG/M |
3300031668|Ga0318542_10645946 | Not Available | 553 | Open in IMG/M |
3300031681|Ga0318572_10317491 | Not Available | 922 | Open in IMG/M |
3300031708|Ga0310686_117156673 | Not Available | 528 | Open in IMG/M |
3300031713|Ga0318496_10117376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1438 | Open in IMG/M |
3300031719|Ga0306917_10947056 | Not Available | 673 | Open in IMG/M |
3300031719|Ga0306917_11340912 | Not Available | 553 | Open in IMG/M |
3300031723|Ga0318493_10392610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. VRA16 Mangrove soil | 758 | Open in IMG/M |
3300031723|Ga0318493_10432501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 722 | Open in IMG/M |
3300031724|Ga0318500_10219800 | Not Available | 915 | Open in IMG/M |
3300031724|Ga0318500_10335215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 745 | Open in IMG/M |
3300031736|Ga0318501_10089312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1520 | Open in IMG/M |
3300031736|Ga0318501_10415605 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300031744|Ga0306918_11032531 | Not Available | 638 | Open in IMG/M |
3300031744|Ga0306918_11185315 | Not Available | 590 | Open in IMG/M |
3300031748|Ga0318492_10431077 | Not Available | 695 | Open in IMG/M |
3300031751|Ga0318494_10026869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2909 | Open in IMG/M |
3300031751|Ga0318494_10449425 | Not Available | 749 | Open in IMG/M |
3300031751|Ga0318494_10627884 | Not Available | 628 | Open in IMG/M |
3300031751|Ga0318494_10657759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 613 | Open in IMG/M |
3300031751|Ga0318494_10786450 | Not Available | 557 | Open in IMG/M |
3300031765|Ga0318554_10178151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 1209 | Open in IMG/M |
3300031768|Ga0318509_10069004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1850 | Open in IMG/M |
3300031768|Ga0318509_10131342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1372 | Open in IMG/M |
3300031769|Ga0318526_10170358 | Not Available | 887 | Open in IMG/M |
3300031770|Ga0318521_10020982 | All Organisms → cellular organisms → Bacteria | 3048 | Open in IMG/M |
3300031770|Ga0318521_10128605 | Not Available | 1422 | Open in IMG/M |
3300031770|Ga0318521_10698382 | Not Available | 616 | Open in IMG/M |
3300031771|Ga0318546_10353635 | Not Available | 1022 | Open in IMG/M |
3300031781|Ga0318547_10822001 | Not Available | 579 | Open in IMG/M |
3300031793|Ga0318548_10071569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1623 | Open in IMG/M |
3300031793|Ga0318548_10178714 | Not Available | 1039 | Open in IMG/M |
3300031796|Ga0318576_10228984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 876 | Open in IMG/M |
3300031798|Ga0318523_10004680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5125 | Open in IMG/M |
3300031798|Ga0318523_10038566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2200 | Open in IMG/M |
3300031799|Ga0318565_10059745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1785 | Open in IMG/M |
3300031799|Ga0318565_10336594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. VRA16 Mangrove soil | 732 | Open in IMG/M |
3300031819|Ga0318568_10836715 | Not Available | 570 | Open in IMG/M |
3300031821|Ga0318567_10044768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2266 | Open in IMG/M |
3300031821|Ga0318567_10685341 | Not Available | 581 | Open in IMG/M |
3300031823|Ga0307478_10356322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
3300031831|Ga0318564_10056259 | Not Available | 1717 | Open in IMG/M |
3300031831|Ga0318564_10115959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1192 | Open in IMG/M |
3300031832|Ga0318499_10406304 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300031832|Ga0318499_10429712 | Not Available | 504 | Open in IMG/M |
3300031833|Ga0310917_10481004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
3300031845|Ga0318511_10017332 | Not Available | 2577 | Open in IMG/M |
3300031846|Ga0318512_10451964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 649 | Open in IMG/M |
3300031879|Ga0306919_10136812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1772 | Open in IMG/M |
3300031880|Ga0318544_10289098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
3300031890|Ga0306925_10753576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1014 | Open in IMG/M |
3300031890|Ga0306925_10904825 | Not Available | 907 | Open in IMG/M |
3300031893|Ga0318536_10040562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2219 | Open in IMG/M |
3300031893|Ga0318536_10069042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1735 | Open in IMG/M |
3300031894|Ga0318522_10428055 | Not Available | 502 | Open in IMG/M |
3300031910|Ga0306923_10201410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2276 | Open in IMG/M |
3300031910|Ga0306923_10599848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1236 | Open in IMG/M |
3300031912|Ga0306921_10351231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1724 | Open in IMG/M |
3300031912|Ga0306921_10545642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
3300031912|Ga0306921_11595433 | Not Available | 709 | Open in IMG/M |
3300031941|Ga0310912_10274014 | Not Available | 1303 | Open in IMG/M |
3300031941|Ga0310912_10594118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 862 | Open in IMG/M |
3300031942|Ga0310916_11474670 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300031945|Ga0310913_10054341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2624 | Open in IMG/M |
3300031946|Ga0310910_10562390 | Not Available | 905 | Open in IMG/M |
3300031954|Ga0306926_10028095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 6567 | Open in IMG/M |
3300031954|Ga0306926_10614440 | Not Available | 1326 | Open in IMG/M |
3300031954|Ga0306926_12995836 | Not Available | 504 | Open in IMG/M |
3300031954|Ga0306926_13039516 | Not Available | 500 | Open in IMG/M |
3300031959|Ga0318530_10264340 | Not Available | 710 | Open in IMG/M |
3300031962|Ga0307479_10028846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5283 | Open in IMG/M |
3300032001|Ga0306922_11715080 | Not Available | 621 | Open in IMG/M |
3300032010|Ga0318569_10079529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1459 | Open in IMG/M |
3300032025|Ga0318507_10154776 | Not Available | 981 | Open in IMG/M |
3300032025|Ga0318507_10483146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 539 | Open in IMG/M |
3300032039|Ga0318559_10609059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
3300032042|Ga0318545_10216192 | Not Available | 687 | Open in IMG/M |
3300032044|Ga0318558_10072350 | Not Available | 1570 | Open in IMG/M |
3300032044|Ga0318558_10139070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1163 | Open in IMG/M |
3300032059|Ga0318533_10749530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus radicis (ex Gao et al. 2016) | 717 | Open in IMG/M |
3300032059|Ga0318533_11330006 | Not Available | 525 | Open in IMG/M |
3300032063|Ga0318504_10214457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 901 | Open in IMG/M |
3300032064|Ga0318510_10142550 | Not Available | 941 | Open in IMG/M |
3300032064|Ga0318510_10519314 | Not Available | 517 | Open in IMG/M |
3300032066|Ga0318514_10196308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 1056 | Open in IMG/M |
3300032066|Ga0318514_10696975 | Not Available | 540 | Open in IMG/M |
3300032068|Ga0318553_10641070 | Not Available | 556 | Open in IMG/M |
3300032068|Ga0318553_10660001 | Not Available | 547 | Open in IMG/M |
3300032089|Ga0318525_10576123 | Not Available | 575 | Open in IMG/M |
3300032091|Ga0318577_10374636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 680 | Open in IMG/M |
3300032094|Ga0318540_10020915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2727 | Open in IMG/M |
3300032174|Ga0307470_11860881 | Not Available | 511 | Open in IMG/M |
3300032180|Ga0307471_102587317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
3300032261|Ga0306920_101250855 | Not Available | 1070 | Open in IMG/M |
3300032261|Ga0306920_102550605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
3300032261|Ga0306920_102839706 | Not Available | 658 | Open in IMG/M |
3300032261|Ga0306920_103212612 | Not Available | 611 | Open in IMG/M |
3300032770|Ga0335085_12061695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 577 | Open in IMG/M |
3300032782|Ga0335082_10829916 | Not Available | 786 | Open in IMG/M |
3300032828|Ga0335080_11307307 | Not Available | 724 | Open in IMG/M |
3300032892|Ga0335081_12654357 | Not Available | 513 | Open in IMG/M |
3300032893|Ga0335069_12370511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 552 | Open in IMG/M |
3300032895|Ga0335074_10983060 | Not Available | 748 | Open in IMG/M |
3300032896|Ga0335075_10421152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1408 | Open in IMG/M |
3300032898|Ga0335072_11503520 | Not Available | 575 | Open in IMG/M |
3300033134|Ga0335073_11865840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica | 557 | Open in IMG/M |
3300033158|Ga0335077_10609964 | Not Available | 1137 | Open in IMG/M |
3300033289|Ga0310914_10095513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2548 | Open in IMG/M |
3300033289|Ga0310914_10436274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1185 | Open in IMG/M |
3300033290|Ga0318519_10854194 | Not Available | 561 | Open in IMG/M |
3300033828|Ga0334850_108146 | Not Available | 538 | Open in IMG/M |
3300034818|Ga0373950_0009161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1573 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.32% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.47% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.14% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.86% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.22% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.22% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.93% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.29% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.29% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.64% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.64% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.32% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.32% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.32% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.32% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.32% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.32% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.32% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.32% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.32% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.32% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.32% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.32% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.32% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.32% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.32% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.32% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.32% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300025703 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030712 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033828 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5 | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
NODE_04519182 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | TKVTYYSPDALAARYHLGAGLAGNLAAINALTDALVAS* |
JGI24752J21851_10416851 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | SYHAPAALAAKHHLSADLAATLSGINALTDALVAS* |
JGI26340J50214_101675931 | 3300003368 | Bog Forest Soil | GQTKVSYVAPSTLASRYDLGADLAARLAGVDPLTDALVAPGA* |
JGIcombinedJ51221_100513161 | 3300003505 | Forest Soil | WDDGGQTNVTYYSPAAIAERYGLSEELAARLAGIDPLTDALIAD* |
JGIcombinedJ51221_102141802 | 3300003505 | Forest Soil | WDDAGQTKVAYYGPAALAARYDLNTDLAAKLAVIDPLTDALVAP* |
Ga0066388_1026519151 | 3300005332 | Tropical Forest Soil | DGQTKVTYYGPAALAARYDLSADLSAELAGIDPLTSALVAPSVS* |
Ga0066388_1081135842 | 3300005332 | Tropical Forest Soil | GQTRVSYYAPAEIAARHGLGPGLEKNLAAIDALTDALVAQS* |
Ga0070682_1005870951 | 3300005337 | Corn Rhizosphere | DGQTKVSYYSPDALAARHHLGGGLAGNLAAVNVLTDALIAP* |
Ga0070709_100099981 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LVWADGAQTKVSYVAPAALGTRYGLTADLTAKLAGIGPLTDALVAP* |
Ga0070714_1012582572 | 3300005435 | Agricultural Soil | VWADGAQTKVTYTAPAALGARYGLTADLTAKLAGIDPLTDALVAP* |
Ga0070711_1018469742 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | DDGQTKVSYYSPDALAARHHLGGGLAGNLAAVNVLTDALIAP* |
Ga0070708_1001368941 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | PLKILIWDDQGQTKVSYYAPEALAARHHLSARLTANLAAINALTDALVAS* |
Ga0070708_1003151153 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | WADGQQTKVSYEAPAAIARRRGLSRELAANLTGINALTDALVTP* |
Ga0070706_1010086551 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GGQTNVTYYSPGELAARYDLSAGLAANLAGIDPLTNAVVAL* |
Ga0070731_102097601 | 3300005538 | Surface Soil | IWSDGEHTNVSYLAPGALARRYGLSADLSASFAGIDPLTDALVSA* |
Ga0070695_1003224661 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DGGQTKVSYYAPAELAARHGFGPGLEKNLAAIDALTDALVATA* |
Ga0066700_108350142 | 3300005559 | Soil | LVWADAQQTKVSYDAPAAIARRRGLSRELAANLSGINAVTDALVTP* |
Ga0066699_106535561 | 3300005561 | Soil | TKVSYYSPDALAARHHLDAGLAGNLAAVNVLTDALTAS* |
Ga0066703_101305971 | 3300005568 | Soil | LKVLVWADAQQTKVSYDAPAAIARRRGLSRELAANLTGINALTDALVTP* |
Ga0066705_109833952 | 3300005569 | Soil | SYYAPAELAARHGLGPGLEKNLAAIDVLTDALVASA* |
Ga0070762_107904451 | 3300005602 | Soil | TKVSYYAPATLAARHHLSADLAARLGAVDPITEALVAP* |
Ga0070763_101478583 | 3300005610 | Soil | KVTYYGPAALAARYDLNTDLMAKLAVIDPLTDALVAP* |
Ga0070763_102918521 | 3300005610 | Soil | IWADNGQTNVTYYAPDAVAARHHLSPDLAARLQGINPITDALISP* |
Ga0066903_1030180383 | 3300005764 | Tropical Forest Soil | GQTKVTYYAPAALAARHHLNADLAAKLSVVDPLTDALIAP* |
Ga0066903_1038018111 | 3300005764 | Tropical Forest Soil | WADGAQTKVTYVAPAALGARYQLTADLTAKLAGIDPLTDALVAP* |
Ga0068863_1002998781 | 3300005841 | Switchgrass Rhizosphere | KVSYYAPAELAARHGFGPGLEKNLAAIDALTDALVATA* |
Ga0068858_1006333552 | 3300005842 | Switchgrass Rhizosphere | KVSYYSPDALAARHHLGAGLAGNLAAVNALTDALIAP* |
Ga0068862_1006703321 | 3300005844 | Switchgrass Rhizosphere | KVSYYAPAALAAKHHLSADLAATLSGINALTDALVAS* |
Ga0066652_1018384892 | 3300006046 | Soil | KVLVWDDAGQTKVSYYAPGELAARHRLGPGLAGNLAAIDTLTDALIAP* |
Ga0075026_1002454531 | 3300006057 | Watersheds | VSYYAPAALAARHHLTADLAASMAGINALTDALVAS* |
Ga0070715_100861913 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | WDDGDQTKVSYYAPAALAAKHHLSAELAATLSGINALTDALVAS* |
Ga0070716_1000698951 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GQTKVSYYSPDALAARHHLGAGLAGNLAAVNALTDALTAS* |
Ga0070712_1017250872 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VSYAAPAELARRYSLGADLTARLAGIDTLTDALVTS* |
Ga0070765_1009904981 | 3300006176 | Soil | LIWADGSRTNVTYYSPAAIAARYGLSGELAAMLAGIDPLTDALVAE* |
Ga0079222_103400822 | 3300006755 | Agricultural Soil | EGQTKVSYYSPDELAARHHLGPELAANLAGISALTDALVAP* |
Ga0079222_125015171 | 3300006755 | Agricultural Soil | KVTYYSPAALAARYHLGAELAGNLAAVNVLTDALVAS* |
Ga0066660_115801551 | 3300006800 | Soil | DGQQTSVSYTAPAALAARHGLSEELAGRLAGIERLTDALTAE* |
Ga0079220_108787352 | 3300006806 | Agricultural Soil | EGQTRVTYYAPAALAARHHLNADLAAKLSVVDPLTDALVAP* |
Ga0079219_118309791 | 3300006954 | Agricultural Soil | EGQTKVSYYSPDELAARHHLGPELAANLVGVNALTDALVAP* |
Ga0099830_109110281 | 3300009088 | Vadose Zone Soil | QTKVSYYAPEALAARHHLSADLAANLAGIGPLTDALVAA* |
Ga0099830_116897381 | 3300009088 | Vadose Zone Soil | YYAPGPLAERHHLSADLARNLAGIDLLTDALVAP* |
Ga0099827_120057341 | 3300009090 | Vadose Zone Soil | DAGQTMVTYSTPGPLAERHHLSADLARNLAGIDPLTDALVAP* |
Ga0105245_131508412 | 3300009098 | Miscanthus Rhizosphere | LKVLVWADEAQTKVSYVAPAALGTRYGLTADLTAELAGIGPLTDALVAP* |
Ga0105247_102192251 | 3300009101 | Switchgrass Rhizosphere | KVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP* |
Ga0066709_1016437423 | 3300009137 | Grasslands Soil | VSYTAPSALAARHHLDPDLAERLAGIDTITDALVAP* |
Ga0116215_11257542 | 3300009672 | Peatlands Soil | YYSPATIAARHHLSPELAGNLAGINALTDALVAP* |
Ga0116215_15429041 | 3300009672 | Peatlands Soil | QTKISYYSPAALAASHHLTADLAASLAGINALTDALVASQRPDPGSVKARA* |
Ga0116224_104735371 | 3300009683 | Peatlands Soil | ETKVSYLAPDGLAARYGIPPDLAANLRGIDHLTDALVAA* |
Ga0116217_108044101 | 3300009700 | Peatlands Soil | KVSYYGPAALAARYDLSADLAAKLAGIDPVTDALIAQ* |
Ga0126373_130186411 | 3300010048 | Tropical Forest Soil | KVLVWADGALTKVTYVAPGALGARYRLSDDLTAKLAGIGPLTDALVAP* |
Ga0126318_106118611 | 3300010152 | Soil | KISYYSPDALAARHHLGADLAGNLAAVNALTDALIA* |
Ga0074045_107736342 | 3300010341 | Bog Forest Soil | ADEGQTKVSYYAPAALAASHHLTADLAANLAGIDTLTDALVAS* |
Ga0126370_117470371 | 3300010358 | Tropical Forest Soil | YYGPAALAARYDLSADLSTELAGIDPLTDALVAP* |
Ga0126372_100860992 | 3300010360 | Tropical Forest Soil | DDGQTKVTYYGPAALAARYDLSAGLSAKLAGIDPLTDALVAP* |
Ga0126378_107739921 | 3300010361 | Tropical Forest Soil | LIWADDGQTKVTYYSPAAQAARYDLSAELAAGLASIDPLTDALIAP* |
Ga0126378_110187491 | 3300010361 | Tropical Forest Soil | MVSYYMPAALAARHHLTSDLAAKLAGIDPLTDALIAP* |
Ga0126378_125652481 | 3300010361 | Tropical Forest Soil | MQVLIWADGGQTKVSYYAPAAVAASHRLPEDLAANLAGINALTDALVA |
Ga0126379_115488131 | 3300010366 | Tropical Forest Soil | LVWADDGQTKVTYYGPAALATRYDLSADLSAKLAGIDPLTDALVAP* |
Ga0136449_1005441171 | 3300010379 | Peatlands Soil | LKVLVWDDEGQTKVSYYAPAALAARHHLGPDLAGNLAGINALTDALVAS* |
Ga0136449_1012755531 | 3300010379 | Peatlands Soil | TKVSYYAPAALAARHHLGPELAGNLAGINGLTDALVAS* |
Ga0136449_1019559562 | 3300010379 | Peatlands Soil | PLKVLVWDDAGQTKVTYYAPAALAARYQLSADLEGNLAAINPLTDALIAP* |
Ga0136449_1022225701 | 3300010379 | Peatlands Soil | VSYSAPAWLAARYQLSDELAANLAGIDPLTDALTSR* |
Ga0136449_1025709501 | 3300010379 | Peatlands Soil | GQTKVSYYAPAALAASHHLTADLAASLAGINALTDALVASQRPDPGSVKARA* |
Ga0126383_102641611 | 3300010398 | Tropical Forest Soil | DAGETKVSYYAPGALAARHHLSADLAPRLAAVDPITDALVAP* |
Ga0126383_112423092 | 3300010398 | Tropical Forest Soil | QTKVSYWAPAVLAARHRLSPALAKNLAGIDPLTDALVAG* |
Ga0126383_130561211 | 3300010398 | Tropical Forest Soil | KVLVWDDAGQTQVTYTATAVLAARHQLGPDLAARLAGIDPLTDALVNS* |
Ga0126383_134021091 | 3300010398 | Tropical Forest Soil | KVLVWADGAQTKVSYVAPAALGTRYGLTADLTAKLAGIGPLTDALVAP* |
Ga0134122_101455091 | 3300010400 | Terrestrial Soil | DDGDQTKVSYYAPAALAAKHHLSADLAATLSGINALTDALVAS* |
Ga0126361_104096381 | 3300010876 | Boreal Forest Soil | LPLKILVWSDEGQTKVSYTSPAALAARYRLPPELAGNLAAINALTDALVNA* |
Ga0126361_104842873 | 3300010876 | Boreal Forest Soil | YLAPAALAARHHLSADLAANLAGINALTDALVAS* |
Ga0126361_109283182 | 3300010876 | Boreal Forest Soil | VLIWADEGQTKVSYYAPAALAASHHLTADLAASLSGINVLTDALVAA* |
Ga0105246_118804542 | 3300011119 | Miscanthus Rhizosphere | SYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP* |
Ga0137392_107622311 | 3300011269 | Vadose Zone Soil | KVLVWADGAQTKVTYVAPAALGARYGLTADLTAKLAGIDPLTDALVAP* |
Ga0137389_116340582 | 3300012096 | Vadose Zone Soil | VWADGPHTKVSYYAPEALAARHHLSADLAANLAGIGPLTDALVAA* |
Ga0137383_113627361 | 3300012199 | Vadose Zone Soil | QTKVSYYAPAALAARHHLDADLAAKLAGIDPLTDALVAQ* |
Ga0137382_100908261 | 3300012200 | Vadose Zone Soil | TMVTYYAPGSLAERHHLSADLARNLAGIDPLTDALVAP* |
Ga0137365_112132511 | 3300012201 | Vadose Zone Soil | QTMVTYSSPGPLAERHHLSADLARNLAGIDPLTDALVAP* |
Ga0137380_101981521 | 3300012206 | Vadose Zone Soil | AGQTKVSYNAPAWLAARHHLGEDLAGNLAGIDALTDALVAP* |
Ga0137380_117147211 | 3300012206 | Vadose Zone Soil | AGQTKVSYNAPAWLAARHHLGEDLAGNLAGIDALTDALVAL* |
Ga0137379_100255901 | 3300012209 | Vadose Zone Soil | KVSYYAPEALAARHHLSAGLTANLAAVDALTDALVAS* |
Ga0137378_107174201 | 3300012210 | Vadose Zone Soil | QTKVSYNAPAWLAARHHLGEDLAGNLAGIDALTDALVAP* |
Ga0137378_118526751 | 3300012210 | Vadose Zone Soil | GQTKVSYYSPAGLAARHHLGAGLAGNLAAIDVLTDALVAS* |
Ga0137372_109931111 | 3300012350 | Vadose Zone Soil | QTNVTYYAPGALAARHHLTADLAAKLAGIDPLTDAVVAPDP* |
Ga0137385_101861671 | 3300012359 | Vadose Zone Soil | GQTKVSYNAPAWLAARHHLGEDLAGNLAGIDALTDALVAP* |
Ga0137404_121394571 | 3300012929 | Vadose Zone Soil | DAGQTMVTYYAPGPLAERHHLSADLARNLAGIDPLTDALVAP* |
Ga0157369_122181432 | 3300013105 | Corn Rhizosphere | SYYSPDALAARHHLGAGLAGNLAAVNALTNALIAP* |
Ga0157372_105323701 | 3300013307 | Corn Rhizosphere | TKVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP* |
Ga0120155_10751972 | 3300013768 | Permafrost | TSVSYYAPGVFQVRHGLDPDLARNLAGIDALTDALVAA* |
Ga0181523_103307482 | 3300014165 | Bog | LVWADEEKTRVSYYDPAALAARHNVSADLAGNLAGIHALTDALVAS* |
Ga0181534_100795963 | 3300014168 | Bog | LIWADGNRTNVTYHTPAAIAACYGLSAELATKLAAVDPLTDALIAG* |
Ga0182024_110298122 | 3300014501 | Permafrost | PLKVLVWADGEQTKVSYLAPEALGARHHLDADLTESLAGIDPLTDALVAVSP* |
Ga0181525_104295383 | 3300014654 | Bog | KVLVWADGGQTKVSYLAPAALAARHQLTAELGARLAGIDPLTDALVAS* |
Ga0157376_103680542 | 3300014969 | Miscanthus Rhizosphere | VSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP* |
Ga0182041_115903132 | 3300016294 | Soil | WADGEQTKVSYYAPAALAASHRLPDDLAANLAGINALTDALVGS |
Ga0182033_102242561 | 3300016319 | Soil | VLVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVVP |
Ga0182035_101274564 | 3300016341 | Soil | LKVLVWADGEQTKVTYVAPAALGARYQLTADLTAKLAGIGPLTDALVAP |
Ga0182040_117091521 | 3300016387 | Soil | DDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVVP |
Ga0182040_118542871 | 3300016387 | Soil | KVSYYAPAELAARHRLGPDLEKNLAAIDSLTDALVTPA |
Ga0182037_105451161 | 3300016404 | Soil | PLKVLVWADGGQTKVSYYGPAALAARYDLSAELAAKVAAVDPLTDALIAP |
Ga0182038_103183043 | 3300016445 | Soil | LIWADDGQTKVTYYGPAALAARYDLSADLEAKLAAIDPLTDALIAP |
Ga0182038_104868822 | 3300016445 | Soil | PLKVLVWDDGGQTKVSYYAPAELAARHGLGPDLEKNLAAIDTLTDALVAAS |
Ga0187812_11427153 | 3300017821 | Freshwater Sediment | WADGGQTKVSYYAPAALAARRHLTADLAANLSGINALTDALVAS |
Ga0187818_103568032 | 3300017823 | Freshwater Sediment | SYHSSDALAARHHLSADLAGINPLTDALVAPEGEPS |
Ga0187818_103651792 | 3300017823 | Freshwater Sediment | IWADGSRTNVTYYSPEAIAARYGLNAELAAKLAGIDPLTDALVADD |
Ga0187820_10021641 | 3300017924 | Freshwater Sediment | KVTYYGPAALAARYDLNADLTAKLAAIDLLTDALIAP |
Ga0187820_12463762 | 3300017924 | Freshwater Sediment | DLPLKILIWADGSRTNVTYYTPAAIAARYGLSAELAAKLAGIDPLTDALVAD |
Ga0187807_10310032 | 3300017926 | Freshwater Sediment | LKVLVWADAKQTKVSYYAPAALAASHHLSDDLAGNLAGINALTDALVAS |
Ga0187814_100063596 | 3300017932 | Freshwater Sediment | PLKILVWDDNGQTKVSYYAAATLAARYSLPADLAAKLAIAPLADALLAP |
Ga0187809_101454041 | 3300017937 | Freshwater Sediment | KVSYYAPAALAARHHLGADLEANLAGIDALTDALVASR |
Ga0187808_100510132 | 3300017942 | Freshwater Sediment | DEGQTKVSYYAPAALAARHHLGPDLAGNLAGINALTDALVAS |
Ga0187783_103113322 | 3300017970 | Tropical Peatland | MTRMVGAGKVSYYGPDAIAAHHHLSADLAGNLAGINALTDALVAA |
Ga0187884_104714442 | 3300018009 | Peatland | VWADGVETKISYYDPRALTIRHDLSADLARNLSGIDALTDALVAS |
Ga0187810_102541652 | 3300018012 | Freshwater Sediment | SYYAPAALAARHHLPPELAGNLAGINGLTDALVAT |
Ga0187890_103247512 | 3300018044 | Peatland | DDAGQVKVSYSAPAWLAARHQLSDELAANLAGIGPLTDALIAR |
Ga0187772_103451471 | 3300018085 | Tropical Peatland | DGDQTKVSYYAPAALAARHHLPADLAASLAGINALTDALVAS |
Ga0187772_106835101 | 3300018085 | Tropical Peatland | IWADGEQTRVSYYAPAALAARHHLSDDLAGNLAGINALTDALVAS |
Ga0187772_110754161 | 3300018085 | Tropical Peatland | TQVSYVDPAVVAARYDLSPELAAALAGIHALTDALVAG |
Ga0187769_113879711 | 3300018086 | Tropical Peatland | KVSYYSPSALAASHHLSADLAANLSGINALTDALVAF |
Ga0210399_110627942 | 3300020581 | Soil | MGRPRAAKVSYNAPAWLTARHHLADDLAANLAGVDQLTDALITP |
Ga0210395_103183041 | 3300020582 | Soil | VLVWADGAQTKVSYAAPAALGARYGLTADLTAKLAGIDPLTDTLVAP |
Ga0210405_104949512 | 3300021171 | Soil | VLIWSDKGQTKVSYYAPTALAARHHLGPELAGNLAGINGLTDALVASSHGQDGNPAIVI |
Ga0210396_107777532 | 3300021180 | Soil | GVGGDGDRRTKVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP |
Ga0210388_111753172 | 3300021181 | Soil | EGQTKVSYYAPAALAARHHLGADLAGNLAGINALTDALVAA |
Ga0213875_105692672 | 3300021388 | Plant Roots | VSYYAPEALAARHHLGPELAGNLAGISAITDALVAS |
Ga0210393_101269341 | 3300021401 | Soil | KVTYVAPAALGARYGLTADLTAKLAGIDPLTDALVAP |
Ga0210393_104411211 | 3300021401 | Soil | DEGQTKVSYTSPAALAARYQLPPELAGNLAAINALTDALVSS |
Ga0210385_109748931 | 3300021402 | Soil | KVLVWADEGQTKVSYYAPAALAARHHLGADLAGNLAGINALTDALVAA |
Ga0210397_110103201 | 3300021403 | Soil | PSRQSVAAALATRHHLTADLAASLAGVNALTDTLVAS |
Ga0210389_114087051 | 3300021404 | Soil | WDDDGQTKVSYYDPAALAARHQVPAGLAGNLAAINGLTDALVAP |
Ga0210387_107922252 | 3300021405 | Soil | DEGETKISYVTPAALAARHRLSADLAGNLAAIEQLTDALVAP |
Ga0210383_113391262 | 3300021407 | Soil | DEGQTKVSYYAPAALAARHHLGPELEGNLAGINGLTDALVAS |
Ga0210392_107157732 | 3300021475 | Soil | LKVLVWADGAQTKVSYAAPAALGARYGLTADLTAKLAGIDQLTDALVAP |
Ga0210402_109745512 | 3300021478 | Soil | KVSYYAPATLASRYDLGADLAARLAGVDPLTDALVAPDA |
Ga0126371_1000113924 | 3300021560 | Tropical Forest Soil | LKVLVWDDDGQTKVTYYSPDALAARYHLGAGLAGNLAAINALTDALVAS |
Ga0247661_10449153 | 3300024254 | Soil | QTKVSYYSPDALAARHHLGAGLAGNLAAVNALTDALTAS |
Ga0208357_10090935 | 3300025703 | Arctic Peat Soil | KVLVWADGDQVKVSYVAPPVLAARRGLPADLAQNLAGIDGLTDALVAP |
Ga0207710_104279262 | 3300025900 | Switchgrass Rhizosphere | KVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP |
Ga0207699_102801592 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VWSDGEQTVVSYTAPAELAARHHLSPELAQNLAGIEPLTDALVDW |
Ga0207663_102408341 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GQTKVSYYSPDELAARHHLGPGLAANLAGVNALTDALVAP |
Ga0207646_105281302 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TKVSYYSPDALAARHHLGAGLAGNLAAVNTLTDALIAP |
Ga0207687_107409692 | 3300025927 | Miscanthus Rhizosphere | SYYAPAELAARHGFGPGLEKNLAAIDALTDALVATA |
Ga0207700_101101221 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ISYHAPAALAAKHHLSADLAATLSGINALTDALVAS |
Ga0207686_103876071 | 3300025934 | Miscanthus Rhizosphere | SYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP |
Ga0207709_100362414 | 3300025935 | Miscanthus Rhizosphere | GDQTKVSYYAPAALAAKHHLSADLAATLSGINALTDALVAS |
Ga0207704_104251891 | 3300025938 | Miscanthus Rhizosphere | QTKVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP |
Ga0207665_106626712 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GMKPFAVIDQADEGQTKVSYYAPAALAASHHLTADLAANLAGINALTDTLAAS |
Ga0209154_13241701 | 3300026317 | Soil | PLKVLVWADAQQTKVSYDAPAAIARRRGLSRELAANLTGINAVTDALVTP |
Ga0257146_10297281 | 3300026374 | Soil | TKVSYYSPDALAARHHLGAGLAGNLAAVNALTDALTAS |
Ga0209806_10284521 | 3300026529 | Soil | VWADAQQTKVSYDAPAAIARRRGLSRELAANLTGINALTDALVTP |
Ga0209806_10439141 | 3300026529 | Soil | VWADAQQTKVSYDAPAAIARRRGLSRELAANLSGINAVTDALVTP |
Ga0208475_10099281 | 3300027018 | Soil | GQTNVSYYAPAELAARHRLGPGLAGNLAAIGTLTDALVAP |
Ga0207800_10386912 | 3300027043 | Tropical Forest Soil | VLIWADGDQAKVSYYAPAALAARHQLPADLAANLAGINALTDALVAS |
Ga0208488_10401321 | 3300027110 | Forest Soil | VSYYAPATLAARHHLSADLAARLGAVDPITEALVAP |
Ga0208324_11716321 | 3300027604 | Peatlands Soil | LKVLVWDDEGQTKVSYYAPAALAARHHLGPDLAGNLAGINALTDALVAS |
Ga0208990_11238632 | 3300027663 | Forest Soil | VWADGEQTKVSSVAPSALTARHHLPMDLVKNVPGIVGLTDALVAP |
Ga0207826_12146022 | 3300027680 | Tropical Forest Soil | KVTYESPTSIAARHGLTPDLAARLAGIDPLTDALVADG |
Ga0209178_13912311 | 3300027725 | Agricultural Soil | SYYSPDALAARHHLGADLAGNLAAVNALTDALIAS |
Ga0209274_101316582 | 3300027853 | Soil | KVLVWADGDQTKVSYYTPAAIAANHNLGADLAGNLAAINVLTDALVAA |
Ga0209274_102039952 | 3300027853 | Soil | AGDTKVSYYAPATLAARHHLSADLAARLAAIDPITDALVAP |
Ga0209517_104542981 | 3300027854 | Peatlands Soil | KVSYYSPAAIAARHHLSAELAGNLAGINALTDALIVP |
Ga0209579_104098951 | 3300027869 | Surface Soil | VSYYAPAALAASHHLSDDLAGNLAGINALTDALVAS |
Ga0209275_103979502 | 3300027884 | Soil | SYYAPAAIAARHHLRPELAGNLAGINGLTDALVASQP |
Ga0307307_102629071 | 3300028718 | Soil | VLEVCRVVLVWDDAGQTKVSYYAPAELAARHRLGPGLAGNLAAIGTLTDALVAP |
Ga0307282_100625521 | 3300028784 | Soil | LEVRRVVLVWDDAGQTKVSYYAPAELAARHRLGPGLAGNLAAIGTLTDALVAP |
Ga0307282_101884681 | 3300028784 | Soil | VLVWDDAGQTKVSYYAPAELAARHRLGPGLAGNLAAIGTLT |
Ga0265338_101317945 | 3300028800 | Rhizosphere | WADGNRTNVTYYSPAAIAARYGLSDELAARLAGIDPLTDALVAD |
Ga0307296_100186702 | 3300028819 | Soil | VLVWDDAGQTKVSYYAPAELAARHRLGPGLAGNLAAIGTLTDALVAP |
Ga0302235_104413221 | 3300028877 | Palsa | ADGSRTNVTYYSPAAIAARYDLSAELAANLAGLDPLTDALVAQ |
Ga0308309_106038212 | 3300028906 | Soil | LVWADGAQTKVTYVAPAAVGARYGLTADLTAKLAGIDPLTDALVAP |
Ga0308309_112598191 | 3300028906 | Soil | IWSDSGQTKISYYAPAALAARHHIAPELASNLGAVNALTDALIAP |
Ga0311340_102847933 | 3300029943 | Palsa | WADGIRTNVTYYTPAALAARHGLSAELAAKLAGIDPLTDALVAD |
Ga0311371_121314671 | 3300029951 | Palsa | PLNILIWADGSGTNVTYFSPAALAARYGLSAELAANLAGIDPLTDALVAQ |
Ga0311339_105349052 | 3300029999 | Palsa | ADGSRTNVTYYSPAAIAARHGLSSELARELAAIDQLTDALIGD |
Ga0311338_106062471 | 3300030007 | Palsa | DEGQTQVTYYDPAALAARHHLDASLAANLAGINALTDALVAS |
Ga0302178_104502852 | 3300030013 | Palsa | VTYYDPAALAARHHLDASLAANLAGINALTDALVAS |
Ga0302182_103889671 | 3300030054 | Palsa | VLIWADEGQTKVSYYAPTALAASHHLIADLAASLSGINVLTDALVAA |
Ga0302181_101055774 | 3300030056 | Palsa | GQTKVTYYGPAALAARYDLNADLTAKLAAIDPLTDALVAP |
Ga0302181_104895202 | 3300030056 | Palsa | TVSYYGPEALTARYGLDRSLQAKLAGIDPLTDALIAA |
Ga0302184_103929632 | 3300030490 | Palsa | QTKVTYYGPAALAARYDLNADLTAKLAAIDPLTDALVAP |
Ga0311372_129541112 | 3300030520 | Palsa | WAEEGQTKVSYYGPAALAARYGLSEELAAKLAGIDPLTDGLIAQ |
Ga0311355_102920182 | 3300030580 | Palsa | DQGQTKVSYYAPSVLATRYHLDADLAHNLAGIDALTDALVAP |
Ga0311356_106512363 | 3300030617 | Palsa | KILIWADGSRTNVTYYTPAALAARHGLSAELAAKLAGIDPLTDALVAD |
Ga0307921_10057841 | 3300030712 | Soil | QTKVSYCAPAALAARHHLTAELAAKLAGIDPLTDALIAP |
Ga0302311_102426592 | 3300030739 | Palsa | GQTKVSYYAPSVLATRYHLDADLAHNLAGIDALTDALVAP |
Ga0170834_1019525771 | 3300031057 | Forest Soil | QTKVSYYAPAALTARHHLGPELAGNLAGVNGLTDALVAS |
Ga0307495_102230232 | 3300031199 | Soil | AGQTKVSYYAPAELAARHGLGPDLEKNLAAIDALTDALVAAA |
Ga0302324_1001872077 | 3300031236 | Palsa | DDGQTKVTYYGPAALAARYDLNADLTAKLAAIDPLTDALVAP |
Ga0302326_119690123 | 3300031525 | Palsa | WADDGQTKVTYYGPAALAARYDLNADLTAKLAAIDPLTDALVAP |
Ga0302326_136605652 | 3300031525 | Palsa | GEQTKVSYYAPASLAALHHLSDDLAQTLAGIGPLTDALIAP |
Ga0318516_102855022 | 3300031543 | Soil | VLIWADEGQTKVSYYAPAALAASHHLTAELAANLSGINALTDALVAS |
Ga0318516_108674642 | 3300031543 | Soil | LKVLVWDDRGQTKVSYVAPDALAARYHLSADLAGNLAGLNALTDALVAP |
Ga0318534_102114352 | 3300031544 | Soil | GQTKVSYYAPAELAARHGLGPDLEKNLAAIDSLTDALVTPA |
Ga0318534_107024422 | 3300031544 | Soil | TKVTYYSPAALAARYHLSADLATNLAAIDALTDALVAS |
Ga0318538_105841811 | 3300031546 | Soil | TYYGPAALAARYGLNADLTAKLAAIDPLTDALVAP |
Ga0318528_106930081 | 3300031561 | Soil | QTKVTYYGPAALAARYDLRPDLSTKLAGIDPLTDALVAP |
Ga0318573_107999842 | 3300031564 | Soil | GRTKVSYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG |
Ga0318555_100147613 | 3300031640 | Soil | VTYYGPAALAARYDLNADLSAKLADIDPLTDALVAP |
Ga0318542_101318932 | 3300031668 | Soil | VTYYGPAALAARYDLNADLTAKLAAIDPLTDALIAP |
Ga0318542_101823281 | 3300031668 | Soil | AGVTKVTYYGPAALSARYDLNADLTAKLAAIDPLTDALIAP |
Ga0318542_106459462 | 3300031668 | Soil | VTYYAPAALAARHHLDAALAANLAVVDPLTDALVAP |
Ga0318572_103174911 | 3300031681 | Soil | VLVWADDGQTKVTYYGPAALAARYELSAGLSAKLAGIDPLTDALVAP |
Ga0310686_1171566732 | 3300031708 | Soil | AGQTTVSYYSPATLAARHRLPADLAARLAATDPLTDALVA |
Ga0318496_101173762 | 3300031713 | Soil | PLKVLVWDDAGQAKVSYYAPATLAARHHLGPDLAAKLAVVDPLTDALVAP |
Ga0306917_109470561 | 3300031719 | Soil | WADGDQTKVSYYAPAALAARHRLPADLAANLAGIDALTDALVAS |
Ga0306917_113409121 | 3300031719 | Soil | ASYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG |
Ga0318493_103926102 | 3300031723 | Soil | VLVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAP |
Ga0318493_104325012 | 3300031723 | Soil | DAGQAKVSYYAPATLAARHHLGPDLAAKLAVVDPLTDALVAP |
Ga0318500_102198001 | 3300031724 | Soil | LKVLVWADGAQTKVTYVAPGALGARYRLSDDLTAKLAGIGPLTDALIAP |
Ga0318500_103352153 | 3300031724 | Soil | VLVWADGGQTKVTYTAPAALAARYQLGADLAAKLAGIGPLTDALIAP |
Ga0318501_100893121 | 3300031736 | Soil | ALIWADGHQTKVSYYAPATVAARHHLPEDLAANLAGINALTDALVAS |
Ga0318501_104156052 | 3300031736 | Soil | TKVSYYSPDALAARHHLGADLAGNLAGINALTDTLVAS |
Ga0306918_110325311 | 3300031744 | Soil | TKVSYVAPDALAARYHLSADLAGNLAGLNALTDALVAP |
Ga0306918_111853151 | 3300031744 | Soil | WDDGGQTKVTYYGPAALAARYGLNADLTAKLAAIDPLTDALVAP |
Ga0318492_104310771 | 3300031748 | Soil | VLVWDDRGQTKVSYVAPDALAARYHLSADLAGNLAGLNALTDALVAP |
Ga0318494_100268694 | 3300031751 | Soil | TKVTYYAPATLAARHHLDADLAARLAAVDPLTDALVAP |
Ga0318494_104494251 | 3300031751 | Soil | VWADDGQTKVTYYGPAALAARYDLNADLSAKLAGIDPLTDALVAP |
Ga0318494_106278841 | 3300031751 | Soil | GQTNVTYYAPAALATRHHLSADMAAKLAGIDPLTDALIAPMNYVPCR |
Ga0318494_106577592 | 3300031751 | Soil | VSYYAPATLAARHHLGPDLAAKLAVVDPLTDALVAP |
Ga0318494_107864501 | 3300031751 | Soil | VLIWADEGQIKVSNYAPAALAASHHLSADLAANLAGINALTDALVAA |
Ga0318554_101781513 | 3300031765 | Soil | DLPLKILIWADGSRTNVTYYSPAAIAARYGLSAELAAKLAGIDPLTDALIADW |
Ga0318509_100690042 | 3300031768 | Soil | GGQTSVSYDATATLAARHHLSADLAAKLAGIDPLTDTLITT |
Ga0318509_101313421 | 3300031768 | Soil | AKVSYYAPATLAARHHLGSDLAAKLAVVDPLTDALVTP |
Ga0318526_101703582 | 3300031769 | Soil | DQGQTKVSYYAPEALAAQHHLSAGLTANLAGIDALTDMLVAP |
Ga0318521_100209823 | 3300031770 | Soil | RQTNVTYYAPDALAARHHLGPDLTARLAGIDPLTDALIAP |
Ga0318521_101286051 | 3300031770 | Soil | DGQTSVTYYSPAAVAARHHLDADLARNLASIDALTDALVAA |
Ga0318521_106983821 | 3300031770 | Soil | KVTYYAPAALATRHHLNADLAAKLSVVDPLTDALITP |
Ga0318546_103536351 | 3300031771 | Soil | GQTKVTYYGPAALAARYDLNADLSAKLADIDPLTDALVAP |
Ga0318547_108220011 | 3300031781 | Soil | SYYAPAELAARHGLGPDLEKNLAAIDTLTDALVAAS |
Ga0318548_100715691 | 3300031793 | Soil | QTKVTYYAPATLAARHHLDADLAARLAAVDPLTDALVAP |
Ga0318548_101787142 | 3300031793 | Soil | TNVTYYAPDALAARHHLSPDLAARLAGIDPLTDALIAR |
Ga0318576_102289841 | 3300031796 | Soil | TVSYYDPAALADRHHLSADLAARLSGIGPLTDALVAP |
Ga0318523_100046805 | 3300031798 | Soil | IWADDGQTKVTYYGPAALAARHDLSADLEAKLAAIDPLTDALIAP |
Ga0318523_100385661 | 3300031798 | Soil | GQTTVSYYDPAALADRHHLSADLAARLSGIGPLTDALVAP |
Ga0318565_100597451 | 3300031799 | Soil | SYDATATIAARHHLSADLAAKLAGIDPLTDTLITT |
Ga0318565_103365941 | 3300031799 | Soil | QTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAP |
Ga0318568_108367151 | 3300031819 | Soil | VSYYAPAELAARHGLGPDLEKNLAAIDTLTDALVAAS |
Ga0318567_100447681 | 3300031821 | Soil | SYYDPAALADRHHLSADLAARLSGIGPLTDALVAP |
Ga0318567_106853411 | 3300031821 | Soil | WADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA |
Ga0307478_103563221 | 3300031823 | Hardwood Forest Soil | KVSYYAPSALAASHHLSADLAANLAGIDALTDALVAS |
Ga0318564_100562591 | 3300031831 | Soil | GQTKVSYYSPDALAARYHLGVGLAGNLAAINALTDALVAS |
Ga0318564_101159591 | 3300031831 | Soil | QTNVTYYAPDALAARHHLSPELAARLAGIDPLTDALVAA |
Ga0318499_104063041 | 3300031832 | Soil | VLIWADGDQTKVSYYAPAALAASHHLTADLAANLAGINALTDALVAS |
Ga0318499_104297121 | 3300031832 | Soil | VSYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG |
Ga0310917_104810043 | 3300031833 | Soil | QTKVTYYAPATLAARHHLDADLATRLAAVDPLTDALVAP |
Ga0318511_100173321 | 3300031845 | Soil | LKVLVWADDGQTKVTYYGPAALAARYDLNADLSAKLAGIDPLTDALVAP |
Ga0318512_104519641 | 3300031846 | Soil | RTNVTYYSPAAIAARYGLSAELAAKLAGIDPLTDALIAGW |
Ga0306919_101368121 | 3300031879 | Soil | WADDGQTKVTYYGPAALAARYDLNADLSAKLAGIDPLTDALVAP |
Ga0318544_102890981 | 3300031880 | Soil | LPLKVLVWADGEQTKVTYVAPAALGARYQLTADLTAKLAGIDPLTDALVAP |
Ga0306925_107535762 | 3300031890 | Soil | LRVLVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA |
Ga0306925_109048251 | 3300031890 | Soil | KVLIWADEGQIKVSNYAPAALAASHHLSADLAANLAGINALTDALVAA |
Ga0318536_100405624 | 3300031893 | Soil | TKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA |
Ga0318536_100690421 | 3300031893 | Soil | VLVWADDGQTKVTYYGPAALAARYDLNADLSAKLAGIDPLTDALVAP |
Ga0318522_104280551 | 3300031894 | Soil | WADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAP |
Ga0306923_102014103 | 3300031910 | Soil | GRTEVSYWAPAALAARHRLSPALANNLAGIDSLTDALVAG |
Ga0306923_105998481 | 3300031910 | Soil | RVLVWADGAQTKVTYVAPAALGTRYQLTADLTAKLAGIDPLTDALVAP |
Ga0306921_103512312 | 3300031912 | Soil | LPLKILVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA |
Ga0306921_105456424 | 3300031912 | Soil | LKVLVWADGGQTKVTYTAPAALAARYQLGADLAAKLAGIGPLTDALIAP |
Ga0306921_115954331 | 3300031912 | Soil | DDGRTKASYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG |
Ga0310912_102740141 | 3300031941 | Soil | DGRTKVSYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG |
Ga0310912_105941182 | 3300031941 | Soil | VLIWDDGGQATVSYDDPAAVAGRHHLSADLAARLAGIGPLTDALVAP |
Ga0310916_114746701 | 3300031942 | Soil | QTKVTYYGPAALAARYGLNADLTAKLAAIDPLTDALVAP |
Ga0310913_100543411 | 3300031945 | Soil | SYYDPAALAYRHHLSADLAARLSGIGPLTDALVAP |
Ga0310910_105623902 | 3300031946 | Soil | DLPLKVLVWADGAQTKVTYVAPAALGARYRLSDDLTAKLAGIGPLTDALVAP |
Ga0306926_100280958 | 3300031954 | Soil | QTNVTYYAPDALAARHHLSPDLAARLAGIDPLTDALIAP |
Ga0306926_106144401 | 3300031954 | Soil | IWDNAGQTNVTYYAPAALATRHHLSADMAAKLAGIDPLTDALIAP |
Ga0306926_129958362 | 3300031954 | Soil | IWADGDQTKVSYYAPAAVAASHHLPGDLAANLAGINALTDALVAS |
Ga0306926_130395161 | 3300031954 | Soil | LKVLVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAP |
Ga0318530_102643401 | 3300031959 | Soil | WADGAQTKVSYVAPAVLGARYGLTADLTAKLAGVDPLTDALVAP |
Ga0307479_100288466 | 3300031962 | Hardwood Forest Soil | TTKVTYDDPAALAVRHHVPADLVPNLAAINGLTDALVAP |
Ga0306922_117150801 | 3300032001 | Soil | TSVTYYSPAAVAARHHLDADLARNLASIDALTDALVAA |
Ga0318569_100795293 | 3300032010 | Soil | LKVLVWADGAQTKVTYVAPAALGARYRLSDDLTAKLAGIGPLTDALVAP |
Ga0318569_103719081 | 3300032010 | Soil | DPGRTCVSSAAPAELAARYQLSDELAAGLAGIDPLTDAAIVR |
Ga0318507_101547761 | 3300032025 | Soil | SYVAPAVLGARYGLTADLTAKLAGVDPLTDALVAP |
Ga0318507_104831462 | 3300032025 | Soil | VWDDAGQAKVSYYAPATLAARHHLGSDLAAKLAVVDPLTDALVTP |
Ga0318559_106090591 | 3300032039 | Soil | TKVSYYAPAALAASHHLTADLAANLAGINALTDALVAS |
Ga0318545_102161921 | 3300032042 | Soil | VLVWADGAQTKVSYVAPAALGARYGLAANLTARLAGIDPLTDALVAP |
Ga0318558_100723502 | 3300032044 | Soil | TKVSYYSPDALAARYHLGAGLAGNLAAINALTDALVAS |
Ga0318558_101390703 | 3300032044 | Soil | VSHYAPATVAARHHLPEDLAANLAGINALTDALVAS |
Ga0318533_107495301 | 3300032059 | Soil | QCSPTPATSALAARHHLSPELAANLAAIDTLTDALVAA |
Ga0318533_113300062 | 3300032059 | Soil | SYYSPDALAARYHLGVGLAGNLAAINALTDALVAS |
Ga0318504_102144571 | 3300032063 | Soil | VWADGGQTKVSYYGPAALAARYDLSAELAAKVAAVDPLTDALIAP |
Ga0318510_101425503 | 3300032064 | Soil | VLVWADGAQTKVSYVAPAVLGARYGLTADLTAKLAGVDPLTDALVAP |
Ga0318510_105193142 | 3300032064 | Soil | SDNGQTNVTYYAPDALAARHHLSPDLAARLAGIDPLTDALIAP |
Ga0318514_101963081 | 3300032066 | Soil | VSYDDPAAVAGRHHLSADLAARLAGIGPLTDALVAP |
Ga0318514_106969752 | 3300032066 | Soil | KISYYAPAALAARHRLPADLAANLAGIDALTDALVAS |
Ga0318553_106410702 | 3300032068 | Soil | ADAGQTKVSYYGPVTLAARYHLGADLAANLAAIDVLTDALVAP |
Ga0318553_106600011 | 3300032068 | Soil | QGQTKVSYYGPAALAARYDLTADLTAKLAAIDPLTDALTAP |
Ga0318525_105761231 | 3300032089 | Soil | DDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA |
Ga0318577_103746362 | 3300032091 | Soil | KVLIWDDGGQATVSYDDPAAVAGRHHLSADLAARLAGIGPLTDALVAP |
Ga0318540_100209151 | 3300032094 | Soil | AGQAKVSYYAPATLAARHHLGSDLAAKLAVVDPLTDALVTP |
Ga0307470_118608812 | 3300032174 | Hardwood Forest Soil | GQTKVSYFDPAELAARHRLGPGLAGNFAAIGTLTDALVAP |
Ga0307471_1025873171 | 3300032180 | Hardwood Forest Soil | YYAPAELARRHGLSPELEGRLASIDQLTDALVGPG |
Ga0306920_1012508553 | 3300032261 | Soil | YYSPAAIAARYGLSAELAAKLAGIDPLTDALIADW |
Ga0306920_1025506051 | 3300032261 | Soil | DLPLKILVWADEGQTKVTYYGPAALAARYGLSAGLSARLAGIDPLTDALVAP |
Ga0306920_1028397062 | 3300032261 | Soil | IWADGEQTKVSYYAPAALAASHRLPDDLAANLAGINALTDALVGS |
Ga0306920_1032126122 | 3300032261 | Soil | TKVSYYAPAALAASHRLPADLAASLAGINALTDALVAS |
Ga0335085_120616951 | 3300032770 | Soil | ATLAARYHLGAGLAGNLAGINALTDALVAPQASGAAP |
Ga0335082_108299161 | 3300032782 | Soil | YYAPAELAARHGLGPGLEQNLAAIDVLTDALVGPA |
Ga0335080_113073072 | 3300032828 | Soil | TKVSYVAPDALAARYHLGADLAGNLAGINGVTDALVAP |
Ga0335081_126543571 | 3300032892 | Soil | LVWSDGDQTKVSYYAPAALAARHHLGPDLAANLAGIDGLTDALVAP |
Ga0335069_123705111 | 3300032893 | Soil | TNVTYYSPAALATRYELSDELAAKLAVVDPLTDALCAG |
Ga0335074_109830602 | 3300032895 | Soil | DGDQTKVSYYAPAALAASHHLSADLAASLAGINALTDALVAS |
Ga0335075_104211523 | 3300032896 | Soil | IWADEGQVKVSYYAPEELGRRHGLRQDLVANLAGIGPITDALIAD |
Ga0335072_115035201 | 3300032898 | Soil | DGSRTNVTYYSPAALAARFGLSGELAAKLAGIDPLTDALVAGQ |
Ga0335073_118658402 | 3300033134 | Soil | VTYYGPAALAARYGLDAELTAKLAAIDPLTDALVAP |
Ga0335077_106099642 | 3300033158 | Soil | TKVSYYSPAALAARHHLTADLAASLAGINALTDALVAS |
Ga0310914_100955135 | 3300033289 | Soil | VWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA |
Ga0310914_104362742 | 3300033289 | Soil | WDDAGQTKVTYYGPAALAARYELNADLTAKLAAIDPLTDALITP |
Ga0318519_108541942 | 3300033290 | Soil | VTYYAPATLAARHHLDADLATRLAAVDPLTDALVAP |
Ga0334850_108146_3_146 | 3300033828 | Soil | VLVWDDGGQTTVSYYAPAALAARHHLDADLAANLAGINALTDALVAS |
Ga0373950_0009161_1463_1573 | 3300034818 | Rhizosphere Soil | SYYAPAELAARHGLGPGLEKNLAAIDALTDALIAPS |
⦗Top⦘ |