NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F009930

Metagenome / Metatranscriptome Family F009930

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009930
Family Type Metagenome / Metatranscriptome
Number of Sequences 311
Average Sequence Length 42 residues
Representative Sequence QTKVSYYAPAALAARHHLDADLAAKLAGIDPLTDALVAQ
Number of Associated Samples 235
Number of Associated Scaffolds 311

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.95 %
% of genes near scaffold ends (potentially truncated) 95.82 %
% of genes from short scaffolds (< 2000 bps) 89.39 %
Associated GOLD sequencing projects 219
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.768 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.154 % of family members)
Environment Ontology (ENVO) Unclassified
(36.334 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.158 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.81%    β-sheet: 0.00%    Coil/Unstructured: 61.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 311 Family Scaffolds
PF07690MFS_1 19.29
PF04261Dyp_perox 6.43
PF13191AAA_16 5.79
PF13224DUF4032 4.50
PF04525LOR 3.54
PF02656DUF202 2.57
PF02580Tyr_Deacylase 2.25
PF00892EamA 1.61
PF00291PALP 1.61
PF10009DUF2252 1.61
PF03625DUF302 1.61
PF00196GerE 1.29
PF00708Acylphosphatase 1.29
PF04454Linocin_M18 1.29
PF13424TPR_12 1.29
PF12867DinB_2 1.29
PF00106adh_short 0.96
PF12680SnoaL_2 0.96
PF00270DEAD 0.96
PF02322Cyt_bd_oxida_II 0.96
PF00175NAD_binding_1 0.64
PF14542Acetyltransf_CG 0.64
PF07784DUF1622 0.64
PF07859Abhydrolase_3 0.64
PF02614UxaC 0.64
PF13302Acetyltransf_3 0.64
PF07592DDE_Tnp_ISAZ013 0.64
PF00296Bac_luciferase 0.64
PF02502LacAB_rpiB 0.32
PF03976PPK2 0.32
PF03091CutA1 0.32
PF04199Cyclase 0.32
PF14690zf-ISL3 0.32
PF08281Sigma70_r4_2 0.32
PF13278Obsolete Pfam Family 0.32
PF13602ADH_zinc_N_2 0.32
PF04542Sigma70_r2 0.32
PF03060NMO 0.32
PF07992Pyr_redox_2 0.32
PF03116NQR2_RnfD_RnfE 0.32
PF00230MIP 0.32
PF01842ACT 0.32
PF00111Fer2 0.32
PF01740STAS 0.32
PF00211Guanylate_cyc 0.32
PF13659Obsolete Pfam Family 0.32
PF00355Rieske 0.32
PF13671AAA_33 0.32
PF00313CSD 0.32
PF09660DUF2397 0.32
PF00004AAA 0.32
PF01027Bax1-I 0.32
PF03631Virul_fac_BrkB 0.32
PF06500FrsA-like 0.32
PF14027Questin_oxidase 0.32
PF01654Cyt_bd_oxida_I 0.32
PF04715Anth_synt_I_N 0.32
PF06737Transglycosylas 0.32
PF08241Methyltransf_11 0.32
PF08240ADH_N 0.32
PF01648ACPS 0.32
PF00165HTH_AraC 0.32
PF02467Whib 0.32
PF00083Sugar_tr 0.32
PF13378MR_MLE_C 0.32
PF01425Amidase 0.32

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 311 Family Scaffolds
COG2837Periplasmic deferrochelatase/peroxidase EfeBInorganic ion transport and metabolism [P] 6.43
COG4894Putative phospholipid scramblase YxjI, Tubby2 superfamilyLipid transport and metabolism [I] 3.54
COG2149Uncharacterized membrane protein YidH, DUF202 familyFunction unknown [S] 2.57
COG1490D-aminoacyl-tRNA deacylaseTranslation, ribosomal structure and biogenesis [J] 2.25
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 1.61
COG1294Cytochrome bd-type quinol oxidase, subunit 2Energy production and conversion [C] 0.96
COG1904Glucuronate isomeraseCarbohydrate transport and metabolism [G] 0.64
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.64
COG4828Uncharacterized membrane proteinFunction unknown [S] 0.64
COG0147Anthranilate/para-aminobenzoate synthases component IAmino acid transport and metabolism [E] 0.64
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.64
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.32
COG1324Divalent cation tolerance protein CutAInorganic ion transport and metabolism [P] 0.32
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.32
COG1805Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrBEnergy production and conversion [C] 0.32
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.32
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.32
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.32
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.32
COG4658Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfD subunitEnergy production and conversion [C] 0.32
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.32
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.32
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.32
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.32
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.32
COG0698Ribose 5-phosphate isomerase RpiBCarbohydrate transport and metabolism [G] 0.32
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.32
COG1271Cytochrome bd-type quinol oxidase, subunit 1Energy production and conversion [C] 0.32


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.77 %
UnclassifiedrootN/A48.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0451918All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300001976|JGI24752J21851_1041685Not Available615Open in IMG/M
3300003368|JGI26340J50214_10167593Not Available547Open in IMG/M
3300003505|JGIcombinedJ51221_10051316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1568Open in IMG/M
3300003505|JGIcombinedJ51221_10214180Not Available782Open in IMG/M
3300005332|Ga0066388_102651915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia914Open in IMG/M
3300005332|Ga0066388_108113584Not Available525Open in IMG/M
3300005337|Ga0070682_100587095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales877Open in IMG/M
3300005434|Ga0070709_10009998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5244Open in IMG/M
3300005435|Ga0070714_101258257Not Available722Open in IMG/M
3300005439|Ga0070711_101846974Not Available530Open in IMG/M
3300005445|Ga0070708_100136894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2269Open in IMG/M
3300005445|Ga0070708_100315115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1474Open in IMG/M
3300005467|Ga0070706_101008655Not Available767Open in IMG/M
3300005538|Ga0070731_10209760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1293Open in IMG/M
3300005545|Ga0070695_100322466Not Available1149Open in IMG/M
3300005559|Ga0066700_10835014All Organisms → cellular organisms → Bacteria → Terrabacteria group617Open in IMG/M
3300005561|Ga0066699_10653556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales753Open in IMG/M
3300005568|Ga0066703_10130597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1499Open in IMG/M
3300005569|Ga0066705_10983395Not Available500Open in IMG/M
3300005602|Ga0070762_10790445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia datiscae641Open in IMG/M
3300005610|Ga0070763_10147858Not Available1224Open in IMG/M
3300005610|Ga0070763_10291852All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300005764|Ga0066903_103018038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales912Open in IMG/M
3300005764|Ga0066903_103801811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces811Open in IMG/M
3300005841|Ga0068863_100299878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp.1559Open in IMG/M
3300005842|Ga0068858_100633355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1038Open in IMG/M
3300005844|Ga0068862_100670332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1002Open in IMG/M
3300006046|Ga0066652_101838489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300006057|Ga0075026_100245453Not Available959Open in IMG/M
3300006163|Ga0070715_10086191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1436Open in IMG/M
3300006173|Ga0070716_100069895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2059Open in IMG/M
3300006175|Ga0070712_101725087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia548Open in IMG/M
3300006176|Ga0070765_100990498Not Available795Open in IMG/M
3300006755|Ga0079222_10340082All Organisms → cellular organisms → Bacteria1007Open in IMG/M
3300006755|Ga0079222_12501517Not Available518Open in IMG/M
3300006800|Ga0066660_11580155Not Available519Open in IMG/M
3300006806|Ga0079220_10878735Not Available692Open in IMG/M
3300006954|Ga0079219_11830979All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300009088|Ga0099830_10911028Not Available727Open in IMG/M
3300009088|Ga0099830_11689738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300009090|Ga0099827_12005734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium502Open in IMG/M
3300009098|Ga0105245_13150841Not Available511Open in IMG/M
3300009101|Ga0105247_10219225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1287Open in IMG/M
3300009137|Ga0066709_101643742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium916Open in IMG/M
3300009672|Ga0116215_1125754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1144Open in IMG/M
3300009672|Ga0116215_1542904Not Available502Open in IMG/M
3300009700|Ga0116217_10804410Not Available579Open in IMG/M
3300010048|Ga0126373_13018641Not Available525Open in IMG/M
3300010152|Ga0126318_10611861All Organisms → cellular organisms → Bacteria → Terrabacteria group655Open in IMG/M
3300010341|Ga0074045_10773634Not Available608Open in IMG/M
3300010358|Ga0126370_11747037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia600Open in IMG/M
3300010360|Ga0126372_10086099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2306Open in IMG/M
3300010361|Ga0126378_10773992Not Available1070Open in IMG/M
3300010361|Ga0126378_11018749Not Available931Open in IMG/M
3300010361|Ga0126378_12565248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300010366|Ga0126379_11548813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia768Open in IMG/M
3300010379|Ga0136449_100544117Not Available1999Open in IMG/M
3300010379|Ga0136449_101275553Not Available1148Open in IMG/M
3300010379|Ga0136449_101955956All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300010379|Ga0136449_102222570All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300010379|Ga0136449_102570950Not Available727Open in IMG/M
3300010398|Ga0126383_10264161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1698Open in IMG/M
3300010398|Ga0126383_11242309All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300010398|Ga0126383_13056121Not Available546Open in IMG/M
3300010398|Ga0126383_13402109Not Available520Open in IMG/M
3300010400|Ga0134122_10145509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1921Open in IMG/M
3300010876|Ga0126361_10409638Not Available613Open in IMG/M
3300010876|Ga0126361_10484287Not Available1397Open in IMG/M
3300010876|Ga0126361_10928318Not Available701Open in IMG/M
3300011119|Ga0105246_11880454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium574Open in IMG/M
3300011269|Ga0137392_10762231Not Available800Open in IMG/M
3300012096|Ga0137389_11634058Not Available540Open in IMG/M
3300012199|Ga0137383_11362736Not Available503Open in IMG/M
3300012200|Ga0137382_10090826All Organisms → cellular organisms → Bacteria1998Open in IMG/M
3300012201|Ga0137365_11213251All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300012206|Ga0137380_10198152Not Available1822Open in IMG/M
3300012206|Ga0137380_11714721Not Available512Open in IMG/M
3300012209|Ga0137379_10025590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5674Open in IMG/M
3300012210|Ga0137378_10717420All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300012210|Ga0137378_11852675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300012350|Ga0137372_10993111Not Available586Open in IMG/M
3300012359|Ga0137385_10186167Not Available1817Open in IMG/M
3300012929|Ga0137404_12139457All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300013105|Ga0157369_12218143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium557Open in IMG/M
3300013307|Ga0157372_10532370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1369Open in IMG/M
3300013768|Ga0120155_1075197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia965Open in IMG/M
3300014165|Ga0181523_10330748All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300014168|Ga0181534_10079596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1627Open in IMG/M
3300014501|Ga0182024_11029812All Organisms → cellular organisms → Bacteria → Terrabacteria group979Open in IMG/M
3300014654|Ga0181525_10429538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia727Open in IMG/M
3300014969|Ga0157376_10368054Not Available1381Open in IMG/M
3300016294|Ga0182041_11590313Not Available603Open in IMG/M
3300016319|Ga0182033_10224256All Organisms → cellular organisms → Bacteria → Terrabacteria group1511Open in IMG/M
3300016341|Ga0182035_10127456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1915Open in IMG/M
3300016387|Ga0182040_11709152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → unclassified Actinoplanes → Actinoplanes sp. TBRC 11911537Open in IMG/M
3300016387|Ga0182040_11854287Not Available517Open in IMG/M
3300016404|Ga0182037_10545116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium978Open in IMG/M
3300016445|Ga0182038_10318304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1278Open in IMG/M
3300016445|Ga0182038_10486882All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300017821|Ga0187812_1142715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300017823|Ga0187818_10356803Not Available646Open in IMG/M
3300017823|Ga0187818_10365179All Organisms → cellular organisms → Bacteria → Terrabacteria group638Open in IMG/M
3300017924|Ga0187820_1002164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4464Open in IMG/M
3300017924|Ga0187820_1246376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241572Open in IMG/M
3300017926|Ga0187807_1031003Not Available1655Open in IMG/M
3300017932|Ga0187814_10006359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4744Open in IMG/M
3300017937|Ga0187809_10145404Not Available818Open in IMG/M
3300017942|Ga0187808_10051013Not Available1751Open in IMG/M
3300017970|Ga0187783_10311332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1148Open in IMG/M
3300018009|Ga0187884_10471444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium504Open in IMG/M
3300018012|Ga0187810_10254165Not Available721Open in IMG/M
3300018044|Ga0187890_10324751Not Available864Open in IMG/M
3300018085|Ga0187772_10345147Not Available1028Open in IMG/M
3300018085|Ga0187772_10683510Not Available735Open in IMG/M
3300018086|Ga0187769_11387971Not Available531Open in IMG/M
3300020581|Ga0210399_11062794All Organisms → cellular organisms → Bacteria → Terrabacteria group649Open in IMG/M
3300020582|Ga0210395_10318304All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. T12-51170Open in IMG/M
3300021171|Ga0210405_10494951Not Available958Open in IMG/M
3300021180|Ga0210396_10777753Not Available823Open in IMG/M
3300021181|Ga0210388_11175317Not Available652Open in IMG/M
3300021388|Ga0213875_10569267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium546Open in IMG/M
3300021401|Ga0210393_10126934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2043Open in IMG/M
3300021401|Ga0210393_10441121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1062Open in IMG/M
3300021402|Ga0210385_10974893Not Available651Open in IMG/M
3300021403|Ga0210397_11010320Not Available645Open in IMG/M
3300021404|Ga0210389_11408705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinomycetospora532Open in IMG/M
3300021405|Ga0210387_10792225Not Available838Open in IMG/M
3300021407|Ga0210383_11339126Not Available597Open in IMG/M
3300021475|Ga0210392_10715773Not Available746Open in IMG/M
3300021478|Ga0210402_10974551Not Available775Open in IMG/M
3300021560|Ga0126371_10001139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria22333Open in IMG/M
3300024254|Ga0247661_1044915Not Available805Open in IMG/M
3300025703|Ga0208357_1009093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4635Open in IMG/M
3300025900|Ga0207710_10427926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium682Open in IMG/M
3300025906|Ga0207699_10280159Not Available1158Open in IMG/M
3300025916|Ga0207663_10240834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1327Open in IMG/M
3300025922|Ga0207646_10528130Not Available1062Open in IMG/M
3300025927|Ga0207687_10740969Not Available836Open in IMG/M
3300025928|Ga0207700_10110122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2214Open in IMG/M
3300025934|Ga0207686_10387607Not Available1061Open in IMG/M
3300025935|Ga0207709_10036241All Organisms → cellular organisms → Bacteria2923Open in IMG/M
3300025938|Ga0207704_10425189Not Available1054Open in IMG/M
3300025939|Ga0207665_10662671Not Available819Open in IMG/M
3300026317|Ga0209154_1324170All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300026374|Ga0257146_1029728All Organisms → cellular organisms → Bacteria → Terrabacteria group887Open in IMG/M
3300026529|Ga0209806_1028452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2793Open in IMG/M
3300026529|Ga0209806_1043914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2139Open in IMG/M
3300027018|Ga0208475_1009928Not Available933Open in IMG/M
3300027043|Ga0207800_1038691Not Available670Open in IMG/M
3300027110|Ga0208488_1040132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Candidatus Frankia datiscae837Open in IMG/M
3300027604|Ga0208324_1171632Not Available584Open in IMG/M
3300027663|Ga0208990_1123863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium700Open in IMG/M
3300027680|Ga0207826_1214602Not Available517Open in IMG/M
3300027725|Ga0209178_1391231All Organisms → cellular organisms → Bacteria → Terrabacteria group527Open in IMG/M
3300027853|Ga0209274_10131658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium1251Open in IMG/M
3300027853|Ga0209274_10203995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1006Open in IMG/M
3300027854|Ga0209517_10454298Not Available707Open in IMG/M
3300027869|Ga0209579_10409895Not Available735Open in IMG/M
3300027884|Ga0209275_10397950Not Available777Open in IMG/M
3300028718|Ga0307307_10262907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300028784|Ga0307282_10062552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. ATCC PTA-50241679Open in IMG/M
3300028784|Ga0307282_10188468Not Available984Open in IMG/M
3300028800|Ga0265338_10131794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1972Open in IMG/M
3300028819|Ga0307296_10018670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3645Open in IMG/M
3300028877|Ga0302235_10441322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae555Open in IMG/M
3300028906|Ga0308309_10603821Not Available952Open in IMG/M
3300028906|Ga0308309_11259819Not Available636Open in IMG/M
3300029943|Ga0311340_10284793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1586Open in IMG/M
3300029951|Ga0311371_12131467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300029999|Ga0311339_10534905Not Available1183Open in IMG/M
3300030007|Ga0311338_10606247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia1125Open in IMG/M
3300030013|Ga0302178_10450285Not Available567Open in IMG/M
3300030054|Ga0302182_10388967Not Available584Open in IMG/M
3300030056|Ga0302181_10105577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1392Open in IMG/M
3300030056|Ga0302181_10489520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans520Open in IMG/M
3300030490|Ga0302184_10392963Not Available540Open in IMG/M
3300030520|Ga0311372_12954111Not Available516Open in IMG/M
3300030580|Ga0311355_10292018Not Available1643Open in IMG/M
3300030617|Ga0311356_10651236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1014Open in IMG/M
3300030712|Ga0307921_1005784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium1261Open in IMG/M
3300030739|Ga0302311_10242659Not Available1339Open in IMG/M
3300031057|Ga0170834_101952577Not Available1422Open in IMG/M
3300031199|Ga0307495_10223023Not Available529Open in IMG/M
3300031236|Ga0302324_100187207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3325Open in IMG/M
3300031525|Ga0302326_11969012Not Available756Open in IMG/M
3300031525|Ga0302326_13660565All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031543|Ga0318516_10285502All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300031543|Ga0318516_10867464Not Available509Open in IMG/M
3300031544|Ga0318534_10211435All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300031544|Ga0318534_10702442Not Available571Open in IMG/M
3300031546|Ga0318538_10584181Not Available606Open in IMG/M
3300031561|Ga0318528_10693008Not Available545Open in IMG/M
3300031564|Ga0318573_10799984Not Available506Open in IMG/M
3300031640|Ga0318555_10014761Not Available3549Open in IMG/M
3300031668|Ga0318542_10131893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1230Open in IMG/M
3300031668|Ga0318542_10182328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1054Open in IMG/M
3300031668|Ga0318542_10645946Not Available553Open in IMG/M
3300031681|Ga0318572_10317491Not Available922Open in IMG/M
3300031708|Ga0310686_117156673Not Available528Open in IMG/M
3300031713|Ga0318496_10117376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1438Open in IMG/M
3300031719|Ga0306917_10947056Not Available673Open in IMG/M
3300031719|Ga0306917_11340912Not Available553Open in IMG/M
3300031723|Ga0318493_10392610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. VRA16 Mangrove soil758Open in IMG/M
3300031723|Ga0318493_10432501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii722Open in IMG/M
3300031724|Ga0318500_10219800Not Available915Open in IMG/M
3300031724|Ga0318500_10335215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300031736|Ga0318501_10089312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1520Open in IMG/M
3300031736|Ga0318501_10415605All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300031744|Ga0306918_11032531Not Available638Open in IMG/M
3300031744|Ga0306918_11185315Not Available590Open in IMG/M
3300031748|Ga0318492_10431077Not Available695Open in IMG/M
3300031751|Ga0318494_10026869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2909Open in IMG/M
3300031751|Ga0318494_10449425Not Available749Open in IMG/M
3300031751|Ga0318494_10627884Not Available628Open in IMG/M
3300031751|Ga0318494_10657759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii613Open in IMG/M
3300031751|Ga0318494_10786450Not Available557Open in IMG/M
3300031765|Ga0318554_10178151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae1209Open in IMG/M
3300031768|Ga0318509_10069004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1850Open in IMG/M
3300031768|Ga0318509_10131342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1372Open in IMG/M
3300031769|Ga0318526_10170358Not Available887Open in IMG/M
3300031770|Ga0318521_10020982All Organisms → cellular organisms → Bacteria3048Open in IMG/M
3300031770|Ga0318521_10128605Not Available1422Open in IMG/M
3300031770|Ga0318521_10698382Not Available616Open in IMG/M
3300031771|Ga0318546_10353635Not Available1022Open in IMG/M
3300031781|Ga0318547_10822001Not Available579Open in IMG/M
3300031793|Ga0318548_10071569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1623Open in IMG/M
3300031793|Ga0318548_10178714Not Available1039Open in IMG/M
3300031796|Ga0318576_10228984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534876Open in IMG/M
3300031798|Ga0318523_10004680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5125Open in IMG/M
3300031798|Ga0318523_10038566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2200Open in IMG/M
3300031799|Ga0318565_10059745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1785Open in IMG/M
3300031799|Ga0318565_10336594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. VRA16 Mangrove soil732Open in IMG/M
3300031819|Ga0318568_10836715Not Available570Open in IMG/M
3300031821|Ga0318567_10044768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2266Open in IMG/M
3300031821|Ga0318567_10685341Not Available581Open in IMG/M
3300031823|Ga0307478_10356322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1206Open in IMG/M
3300031831|Ga0318564_10056259Not Available1717Open in IMG/M
3300031831|Ga0318564_10115959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1192Open in IMG/M
3300031832|Ga0318499_10406304All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300031832|Ga0318499_10429712Not Available504Open in IMG/M
3300031833|Ga0310917_10481004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300031845|Ga0318511_10017332Not Available2577Open in IMG/M
3300031846|Ga0318512_10451964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae649Open in IMG/M
3300031879|Ga0306919_10136812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1772Open in IMG/M
3300031880|Ga0318544_10289098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300031890|Ga0306925_10753576All Organisms → cellular organisms → Bacteria → Terrabacteria group1014Open in IMG/M
3300031890|Ga0306925_10904825Not Available907Open in IMG/M
3300031893|Ga0318536_10040562All Organisms → cellular organisms → Bacteria → Terrabacteria group2219Open in IMG/M
3300031893|Ga0318536_10069042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1735Open in IMG/M
3300031894|Ga0318522_10428055Not Available502Open in IMG/M
3300031910|Ga0306923_10201410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2276Open in IMG/M
3300031910|Ga0306923_10599848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1236Open in IMG/M
3300031912|Ga0306921_10351231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1724Open in IMG/M
3300031912|Ga0306921_10545642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1345Open in IMG/M
3300031912|Ga0306921_11595433Not Available709Open in IMG/M
3300031941|Ga0310912_10274014Not Available1303Open in IMG/M
3300031941|Ga0310912_10594118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534862Open in IMG/M
3300031942|Ga0310916_11474670All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031945|Ga0310913_10054341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2624Open in IMG/M
3300031946|Ga0310910_10562390Not Available905Open in IMG/M
3300031954|Ga0306926_10028095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces6567Open in IMG/M
3300031954|Ga0306926_10614440Not Available1326Open in IMG/M
3300031954|Ga0306926_12995836Not Available504Open in IMG/M
3300031954|Ga0306926_13039516Not Available500Open in IMG/M
3300031959|Ga0318530_10264340Not Available710Open in IMG/M
3300031962|Ga0307479_10028846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5283Open in IMG/M
3300032001|Ga0306922_11715080Not Available621Open in IMG/M
3300032010|Ga0318569_10079529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1459Open in IMG/M
3300032025|Ga0318507_10154776Not Available981Open in IMG/M
3300032025|Ga0318507_10483146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii539Open in IMG/M
3300032039|Ga0318559_10609059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300032042|Ga0318545_10216192Not Available687Open in IMG/M
3300032044|Ga0318558_10072350Not Available1570Open in IMG/M
3300032044|Ga0318558_10139070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1163Open in IMG/M
3300032059|Ga0318533_10749530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus radicis (ex Gao et al. 2016)717Open in IMG/M
3300032059|Ga0318533_11330006Not Available525Open in IMG/M
3300032063|Ga0318504_10214457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium901Open in IMG/M
3300032064|Ga0318510_10142550Not Available941Open in IMG/M
3300032064|Ga0318510_10519314Not Available517Open in IMG/M
3300032066|Ga0318514_10196308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K5341056Open in IMG/M
3300032066|Ga0318514_10696975Not Available540Open in IMG/M
3300032068|Ga0318553_10641070Not Available556Open in IMG/M
3300032068|Ga0318553_10660001Not Available547Open in IMG/M
3300032089|Ga0318525_10576123Not Available575Open in IMG/M
3300032091|Ga0318577_10374636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534680Open in IMG/M
3300032094|Ga0318540_10020915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2727Open in IMG/M
3300032174|Ga0307470_11860881Not Available511Open in IMG/M
3300032180|Ga0307471_102587317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300032261|Ga0306920_101250855Not Available1070Open in IMG/M
3300032261|Ga0306920_102550605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria702Open in IMG/M
3300032261|Ga0306920_102839706Not Available658Open in IMG/M
3300032261|Ga0306920_103212612Not Available611Open in IMG/M
3300032770|Ga0335085_12061695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium577Open in IMG/M
3300032782|Ga0335082_10829916Not Available786Open in IMG/M
3300032828|Ga0335080_11307307Not Available724Open in IMG/M
3300032892|Ga0335081_12654357Not Available513Open in IMG/M
3300032893|Ga0335069_12370511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia552Open in IMG/M
3300032895|Ga0335074_10983060Not Available748Open in IMG/M
3300032896|Ga0335075_10421152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1408Open in IMG/M
3300032898|Ga0335072_11503520Not Available575Open in IMG/M
3300033134|Ga0335073_11865840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Actinospicaceae → Actinospica557Open in IMG/M
3300033158|Ga0335077_10609964Not Available1137Open in IMG/M
3300033289|Ga0310914_10095513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2548Open in IMG/M
3300033289|Ga0310914_10436274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1185Open in IMG/M
3300033290|Ga0318519_10854194Not Available561Open in IMG/M
3300033828|Ga0334850_108146Not Available538Open in IMG/M
3300034818|Ga0373950_0009161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1573Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.32%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.22%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.22%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.89%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.29%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.29%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.64%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.64%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.32%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.32%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.32%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.32%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.32%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.32%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.32%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.32%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.32%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.32%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.32%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.32%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.32%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.32%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.32%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.32%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.32%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.32%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025703Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027018Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes)EnvironmentalOpen in IMG/M
3300027043Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027680Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030712Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033828Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
NODE_045191823300000156Sugar Cane Bagasse Incubating BioreactorTKVTYYSPDALAARYHLGAGLAGNLAAINALTDALVAS*
JGI24752J21851_104168513300001976Corn, Switchgrass And Miscanthus RhizosphereSYHAPAALAAKHHLSADLAATLSGINALTDALVAS*
JGI26340J50214_1016759313300003368Bog Forest SoilGQTKVSYVAPSTLASRYDLGADLAARLAGVDPLTDALVAPGA*
JGIcombinedJ51221_1005131613300003505Forest SoilWDDGGQTNVTYYSPAAIAERYGLSEELAARLAGIDPLTDALIAD*
JGIcombinedJ51221_1021418023300003505Forest SoilWDDAGQTKVAYYGPAALAARYDLNTDLAAKLAVIDPLTDALVAP*
Ga0066388_10265191513300005332Tropical Forest SoilDGQTKVTYYGPAALAARYDLSADLSAELAGIDPLTSALVAPSVS*
Ga0066388_10811358423300005332Tropical Forest SoilGQTRVSYYAPAEIAARHGLGPGLEKNLAAIDALTDALVAQS*
Ga0070682_10058709513300005337Corn RhizosphereDGQTKVSYYSPDALAARHHLGGGLAGNLAAVNVLTDALIAP*
Ga0070709_1000999813300005434Corn, Switchgrass And Miscanthus RhizosphereLVWADGAQTKVSYVAPAALGTRYGLTADLTAKLAGIGPLTDALVAP*
Ga0070714_10125825723300005435Agricultural SoilVWADGAQTKVTYTAPAALGARYGLTADLTAKLAGIDPLTDALVAP*
Ga0070711_10184697423300005439Corn, Switchgrass And Miscanthus RhizosphereDDGQTKVSYYSPDALAARHHLGGGLAGNLAAVNVLTDALIAP*
Ga0070708_10013689413300005445Corn, Switchgrass And Miscanthus RhizospherePLKILIWDDQGQTKVSYYAPEALAARHHLSARLTANLAAINALTDALVAS*
Ga0070708_10031511533300005445Corn, Switchgrass And Miscanthus RhizosphereWADGQQTKVSYEAPAAIARRRGLSRELAANLTGINALTDALVTP*
Ga0070706_10100865513300005467Corn, Switchgrass And Miscanthus RhizosphereGGQTNVTYYSPGELAARYDLSAGLAANLAGIDPLTNAVVAL*
Ga0070731_1020976013300005538Surface SoilIWSDGEHTNVSYLAPGALARRYGLSADLSASFAGIDPLTDALVSA*
Ga0070695_10032246613300005545Corn, Switchgrass And Miscanthus RhizosphereDGGQTKVSYYAPAELAARHGFGPGLEKNLAAIDALTDALVATA*
Ga0066700_1083501423300005559SoilLVWADAQQTKVSYDAPAAIARRRGLSRELAANLSGINAVTDALVTP*
Ga0066699_1065355613300005561SoilTKVSYYSPDALAARHHLDAGLAGNLAAVNVLTDALTAS*
Ga0066703_1013059713300005568SoilLKVLVWADAQQTKVSYDAPAAIARRRGLSRELAANLTGINALTDALVTP*
Ga0066705_1098339523300005569SoilSYYAPAELAARHGLGPGLEKNLAAIDVLTDALVASA*
Ga0070762_1079044513300005602SoilTKVSYYAPATLAARHHLSADLAARLGAVDPITEALVAP*
Ga0070763_1014785833300005610SoilKVTYYGPAALAARYDLNTDLMAKLAVIDPLTDALVAP*
Ga0070763_1029185213300005610SoilIWADNGQTNVTYYAPDAVAARHHLSPDLAARLQGINPITDALISP*
Ga0066903_10301803833300005764Tropical Forest SoilGQTKVTYYAPAALAARHHLNADLAAKLSVVDPLTDALIAP*
Ga0066903_10380181113300005764Tropical Forest SoilWADGAQTKVTYVAPAALGARYQLTADLTAKLAGIDPLTDALVAP*
Ga0068863_10029987813300005841Switchgrass RhizosphereKVSYYAPAELAARHGFGPGLEKNLAAIDALTDALVATA*
Ga0068858_10063335523300005842Switchgrass RhizosphereKVSYYSPDALAARHHLGAGLAGNLAAVNALTDALIAP*
Ga0068862_10067033213300005844Switchgrass RhizosphereKVSYYAPAALAAKHHLSADLAATLSGINALTDALVAS*
Ga0066652_10183848923300006046SoilKVLVWDDAGQTKVSYYAPGELAARHRLGPGLAGNLAAIDTLTDALIAP*
Ga0075026_10024545313300006057WatershedsVSYYAPAALAARHHLTADLAASMAGINALTDALVAS*
Ga0070715_1008619133300006163Corn, Switchgrass And Miscanthus RhizosphereWDDGDQTKVSYYAPAALAAKHHLSAELAATLSGINALTDALVAS*
Ga0070716_10006989513300006173Corn, Switchgrass And Miscanthus RhizosphereGQTKVSYYSPDALAARHHLGAGLAGNLAAVNALTDALTAS*
Ga0070712_10172508723300006175Corn, Switchgrass And Miscanthus RhizosphereVSYAAPAELARRYSLGADLTARLAGIDTLTDALVTS*
Ga0070765_10099049813300006176SoilLIWADGSRTNVTYYSPAAIAARYGLSGELAAMLAGIDPLTDALVAE*
Ga0079222_1034008223300006755Agricultural SoilEGQTKVSYYSPDELAARHHLGPELAANLAGISALTDALVAP*
Ga0079222_1250151713300006755Agricultural SoilKVTYYSPAALAARYHLGAELAGNLAAVNVLTDALVAS*
Ga0066660_1158015513300006800SoilDGQQTSVSYTAPAALAARHGLSEELAGRLAGIERLTDALTAE*
Ga0079220_1087873523300006806Agricultural SoilEGQTRVTYYAPAALAARHHLNADLAAKLSVVDPLTDALVAP*
Ga0079219_1183097913300006954Agricultural SoilEGQTKVSYYSPDELAARHHLGPELAANLVGVNALTDALVAP*
Ga0099830_1091102813300009088Vadose Zone SoilQTKVSYYAPEALAARHHLSADLAANLAGIGPLTDALVAA*
Ga0099830_1168973813300009088Vadose Zone SoilYYAPGPLAERHHLSADLARNLAGIDLLTDALVAP*
Ga0099827_1200573413300009090Vadose Zone SoilDAGQTMVTYSTPGPLAERHHLSADLARNLAGIDPLTDALVAP*
Ga0105245_1315084123300009098Miscanthus RhizosphereLKVLVWADEAQTKVSYVAPAALGTRYGLTADLTAELAGIGPLTDALVAP*
Ga0105247_1021922513300009101Switchgrass RhizosphereKVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP*
Ga0066709_10164374233300009137Grasslands SoilVSYTAPSALAARHHLDPDLAERLAGIDTITDALVAP*
Ga0116215_112575423300009672Peatlands SoilYYSPATIAARHHLSPELAGNLAGINALTDALVAP*
Ga0116215_154290413300009672Peatlands SoilQTKISYYSPAALAASHHLTADLAASLAGINALTDALVASQRPDPGSVKARA*
Ga0116224_1047353713300009683Peatlands SoilETKVSYLAPDGLAARYGIPPDLAANLRGIDHLTDALVAA*
Ga0116217_1080441013300009700Peatlands SoilKVSYYGPAALAARYDLSADLAAKLAGIDPVTDALIAQ*
Ga0126373_1301864113300010048Tropical Forest SoilKVLVWADGALTKVTYVAPGALGARYRLSDDLTAKLAGIGPLTDALVAP*
Ga0126318_1061186113300010152SoilKISYYSPDALAARHHLGADLAGNLAAVNALTDALIA*
Ga0074045_1077363423300010341Bog Forest SoilADEGQTKVSYYAPAALAASHHLTADLAANLAGIDTLTDALVAS*
Ga0126370_1174703713300010358Tropical Forest SoilYYGPAALAARYDLSADLSTELAGIDPLTDALVAP*
Ga0126372_1008609923300010360Tropical Forest SoilDDGQTKVTYYGPAALAARYDLSAGLSAKLAGIDPLTDALVAP*
Ga0126378_1077399213300010361Tropical Forest SoilLIWADDGQTKVTYYSPAAQAARYDLSAELAAGLASIDPLTDALIAP*
Ga0126378_1101874913300010361Tropical Forest SoilMVSYYMPAALAARHHLTSDLAAKLAGIDPLTDALIAP*
Ga0126378_1256524813300010361Tropical Forest SoilMQVLIWADGGQTKVSYYAPAAVAASHRLPEDLAANLAGINALTDALVA
Ga0126379_1154881313300010366Tropical Forest SoilLVWADDGQTKVTYYGPAALATRYDLSADLSAKLAGIDPLTDALVAP*
Ga0136449_10054411713300010379Peatlands SoilLKVLVWDDEGQTKVSYYAPAALAARHHLGPDLAGNLAGINALTDALVAS*
Ga0136449_10127555313300010379Peatlands SoilTKVSYYAPAALAARHHLGPELAGNLAGINGLTDALVAS*
Ga0136449_10195595623300010379Peatlands SoilPLKVLVWDDAGQTKVTYYAPAALAARYQLSADLEGNLAAINPLTDALIAP*
Ga0136449_10222257013300010379Peatlands SoilVSYSAPAWLAARYQLSDELAANLAGIDPLTDALTSR*
Ga0136449_10257095013300010379Peatlands SoilGQTKVSYYAPAALAASHHLTADLAASLAGINALTDALVASQRPDPGSVKARA*
Ga0126383_1026416113300010398Tropical Forest SoilDAGETKVSYYAPGALAARHHLSADLAPRLAAVDPITDALVAP*
Ga0126383_1124230923300010398Tropical Forest SoilQTKVSYWAPAVLAARHRLSPALAKNLAGIDPLTDALVAG*
Ga0126383_1305612113300010398Tropical Forest SoilKVLVWDDAGQTQVTYTATAVLAARHQLGPDLAARLAGIDPLTDALVNS*
Ga0126383_1340210913300010398Tropical Forest SoilKVLVWADGAQTKVSYVAPAALGTRYGLTADLTAKLAGIGPLTDALVAP*
Ga0134122_1014550913300010400Terrestrial SoilDDGDQTKVSYYAPAALAAKHHLSADLAATLSGINALTDALVAS*
Ga0126361_1040963813300010876Boreal Forest SoilLPLKILVWSDEGQTKVSYTSPAALAARYRLPPELAGNLAAINALTDALVNA*
Ga0126361_1048428733300010876Boreal Forest SoilYLAPAALAARHHLSADLAANLAGINALTDALVAS*
Ga0126361_1092831823300010876Boreal Forest SoilVLIWADEGQTKVSYYAPAALAASHHLTADLAASLSGINVLTDALVAA*
Ga0105246_1188045423300011119Miscanthus RhizosphereSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP*
Ga0137392_1076223113300011269Vadose Zone SoilKVLVWADGAQTKVTYVAPAALGARYGLTADLTAKLAGIDPLTDALVAP*
Ga0137389_1163405823300012096Vadose Zone SoilVWADGPHTKVSYYAPEALAARHHLSADLAANLAGIGPLTDALVAA*
Ga0137383_1136273613300012199Vadose Zone SoilQTKVSYYAPAALAARHHLDADLAAKLAGIDPLTDALVAQ*
Ga0137382_1009082613300012200Vadose Zone SoilTMVTYYAPGSLAERHHLSADLARNLAGIDPLTDALVAP*
Ga0137365_1121325113300012201Vadose Zone SoilQTMVTYSSPGPLAERHHLSADLARNLAGIDPLTDALVAP*
Ga0137380_1019815213300012206Vadose Zone SoilAGQTKVSYNAPAWLAARHHLGEDLAGNLAGIDALTDALVAP*
Ga0137380_1171472113300012206Vadose Zone SoilAGQTKVSYNAPAWLAARHHLGEDLAGNLAGIDALTDALVAL*
Ga0137379_1002559013300012209Vadose Zone SoilKVSYYAPEALAARHHLSAGLTANLAAVDALTDALVAS*
Ga0137378_1071742013300012210Vadose Zone SoilQTKVSYNAPAWLAARHHLGEDLAGNLAGIDALTDALVAP*
Ga0137378_1185267513300012210Vadose Zone SoilGQTKVSYYSPAGLAARHHLGAGLAGNLAAIDVLTDALVAS*
Ga0137372_1099311113300012350Vadose Zone SoilQTNVTYYAPGALAARHHLTADLAAKLAGIDPLTDAVVAPDP*
Ga0137385_1018616713300012359Vadose Zone SoilGQTKVSYNAPAWLAARHHLGEDLAGNLAGIDALTDALVAP*
Ga0137404_1213945713300012929Vadose Zone SoilDAGQTMVTYYAPGPLAERHHLSADLARNLAGIDPLTDALVAP*
Ga0157369_1221814323300013105Corn RhizosphereSYYSPDALAARHHLGAGLAGNLAAVNALTNALIAP*
Ga0157372_1053237013300013307Corn RhizosphereTKVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP*
Ga0120155_107519723300013768PermafrostTSVSYYAPGVFQVRHGLDPDLARNLAGIDALTDALVAA*
Ga0181523_1033074823300014165BogLVWADEEKTRVSYYDPAALAARHNVSADLAGNLAGIHALTDALVAS*
Ga0181534_1007959633300014168BogLIWADGNRTNVTYHTPAAIAACYGLSAELATKLAAVDPLTDALIAG*
Ga0182024_1102981223300014501PermafrostPLKVLVWADGEQTKVSYLAPEALGARHHLDADLTESLAGIDPLTDALVAVSP*
Ga0181525_1042953833300014654BogKVLVWADGGQTKVSYLAPAALAARHQLTAELGARLAGIDPLTDALVAS*
Ga0157376_1036805423300014969Miscanthus RhizosphereVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP*
Ga0182041_1159031323300016294SoilWADGEQTKVSYYAPAALAASHRLPDDLAANLAGINALTDALVGS
Ga0182033_1022425613300016319SoilVLVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVVP
Ga0182035_1012745643300016341SoilLKVLVWADGEQTKVTYVAPAALGARYQLTADLTAKLAGIGPLTDALVAP
Ga0182040_1170915213300016387SoilDDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVVP
Ga0182040_1185428713300016387SoilKVSYYAPAELAARHRLGPDLEKNLAAIDSLTDALVTPA
Ga0182037_1054511613300016404SoilPLKVLVWADGGQTKVSYYGPAALAARYDLSAELAAKVAAVDPLTDALIAP
Ga0182038_1031830433300016445SoilLIWADDGQTKVTYYGPAALAARYDLSADLEAKLAAIDPLTDALIAP
Ga0182038_1048688223300016445SoilPLKVLVWDDGGQTKVSYYAPAELAARHGLGPDLEKNLAAIDTLTDALVAAS
Ga0187812_114271533300017821Freshwater SedimentWADGGQTKVSYYAPAALAARRHLTADLAANLSGINALTDALVAS
Ga0187818_1035680323300017823Freshwater SedimentSYHSSDALAARHHLSADLAGINPLTDALVAPEGEPS
Ga0187818_1036517923300017823Freshwater SedimentIWADGSRTNVTYYSPEAIAARYGLNAELAAKLAGIDPLTDALVADD
Ga0187820_100216413300017924Freshwater SedimentKVTYYGPAALAARYDLNADLTAKLAAIDLLTDALIAP
Ga0187820_124637623300017924Freshwater SedimentDLPLKILIWADGSRTNVTYYTPAAIAARYGLSAELAAKLAGIDPLTDALVAD
Ga0187807_103100323300017926Freshwater SedimentLKVLVWADAKQTKVSYYAPAALAASHHLSDDLAGNLAGINALTDALVAS
Ga0187814_1000635963300017932Freshwater SedimentPLKILVWDDNGQTKVSYYAAATLAARYSLPADLAAKLAIAPLADALLAP
Ga0187809_1014540413300017937Freshwater SedimentKVSYYAPAALAARHHLGADLEANLAGIDALTDALVASR
Ga0187808_1005101323300017942Freshwater SedimentDEGQTKVSYYAPAALAARHHLGPDLAGNLAGINALTDALVAS
Ga0187783_1031133223300017970Tropical PeatlandMTRMVGAGKVSYYGPDAIAAHHHLSADLAGNLAGINALTDALVAA
Ga0187884_1047144423300018009PeatlandVWADGVETKISYYDPRALTIRHDLSADLARNLSGIDALTDALVAS
Ga0187810_1025416523300018012Freshwater SedimentSYYAPAALAARHHLPPELAGNLAGINGLTDALVAT
Ga0187890_1032475123300018044PeatlandDDAGQVKVSYSAPAWLAARHQLSDELAANLAGIGPLTDALIAR
Ga0187772_1034514713300018085Tropical PeatlandDGDQTKVSYYAPAALAARHHLPADLAASLAGINALTDALVAS
Ga0187772_1068351013300018085Tropical PeatlandIWADGEQTRVSYYAPAALAARHHLSDDLAGNLAGINALTDALVAS
Ga0187772_1107541613300018085Tropical PeatlandTQVSYVDPAVVAARYDLSPELAAALAGIHALTDALVAG
Ga0187769_1138797113300018086Tropical PeatlandKVSYYSPSALAASHHLSADLAANLSGINALTDALVAF
Ga0210399_1106279423300020581SoilMGRPRAAKVSYNAPAWLTARHHLADDLAANLAGVDQLTDALITP
Ga0210395_1031830413300020582SoilVLVWADGAQTKVSYAAPAALGARYGLTADLTAKLAGIDPLTDTLVAP
Ga0210405_1049495123300021171SoilVLIWSDKGQTKVSYYAPTALAARHHLGPELAGNLAGINGLTDALVASSHGQDGNPAIVI
Ga0210396_1077775323300021180SoilGVGGDGDRRTKVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP
Ga0210388_1117531723300021181SoilEGQTKVSYYAPAALAARHHLGADLAGNLAGINALTDALVAA
Ga0213875_1056926723300021388Plant RootsVSYYAPEALAARHHLGPELAGNLAGISAITDALVAS
Ga0210393_1012693413300021401SoilKVTYVAPAALGARYGLTADLTAKLAGIDPLTDALVAP
Ga0210393_1044112113300021401SoilDEGQTKVSYTSPAALAARYQLPPELAGNLAAINALTDALVSS
Ga0210385_1097489313300021402SoilKVLVWADEGQTKVSYYAPAALAARHHLGADLAGNLAGINALTDALVAA
Ga0210397_1101032013300021403SoilPSRQSVAAALATRHHLTADLAASLAGVNALTDTLVAS
Ga0210389_1140870513300021404SoilWDDDGQTKVSYYDPAALAARHQVPAGLAGNLAAINGLTDALVAP
Ga0210387_1079222523300021405SoilDEGETKISYVTPAALAARHRLSADLAGNLAAIEQLTDALVAP
Ga0210383_1133912623300021407SoilDEGQTKVSYYAPAALAARHHLGPELEGNLAGINGLTDALVAS
Ga0210392_1071577323300021475SoilLKVLVWADGAQTKVSYAAPAALGARYGLTADLTAKLAGIDQLTDALVAP
Ga0210402_1097455123300021478SoilKVSYYAPATLASRYDLGADLAARLAGVDPLTDALVAPDA
Ga0126371_10001139243300021560Tropical Forest SoilLKVLVWDDDGQTKVTYYSPDALAARYHLGAGLAGNLAAINALTDALVAS
Ga0247661_104491533300024254SoilQTKVSYYSPDALAARHHLGAGLAGNLAAVNALTDALTAS
Ga0208357_100909353300025703Arctic Peat SoilKVLVWADGDQVKVSYVAPPVLAARRGLPADLAQNLAGIDGLTDALVAP
Ga0207710_1042792623300025900Switchgrass RhizosphereKVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP
Ga0207699_1028015923300025906Corn, Switchgrass And Miscanthus RhizosphereVWSDGEQTVVSYTAPAELAARHHLSPELAQNLAGIEPLTDALVDW
Ga0207663_1024083413300025916Corn, Switchgrass And Miscanthus RhizosphereGQTKVSYYSPDELAARHHLGPGLAANLAGVNALTDALVAP
Ga0207646_1052813023300025922Corn, Switchgrass And Miscanthus RhizosphereTKVSYYSPDALAARHHLGAGLAGNLAAVNTLTDALIAP
Ga0207687_1074096923300025927Miscanthus RhizosphereSYYAPAELAARHGFGPGLEKNLAAIDALTDALVATA
Ga0207700_1011012213300025928Corn, Switchgrass And Miscanthus RhizosphereISYHAPAALAAKHHLSADLAATLSGINALTDALVAS
Ga0207686_1038760713300025934Miscanthus RhizosphereSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP
Ga0207709_1003624143300025935Miscanthus RhizosphereGDQTKVSYYAPAALAAKHHLSADLAATLSGINALTDALVAS
Ga0207704_1042518913300025938Miscanthus RhizosphereQTKVSYYSPDALAARHHLGAGLAGNLAAVNVLTDALIAP
Ga0207665_1066267123300025939Corn, Switchgrass And Miscanthus RhizosphereGMKPFAVIDQADEGQTKVSYYAPAALAASHHLTADLAANLAGINALTDTLAAS
Ga0209154_132417013300026317SoilPLKVLVWADAQQTKVSYDAPAAIARRRGLSRELAANLTGINAVTDALVTP
Ga0257146_102972813300026374SoilTKVSYYSPDALAARHHLGAGLAGNLAAVNALTDALTAS
Ga0209806_102845213300026529SoilVWADAQQTKVSYDAPAAIARRRGLSRELAANLTGINALTDALVTP
Ga0209806_104391413300026529SoilVWADAQQTKVSYDAPAAIARRRGLSRELAANLSGINAVTDALVTP
Ga0208475_100992813300027018SoilGQTNVSYYAPAELAARHRLGPGLAGNLAAIGTLTDALVAP
Ga0207800_103869123300027043Tropical Forest SoilVLIWADGDQAKVSYYAPAALAARHQLPADLAANLAGINALTDALVAS
Ga0208488_104013213300027110Forest SoilVSYYAPATLAARHHLSADLAARLGAVDPITEALVAP
Ga0208324_117163213300027604Peatlands SoilLKVLVWDDEGQTKVSYYAPAALAARHHLGPDLAGNLAGINALTDALVAS
Ga0208990_112386323300027663Forest SoilVWADGEQTKVSSVAPSALTARHHLPMDLVKNVPGIVGLTDALVAP
Ga0207826_121460223300027680Tropical Forest SoilKVTYESPTSIAARHGLTPDLAARLAGIDPLTDALVADG
Ga0209178_139123113300027725Agricultural SoilSYYSPDALAARHHLGADLAGNLAAVNALTDALIAS
Ga0209274_1013165823300027853SoilKVLVWADGDQTKVSYYTPAAIAANHNLGADLAGNLAAINVLTDALVAA
Ga0209274_1020399523300027853SoilAGDTKVSYYAPATLAARHHLSADLAARLAAIDPITDALVAP
Ga0209517_1045429813300027854Peatlands SoilKVSYYSPAAIAARHHLSAELAGNLAGINALTDALIVP
Ga0209579_1040989513300027869Surface SoilVSYYAPAALAASHHLSDDLAGNLAGINALTDALVAS
Ga0209275_1039795023300027884SoilSYYAPAAIAARHHLRPELAGNLAGINGLTDALVASQP
Ga0307307_1026290713300028718SoilVLEVCRVVLVWDDAGQTKVSYYAPAELAARHRLGPGLAGNLAAIGTLTDALVAP
Ga0307282_1006255213300028784SoilLEVRRVVLVWDDAGQTKVSYYAPAELAARHRLGPGLAGNLAAIGTLTDALVAP
Ga0307282_1018846813300028784SoilVLVWDDAGQTKVSYYAPAELAARHRLGPGLAGNLAAIGTLT
Ga0265338_1013179453300028800RhizosphereWADGNRTNVTYYSPAAIAARYGLSDELAARLAGIDPLTDALVAD
Ga0307296_1001867023300028819SoilVLVWDDAGQTKVSYYAPAELAARHRLGPGLAGNLAAIGTLTDALVAP
Ga0302235_1044132213300028877PalsaADGSRTNVTYYSPAAIAARYDLSAELAANLAGLDPLTDALVAQ
Ga0308309_1060382123300028906SoilLVWADGAQTKVTYVAPAAVGARYGLTADLTAKLAGIDPLTDALVAP
Ga0308309_1125981913300028906SoilIWSDSGQTKISYYAPAALAARHHIAPELASNLGAVNALTDALIAP
Ga0311340_1028479333300029943PalsaWADGIRTNVTYYTPAALAARHGLSAELAAKLAGIDPLTDALVAD
Ga0311371_1213146713300029951PalsaPLNILIWADGSGTNVTYFSPAALAARYGLSAELAANLAGIDPLTDALVAQ
Ga0311339_1053490523300029999PalsaADGSRTNVTYYSPAAIAARHGLSSELARELAAIDQLTDALIGD
Ga0311338_1060624713300030007PalsaDEGQTQVTYYDPAALAARHHLDASLAANLAGINALTDALVAS
Ga0302178_1045028523300030013PalsaVTYYDPAALAARHHLDASLAANLAGINALTDALVAS
Ga0302182_1038896713300030054PalsaVLIWADEGQTKVSYYAPTALAASHHLIADLAASLSGINVLTDALVAA
Ga0302181_1010557743300030056PalsaGQTKVTYYGPAALAARYDLNADLTAKLAAIDPLTDALVAP
Ga0302181_1048952023300030056PalsaTVSYYGPEALTARYGLDRSLQAKLAGIDPLTDALIAA
Ga0302184_1039296323300030490PalsaQTKVTYYGPAALAARYDLNADLTAKLAAIDPLTDALVAP
Ga0311372_1295411123300030520PalsaWAEEGQTKVSYYGPAALAARYGLSEELAAKLAGIDPLTDGLIAQ
Ga0311355_1029201823300030580PalsaDQGQTKVSYYAPSVLATRYHLDADLAHNLAGIDALTDALVAP
Ga0311356_1065123633300030617PalsaKILIWADGSRTNVTYYTPAALAARHGLSAELAAKLAGIDPLTDALVAD
Ga0307921_100578413300030712SoilQTKVSYCAPAALAARHHLTAELAAKLAGIDPLTDALIAP
Ga0302311_1024265923300030739PalsaGQTKVSYYAPSVLATRYHLDADLAHNLAGIDALTDALVAP
Ga0170834_10195257713300031057Forest SoilQTKVSYYAPAALTARHHLGPELAGNLAGVNGLTDALVAS
Ga0307495_1022302323300031199SoilAGQTKVSYYAPAELAARHGLGPDLEKNLAAIDALTDALVAAA
Ga0302324_10018720773300031236PalsaDDGQTKVTYYGPAALAARYDLNADLTAKLAAIDPLTDALVAP
Ga0302326_1196901233300031525PalsaWADDGQTKVTYYGPAALAARYDLNADLTAKLAAIDPLTDALVAP
Ga0302326_1366056523300031525PalsaGEQTKVSYYAPASLAALHHLSDDLAQTLAGIGPLTDALIAP
Ga0318516_1028550223300031543SoilVLIWADEGQTKVSYYAPAALAASHHLTAELAANLSGINALTDALVAS
Ga0318516_1086746423300031543SoilLKVLVWDDRGQTKVSYVAPDALAARYHLSADLAGNLAGLNALTDALVAP
Ga0318534_1021143523300031544SoilGQTKVSYYAPAELAARHGLGPDLEKNLAAIDSLTDALVTPA
Ga0318534_1070244223300031544SoilTKVTYYSPAALAARYHLSADLATNLAAIDALTDALVAS
Ga0318538_1058418113300031546SoilTYYGPAALAARYGLNADLTAKLAAIDPLTDALVAP
Ga0318528_1069300813300031561SoilQTKVTYYGPAALAARYDLRPDLSTKLAGIDPLTDALVAP
Ga0318573_1079998423300031564SoilGRTKVSYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG
Ga0318555_1001476133300031640SoilVTYYGPAALAARYDLNADLSAKLADIDPLTDALVAP
Ga0318542_1013189323300031668SoilVTYYGPAALAARYDLNADLTAKLAAIDPLTDALIAP
Ga0318542_1018232813300031668SoilAGVTKVTYYGPAALSARYDLNADLTAKLAAIDPLTDALIAP
Ga0318542_1064594623300031668SoilVTYYAPAALAARHHLDAALAANLAVVDPLTDALVAP
Ga0318572_1031749113300031681SoilVLVWADDGQTKVTYYGPAALAARYELSAGLSAKLAGIDPLTDALVAP
Ga0310686_11715667323300031708SoilAGQTTVSYYSPATLAARHRLPADLAARLAATDPLTDALVA
Ga0318496_1011737623300031713SoilPLKVLVWDDAGQAKVSYYAPATLAARHHLGPDLAAKLAVVDPLTDALVAP
Ga0306917_1094705613300031719SoilWADGDQTKVSYYAPAALAARHRLPADLAANLAGIDALTDALVAS
Ga0306917_1134091213300031719SoilASYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG
Ga0318493_1039261023300031723SoilVLVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAP
Ga0318493_1043250123300031723SoilDAGQAKVSYYAPATLAARHHLGPDLAAKLAVVDPLTDALVAP
Ga0318500_1021980013300031724SoilLKVLVWADGAQTKVTYVAPGALGARYRLSDDLTAKLAGIGPLTDALIAP
Ga0318500_1033521533300031724SoilVLVWADGGQTKVTYTAPAALAARYQLGADLAAKLAGIGPLTDALIAP
Ga0318501_1008931213300031736SoilALIWADGHQTKVSYYAPATVAARHHLPEDLAANLAGINALTDALVAS
Ga0318501_1041560523300031736SoilTKVSYYSPDALAARHHLGADLAGNLAGINALTDTLVAS
Ga0306918_1103253113300031744SoilTKVSYVAPDALAARYHLSADLAGNLAGLNALTDALVAP
Ga0306918_1118531513300031744SoilWDDGGQTKVTYYGPAALAARYGLNADLTAKLAAIDPLTDALVAP
Ga0318492_1043107713300031748SoilVLVWDDRGQTKVSYVAPDALAARYHLSADLAGNLAGLNALTDALVAP
Ga0318494_1002686943300031751SoilTKVTYYAPATLAARHHLDADLAARLAAVDPLTDALVAP
Ga0318494_1044942513300031751SoilVWADDGQTKVTYYGPAALAARYDLNADLSAKLAGIDPLTDALVAP
Ga0318494_1062788413300031751SoilGQTNVTYYAPAALATRHHLSADMAAKLAGIDPLTDALIAPMNYVPCR
Ga0318494_1065775923300031751SoilVSYYAPATLAARHHLGPDLAAKLAVVDPLTDALVAP
Ga0318494_1078645013300031751SoilVLIWADEGQIKVSNYAPAALAASHHLSADLAANLAGINALTDALVAA
Ga0318554_1017815133300031765SoilDLPLKILIWADGSRTNVTYYSPAAIAARYGLSAELAAKLAGIDPLTDALIADW
Ga0318509_1006900423300031768SoilGGQTSVSYDATATLAARHHLSADLAAKLAGIDPLTDTLITT
Ga0318509_1013134213300031768SoilAKVSYYAPATLAARHHLGSDLAAKLAVVDPLTDALVTP
Ga0318526_1017035823300031769SoilDQGQTKVSYYAPEALAAQHHLSAGLTANLAGIDALTDMLVAP
Ga0318521_1002098233300031770SoilRQTNVTYYAPDALAARHHLGPDLTARLAGIDPLTDALIAP
Ga0318521_1012860513300031770SoilDGQTSVTYYSPAAVAARHHLDADLARNLASIDALTDALVAA
Ga0318521_1069838213300031770SoilKVTYYAPAALATRHHLNADLAAKLSVVDPLTDALITP
Ga0318546_1035363513300031771SoilGQTKVTYYGPAALAARYDLNADLSAKLADIDPLTDALVAP
Ga0318547_1082200113300031781SoilSYYAPAELAARHGLGPDLEKNLAAIDTLTDALVAAS
Ga0318548_1007156913300031793SoilQTKVTYYAPATLAARHHLDADLAARLAAVDPLTDALVAP
Ga0318548_1017871423300031793SoilTNVTYYAPDALAARHHLSPDLAARLAGIDPLTDALIAR
Ga0318576_1022898413300031796SoilTVSYYDPAALADRHHLSADLAARLSGIGPLTDALVAP
Ga0318523_1000468053300031798SoilIWADDGQTKVTYYGPAALAARHDLSADLEAKLAAIDPLTDALIAP
Ga0318523_1003856613300031798SoilGQTTVSYYDPAALADRHHLSADLAARLSGIGPLTDALVAP
Ga0318565_1005974513300031799SoilSYDATATIAARHHLSADLAAKLAGIDPLTDTLITT
Ga0318565_1033659413300031799SoilQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAP
Ga0318568_1083671513300031819SoilVSYYAPAELAARHGLGPDLEKNLAAIDTLTDALVAAS
Ga0318567_1004476813300031821SoilSYYDPAALADRHHLSADLAARLSGIGPLTDALVAP
Ga0318567_1068534113300031821SoilWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA
Ga0307478_1035632213300031823Hardwood Forest SoilKVSYYAPSALAASHHLSADLAANLAGIDALTDALVAS
Ga0318564_1005625913300031831SoilGQTKVSYYSPDALAARYHLGVGLAGNLAAINALTDALVAS
Ga0318564_1011595913300031831SoilQTNVTYYAPDALAARHHLSPELAARLAGIDPLTDALVAA
Ga0318499_1040630413300031832SoilVLIWADGDQTKVSYYAPAALAASHHLTADLAANLAGINALTDALVAS
Ga0318499_1042971213300031832SoilVSYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG
Ga0310917_1048100433300031833SoilQTKVTYYAPATLAARHHLDADLATRLAAVDPLTDALVAP
Ga0318511_1001733213300031845SoilLKVLVWADDGQTKVTYYGPAALAARYDLNADLSAKLAGIDPLTDALVAP
Ga0318512_1045196413300031846SoilRTNVTYYSPAAIAARYGLSAELAAKLAGIDPLTDALIAGW
Ga0306919_1013681213300031879SoilWADDGQTKVTYYGPAALAARYDLNADLSAKLAGIDPLTDALVAP
Ga0318544_1028909813300031880SoilLPLKVLVWADGEQTKVTYVAPAALGARYQLTADLTAKLAGIDPLTDALVAP
Ga0306925_1075357623300031890SoilLRVLVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA
Ga0306925_1090482513300031890SoilKVLIWADEGQIKVSNYAPAALAASHHLSADLAANLAGINALTDALVAA
Ga0318536_1004056243300031893SoilTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA
Ga0318536_1006904213300031893SoilVLVWADDGQTKVTYYGPAALAARYDLNADLSAKLAGIDPLTDALVAP
Ga0318522_1042805513300031894SoilWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAP
Ga0306923_1020141033300031910SoilGRTEVSYWAPAALAARHRLSPALANNLAGIDSLTDALVAG
Ga0306923_1059984813300031910SoilRVLVWADGAQTKVTYVAPAALGTRYQLTADLTAKLAGIDPLTDALVAP
Ga0306921_1035123123300031912SoilLPLKILVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA
Ga0306921_1054564243300031912SoilLKVLVWADGGQTKVTYTAPAALAARYQLGADLAAKLAGIGPLTDALIAP
Ga0306921_1159543313300031912SoilDDGRTKASYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG
Ga0310912_1027401413300031941SoilDGRTKVSYWAPAVLAARYRLNPALAKNLAAIDPLTDALVAG
Ga0310912_1059411823300031941SoilVLIWDDGGQATVSYDDPAAVAGRHHLSADLAARLAGIGPLTDALVAP
Ga0310916_1147467013300031942SoilQTKVTYYGPAALAARYGLNADLTAKLAAIDPLTDALVAP
Ga0310913_1005434113300031945SoilSYYDPAALAYRHHLSADLAARLSGIGPLTDALVAP
Ga0310910_1056239023300031946SoilDLPLKVLVWADGAQTKVTYVAPAALGARYRLSDDLTAKLAGIGPLTDALVAP
Ga0306926_1002809583300031954SoilQTNVTYYAPDALAARHHLSPDLAARLAGIDPLTDALIAP
Ga0306926_1061444013300031954SoilIWDNAGQTNVTYYAPAALATRHHLSADMAAKLAGIDPLTDALIAP
Ga0306926_1299583623300031954SoilIWADGDQTKVSYYAPAAVAASHHLPGDLAANLAGINALTDALVAS
Ga0306926_1303951613300031954SoilLKVLVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAP
Ga0318530_1026434013300031959SoilWADGAQTKVSYVAPAVLGARYGLTADLTAKLAGVDPLTDALVAP
Ga0307479_1002884663300031962Hardwood Forest SoilTTKVTYDDPAALAVRHHVPADLVPNLAAINGLTDALVAP
Ga0306922_1171508013300032001SoilTSVTYYSPAAVAARHHLDADLARNLASIDALTDALVAA
Ga0318569_1007952933300032010SoilLKVLVWADGAQTKVTYVAPAALGARYRLSDDLTAKLAGIGPLTDALVAP
Ga0318569_1037190813300032010SoilDPGRTCVSSAAPAELAARYQLSDELAAGLAGIDPLTDAAIVR
Ga0318507_1015477613300032025SoilSYVAPAVLGARYGLTADLTAKLAGVDPLTDALVAP
Ga0318507_1048314623300032025SoilVWDDAGQAKVSYYAPATLAARHHLGSDLAAKLAVVDPLTDALVTP
Ga0318559_1060905913300032039SoilTKVSYYAPAALAASHHLTADLAANLAGINALTDALVAS
Ga0318545_1021619213300032042SoilVLVWADGAQTKVSYVAPAALGARYGLAANLTARLAGIDPLTDALVAP
Ga0318558_1007235023300032044SoilTKVSYYSPDALAARYHLGAGLAGNLAAINALTDALVAS
Ga0318558_1013907033300032044SoilVSHYAPATVAARHHLPEDLAANLAGINALTDALVAS
Ga0318533_1074953013300032059SoilQCSPTPATSALAARHHLSPELAANLAAIDTLTDALVAA
Ga0318533_1133000623300032059SoilSYYSPDALAARYHLGVGLAGNLAAINALTDALVAS
Ga0318504_1021445713300032063SoilVWADGGQTKVSYYGPAALAARYDLSAELAAKVAAVDPLTDALIAP
Ga0318510_1014255033300032064SoilVLVWADGAQTKVSYVAPAVLGARYGLTADLTAKLAGVDPLTDALVAP
Ga0318510_1051931423300032064SoilSDNGQTNVTYYAPDALAARHHLSPDLAARLAGIDPLTDALIAP
Ga0318514_1019630813300032066SoilVSYDDPAAVAGRHHLSADLAARLAGIGPLTDALVAP
Ga0318514_1069697523300032066SoilKISYYAPAALAARHRLPADLAANLAGIDALTDALVAS
Ga0318553_1064107023300032068SoilADAGQTKVSYYGPVTLAARYHLGADLAANLAAIDVLTDALVAP
Ga0318553_1066000113300032068SoilQGQTKVSYYGPAALAARYDLTADLTAKLAAIDPLTDALTAP
Ga0318525_1057612313300032089SoilDDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA
Ga0318577_1037463623300032091SoilKVLIWDDGGQATVSYDDPAAVAGRHHLSADLAARLAGIGPLTDALVAP
Ga0318540_1002091513300032094SoilAGQAKVSYYAPATLAARHHLGSDLAAKLAVVDPLTDALVTP
Ga0307470_1186088123300032174Hardwood Forest SoilGQTKVSYFDPAELAARHRLGPGLAGNFAAIGTLTDALVAP
Ga0307471_10258731713300032180Hardwood Forest SoilYYAPAELARRHGLSPELEGRLASIDQLTDALVGPG
Ga0306920_10125085533300032261SoilYYSPAAIAARYGLSAELAAKLAGIDPLTDALIADW
Ga0306920_10255060513300032261SoilDLPLKILVWADEGQTKVTYYGPAALAARYGLSAGLSARLAGIDPLTDALVAP
Ga0306920_10283970623300032261SoilIWADGEQTKVSYYAPAALAASHRLPDDLAANLAGINALTDALVGS
Ga0306920_10321261223300032261SoilTKVSYYAPAALAASHRLPADLAASLAGINALTDALVAS
Ga0335085_1206169513300032770SoilATLAARYHLGAGLAGNLAGINALTDALVAPQASGAAP
Ga0335082_1082991613300032782SoilYYAPAELAARHGLGPGLEQNLAAIDVLTDALVGPA
Ga0335080_1130730723300032828SoilTKVSYVAPDALAARYHLGADLAGNLAGINGVTDALVAP
Ga0335081_1265435713300032892SoilLVWSDGDQTKVSYYAPAALAARHHLGPDLAANLAGIDGLTDALVAP
Ga0335069_1237051113300032893SoilTNVTYYSPAALATRYELSDELAAKLAVVDPLTDALCAG
Ga0335074_1098306023300032895SoilDGDQTKVSYYAPAALAASHHLSADLAASLAGINALTDALVAS
Ga0335075_1042115233300032896SoilIWADEGQVKVSYYAPEELGRRHGLRQDLVANLAGIGPITDALIAD
Ga0335072_1150352013300032898SoilDGSRTNVTYYSPAALAARFGLSGELAAKLAGIDPLTDALVAGQ
Ga0335073_1186584023300033134SoilVTYYGPAALAARYGLDAELTAKLAAIDPLTDALVAP
Ga0335077_1060996423300033158SoilTKVSYYSPAALAARHHLTADLAASLAGINALTDALVAS
Ga0310914_1009551353300033289SoilVWADDGQTKVTYYGPAALAARYDLSADLSAKLAGIDPLTDALVAPSAA
Ga0310914_1043627423300033289SoilWDDAGQTKVTYYGPAALAARYELNADLTAKLAAIDPLTDALITP
Ga0318519_1085419423300033290SoilVTYYAPATLAARHHLDADLATRLAAVDPLTDALVAP
Ga0334850_108146_3_1463300033828SoilVLVWDDGGQTTVSYYAPAALAARHHLDADLAANLAGINALTDALVAS
Ga0373950_0009161_1463_15733300034818Rhizosphere SoilSYYAPAELAARHGLGPGLEKNLAAIDALTDALIAPS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.