Basic Information | |
---|---|
Family ID | F009876 |
Family Type | Metagenome |
Number of Sequences | 311 |
Average Sequence Length | 42 residues |
Representative Sequence | MSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Number of Associated Samples | 51 |
Number of Associated Scaffolds | 311 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 18.97 % |
% of genes near scaffold ends (potentially truncated) | 70.10 % |
% of genes from short scaffolds (< 2000 bps) | 81.35 % |
Associated GOLD sequencing projects | 35 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.16 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.135 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer (69.132 % of family members) |
Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (99.035 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.86% β-sheet: 0.00% Coil/Unstructured: 90.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 311 Family Scaffolds |
---|---|---|
PF01557 | FAA_hydrolase | 2.57 |
PF07876 | Dabb | 2.25 |
PF11638 | DnaA_N | 1.61 |
PF03068 | PAD | 1.61 |
PF12344 | UvrB | 1.61 |
PF04932 | Wzy_C | 1.29 |
PF02954 | HTH_8 | 1.29 |
PF01476 | LysM | 1.29 |
PF10387 | DUF2442 | 1.29 |
PF00689 | Cation_ATPase_C | 1.29 |
PF11897 | DUF3417 | 0.96 |
PF02518 | HATPase_c | 0.96 |
PF04055 | Radical_SAM | 0.96 |
PF13432 | TPR_16 | 0.96 |
PF04452 | Methyltrans_RNA | 0.96 |
PF00891 | Methyltransf_2 | 0.96 |
PF00092 | VWA | 0.96 |
PF05016 | ParE_toxin | 0.96 |
PF00990 | GGDEF | 0.96 |
PF09970 | DUF2204 | 0.96 |
PF08668 | HDOD | 0.64 |
PF00436 | SSB | 0.64 |
PF10816 | DUF2760 | 0.64 |
PF00291 | PALP | 0.64 |
PF00171 | Aldedh | 0.64 |
PF01242 | PTPS | 0.64 |
PF13183 | Fer4_8 | 0.64 |
PF03050 | DDE_Tnp_IS66 | 0.64 |
PF12796 | Ank_2 | 0.64 |
PF01040 | UbiA | 0.64 |
PF13546 | DDE_5 | 0.64 |
PF01032 | FecCD | 0.64 |
PF02971 | FTCD | 0.64 |
PF13711 | DUF4160 | 0.64 |
PF08239 | SH3_3 | 0.64 |
PF07726 | AAA_3 | 0.64 |
PF13860 | FlgD_ig | 0.64 |
PF03808 | Glyco_tran_WecG | 0.64 |
PF13240 | zinc_ribbon_2 | 0.64 |
PF00873 | ACR_tran | 0.64 |
PF00359 | PTS_EIIA_2 | 0.64 |
PF03975 | CheD | 0.32 |
PF00108 | Thiolase_N | 0.32 |
PF01522 | Polysacc_deac_1 | 0.32 |
PF02410 | RsfS | 0.32 |
PF02540 | NAD_synthase | 0.32 |
PF04773 | FecR | 0.32 |
PF01740 | STAS | 0.32 |
PF02743 | dCache_1 | 0.32 |
PF01075 | Glyco_transf_9 | 0.32 |
PF13529 | Peptidase_C39_2 | 0.32 |
PF02730 | AFOR_N | 0.32 |
PF02911 | Formyl_trans_C | 0.32 |
PF09723 | Zn-ribbon_8 | 0.32 |
PF04012 | PspA_IM30 | 0.32 |
PF08241 | Methyltransf_11 | 0.32 |
PF13366 | PDDEXK_3 | 0.32 |
PF00441 | Acyl-CoA_dh_1 | 0.32 |
PF03755 | YicC_N | 0.32 |
PF00350 | Dynamin_N | 0.32 |
PF00364 | Biotin_lipoyl | 0.32 |
PF04851 | ResIII | 0.32 |
PF02910 | Succ_DH_flav_C | 0.32 |
PF03544 | TonB_C | 0.32 |
PF02915 | Rubrerythrin | 0.32 |
PF13677 | MotB_plug | 0.32 |
PF01618 | MotA_ExbB | 0.32 |
PF00437 | T2SSE | 0.32 |
PF02786 | CPSase_L_D2 | 0.32 |
PF02861 | Clp_N | 0.32 |
PF13492 | GAF_3 | 0.32 |
PF04892 | VanZ | 0.32 |
PF00072 | Response_reg | 0.32 |
PF00293 | NUDIX | 0.32 |
PF00583 | Acetyltransf_1 | 0.32 |
PF03129 | HGTP_anticodon | 0.32 |
PF07228 | SpoIIE | 0.32 |
PF13646 | HEAT_2 | 0.32 |
PF13620 | CarboxypepD_reg | 0.32 |
PF04986 | Y2_Tnp | 0.32 |
PF13401 | AAA_22 | 0.32 |
PF08299 | Bac_DnaA_C | 0.32 |
PF00672 | HAMP | 0.32 |
PF02784 | Orn_Arg_deC_N | 0.32 |
PF09720 | Unstab_antitox | 0.32 |
PF07478 | Dala_Dala_lig_C | 0.32 |
PF13242 | Hydrolase_like | 0.32 |
PF10431 | ClpB_D2-small | 0.32 |
PF00483 | NTP_transferase | 0.32 |
PF02874 | ATP-synt_ab_N | 0.32 |
PF13185 | GAF_2 | 0.32 |
PF01321 | Creatinase_N | 0.32 |
PF03099 | BPL_LplA_LipB | 0.32 |
PF02472 | ExbD | 0.32 |
PF07733 | DNA_pol3_alpha | 0.32 |
PF09084 | NMT1 | 0.32 |
PF00908 | dTDP_sugar_isom | 0.32 |
PF03219 | TLC | 0.32 |
PF02896 | PEP-utilizers_C | 0.32 |
PF05099 | TerB | 0.32 |
PF00278 | Orn_DAP_Arg_deC | 0.32 |
COG ID | Name | Functional Category | % Frequency in 311 Family Scaffolds |
---|---|---|---|
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 1.29 |
COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 1.29 |
COG1385 | 16S rRNA U1498 N3-methylase RsmE | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG3643 | Glutamate formiminotransferase | Amino acid transport and metabolism [E] | 0.64 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.64 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.64 |
COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.64 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.64 |
COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.64 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.64 |
COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.64 |
COG1842 | Phage shock protein A | Transcription [K] | 0.64 |
COG1871 | Chemotaxis receptor (MCP) glutamine deamidase CheD | Signal transduction mechanisms [T] | 0.64 |
COG1922 | UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family | Cell wall/membrane/envelope biogenesis [M] | 0.64 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.64 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.64 |
COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.32 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.32 |
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.32 |
COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.32 |
COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.32 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.32 |
COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.32 |
COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.32 |
COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.32 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.32 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.32 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG0799 | Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunits | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.32 |
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.32 |
COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.32 |
COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.32 |
COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.32 |
COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.32 |
COG3202 | ATP/ADP translocase | Energy production and conversion [C] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.14 % |
Unclassified | root | N/A | 21.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003830|Ga0051980_10258146 | Not Available | 850 | Open in IMG/M |
3300003830|Ga0051980_10269932 | Not Available | 822 | Open in IMG/M |
3300003830|Ga0051980_10276018 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin157 | 809 | Open in IMG/M |
3300003830|Ga0051980_10295014 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 769 | Open in IMG/M |
3300003830|Ga0051980_10430132 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 577 | Open in IMG/M |
3300003830|Ga0051980_10433902 | Not Available | 573 | Open in IMG/M |
3300004088|Ga0051987_10314842 | Not Available | 504 | Open in IMG/M |
3300004107|Ga0065179_1149898 | Not Available | 705 | Open in IMG/M |
3300004209|Ga0066649_10384781 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 727 | Open in IMG/M |
3300004212|Ga0066631_10164440 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
3300005236|Ga0066636_10003990 | All Organisms → cellular organisms → Bacteria | 9430 | Open in IMG/M |
3300005236|Ga0066636_10006037 | All Organisms → cellular organisms → Bacteria | 7785 | Open in IMG/M |
3300005236|Ga0066636_10007202 | All Organisms → cellular organisms → Bacteria | 7152 | Open in IMG/M |
3300005236|Ga0066636_10010176 | All Organisms → cellular organisms → Bacteria | 5991 | Open in IMG/M |
3300005236|Ga0066636_10014371 | All Organisms → cellular organisms → Bacteria | 4963 | Open in IMG/M |
3300005236|Ga0066636_10014746 | All Organisms → cellular organisms → Bacteria | 4891 | Open in IMG/M |
3300005236|Ga0066636_10023303 | All Organisms → cellular organisms → Bacteria | 3736 | Open in IMG/M |
3300005236|Ga0066636_10023915 | All Organisms → cellular organisms → Bacteria | 3678 | Open in IMG/M |
3300005236|Ga0066636_10025688 | All Organisms → cellular organisms → Bacteria | 3519 | Open in IMG/M |
3300005236|Ga0066636_10026402 | All Organisms → cellular organisms → Bacteria | 3463 | Open in IMG/M |
3300005236|Ga0066636_10030453 | All Organisms → cellular organisms → Bacteria | 3167 | Open in IMG/M |
3300005236|Ga0066636_10036424 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 2831 | Open in IMG/M |
3300005236|Ga0066636_10036446 | All Organisms → cellular organisms → Bacteria | 2830 | Open in IMG/M |
3300005236|Ga0066636_10042365 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
3300005236|Ga0066636_10051732 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
3300005236|Ga0066636_10059506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 2065 | Open in IMG/M |
3300005236|Ga0066636_10067174 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1908 | Open in IMG/M |
3300005236|Ga0066636_10080627 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
3300005236|Ga0066636_10101817 | Not Available | 1442 | Open in IMG/M |
3300005236|Ga0066636_10120787 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
3300005236|Ga0066636_10172793 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 998 | Open in IMG/M |
3300005236|Ga0066636_10248878 | Not Available | 771 | Open in IMG/M |
3300005236|Ga0066636_10271214 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 726 | Open in IMG/M |
3300005236|Ga0066636_10291536 | Not Available | 690 | Open in IMG/M |
3300005236|Ga0066636_10304842 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005236|Ga0066636_10379202 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 572 | Open in IMG/M |
3300007964|Ga0100400_1039760 | All Organisms → cellular organisms → Bacteria | 2201 | Open in IMG/M |
3300007964|Ga0100400_1057614 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300007964|Ga0100400_1068329 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1529 | Open in IMG/M |
3300007964|Ga0100400_1081627 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
3300007964|Ga0100400_1082942 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
3300007964|Ga0100400_1088563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1283 | Open in IMG/M |
3300007964|Ga0100400_1177008 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 793 | Open in IMG/M |
3300007964|Ga0100400_1195093 | Not Available | 740 | Open in IMG/M |
3300007964|Ga0100400_1203336 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300007964|Ga0100400_1236371 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 646 | Open in IMG/M |
3300007964|Ga0100400_1254766 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300007964|Ga0100400_1266564 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 593 | Open in IMG/M |
3300007964|Ga0100400_1277200 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300007964|Ga0100400_1322857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Ozemobacteria → Candidatus Ozemobacterales → Candidatus Ozemobacteraceae → Candidatus Ozemobacter → Candidatus Ozemobacter sibiricus | 519 | Open in IMG/M |
3300007965|Ga0100401_1073039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1727 | Open in IMG/M |
3300007965|Ga0100401_1080829 | Not Available | 1611 | Open in IMG/M |
3300007965|Ga0100401_1134160 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1123 | Open in IMG/M |
3300007965|Ga0100401_1186561 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 881 | Open in IMG/M |
3300007965|Ga0100401_1195249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 852 | Open in IMG/M |
3300007965|Ga0100401_1221506 | Not Available | 774 | Open in IMG/M |
3300007965|Ga0100401_1333690 | Not Available | 570 | Open in IMG/M |
3300007965|Ga0100401_1358024 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300007985|Ga0100381_1341576 | Not Available | 671 | Open in IMG/M |
3300007985|Ga0100381_1463620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
3300007985|Ga0100381_1467492 | Not Available | 536 | Open in IMG/M |
3300007986|Ga0100380_10344291 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 712 | Open in IMG/M |
3300007986|Ga0100380_10372181 | Not Available | 674 | Open in IMG/M |
3300007986|Ga0100380_10373586 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 672 | Open in IMG/M |
3300007986|Ga0100380_10529113 | Not Available | 527 | Open in IMG/M |
3300007986|Ga0100380_10530981 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300007987|Ga0100379_10269138 | Not Available | 862 | Open in IMG/M |
3300007987|Ga0100379_10299274 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 798 | Open in IMG/M |
3300007987|Ga0100379_10454986 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300007988|Ga0100402_1458875 | Not Available | 533 | Open in IMG/M |
3300008001|Ga0100389_1022776 | All Organisms → cellular organisms → Bacteria | 4133 | Open in IMG/M |
3300008001|Ga0100389_1115037 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
3300008001|Ga0100389_1139029 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300008001|Ga0100389_1183848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 998 | Open in IMG/M |
3300008001|Ga0100389_1201759 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300008001|Ga0100389_1210307 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300008001|Ga0100389_1237707 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300008001|Ga0100389_1269543 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300008001|Ga0100389_1300672 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 709 | Open in IMG/M |
3300008001|Ga0100389_1342267 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 648 | Open in IMG/M |
3300008001|Ga0100389_1370987 | Not Available | 614 | Open in IMG/M |
3300008001|Ga0100389_1426667 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 560 | Open in IMG/M |
3300008001|Ga0100389_1467603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 526 | Open in IMG/M |
3300008001|Ga0100389_1504261 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 500 | Open in IMG/M |
3300008002|Ga0100390_10059534 | All Organisms → cellular organisms → Bacteria | 2504 | Open in IMG/M |
3300008002|Ga0100390_10079518 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 2052 | Open in IMG/M |
3300008002|Ga0100390_10167510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1213 | Open in IMG/M |
3300008002|Ga0100390_10277973 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300008002|Ga0100390_10361020 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 690 | Open in IMG/M |
3300008002|Ga0100390_10373747 | Not Available | 673 | Open in IMG/M |
3300008002|Ga0100390_10522330 | Not Available | 529 | Open in IMG/M |
3300008003|Ga0100391_1094036 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300008003|Ga0100391_1101690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1651 | Open in IMG/M |
3300008003|Ga0100391_1122206 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1454 | Open in IMG/M |
3300008003|Ga0100391_1162130 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300008003|Ga0100391_1187009 | Not Available | 1074 | Open in IMG/M |
3300008003|Ga0100391_1198803 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1029 | Open in IMG/M |
3300008003|Ga0100391_1210820 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300008003|Ga0100391_1233072 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300008003|Ga0100391_1247076 | Not Available | 879 | Open in IMG/M |
3300008003|Ga0100391_1266924 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300008003|Ga0100391_1278290 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 806 | Open in IMG/M |
3300008003|Ga0100391_1281198 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300008003|Ga0100391_1343866 | Not Available | 693 | Open in IMG/M |
3300008003|Ga0100391_1401635 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300008003|Ga0100391_1471630 | Not Available | 555 | Open in IMG/M |
3300008003|Ga0100391_1477215 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300008004|Ga0100395_1064191 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300008004|Ga0100395_1155857 | Not Available | 1032 | Open in IMG/M |
3300008004|Ga0100395_1198411 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300008004|Ga0100395_1268183 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 707 | Open in IMG/M |
3300008004|Ga0100395_1292776 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300008004|Ga0100395_1339698 | Not Available | 601 | Open in IMG/M |
3300008004|Ga0100395_1401251 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 537 | Open in IMG/M |
3300008005|Ga0100385_1219842 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 934 | Open in IMG/M |
3300008005|Ga0100385_1523992 | Not Available | 504 | Open in IMG/M |
3300008007|Ga0100386_10228314 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 962 | Open in IMG/M |
3300008007|Ga0100386_10282236 | Not Available | 825 | Open in IMG/M |
3300008007|Ga0100386_10293369 | Not Available | 802 | Open in IMG/M |
3300008007|Ga0100386_10426072 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 612 | Open in IMG/M |
3300008007|Ga0100386_10543474 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 517 | Open in IMG/M |
3300008008|Ga0100399_1031055 | All Organisms → cellular organisms → Bacteria | 2861 | Open in IMG/M |
3300008008|Ga0100399_1044842 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
3300008008|Ga0100399_1061482 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1810 | Open in IMG/M |
3300008008|Ga0100399_1068589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → Thiocapsa marina | 1680 | Open in IMG/M |
3300008008|Ga0100399_1071996 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
3300008008|Ga0100399_1085535 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1446 | Open in IMG/M |
3300008008|Ga0100399_1092258 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300008008|Ga0100399_1151920 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 959 | Open in IMG/M |
3300008008|Ga0100399_1203533 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300008008|Ga0100399_1269090 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300008008|Ga0100399_1319749 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 553 | Open in IMG/M |
3300008009|Ga0100394_1089443 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
3300008009|Ga0100394_1128135 | Not Available | 1335 | Open in IMG/M |
3300008009|Ga0100394_1139682 | Not Available | 1254 | Open in IMG/M |
3300008009|Ga0100394_1386242 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 598 | Open in IMG/M |
3300008009|Ga0100394_1497784 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300008010|Ga0100397_1011304 | All Organisms → cellular organisms → Bacteria | 4690 | Open in IMG/M |
3300008010|Ga0100397_1014165 | All Organisms → cellular organisms → Bacteria | 4116 | Open in IMG/M |
3300008010|Ga0100397_1017118 | All Organisms → cellular organisms → Bacteria | 3696 | Open in IMG/M |
3300008010|Ga0100397_1024921 | All Organisms → cellular organisms → Bacteria | 2948 | Open in IMG/M |
3300008010|Ga0100397_1030303 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
3300008010|Ga0100397_1042108 | All Organisms → cellular organisms → Bacteria | 2116 | Open in IMG/M |
3300008010|Ga0100397_1063224 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 1614 | Open in IMG/M |
3300008010|Ga0100397_1094799 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300008010|Ga0100397_1095906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Ozemobacteria → Candidatus Ozemobacterales → Candidatus Ozemobacteraceae → Candidatus Ozemobacter → Candidatus Ozemobacter sibiricus | 1202 | Open in IMG/M |
3300008010|Ga0100397_1098519 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1179 | Open in IMG/M |
3300008010|Ga0100397_1098827 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1177 | Open in IMG/M |
3300008010|Ga0100397_1121869 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
3300008010|Ga0100397_1167360 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300008010|Ga0100397_1191929 | Not Available | 716 | Open in IMG/M |
3300008011|Ga0100396_1024171 | All Organisms → cellular organisms → Bacteria | 3323 | Open in IMG/M |
3300008011|Ga0100396_1026076 | All Organisms → cellular organisms → Bacteria | 3163 | Open in IMG/M |
3300008011|Ga0100396_1070015 | Not Available | 1621 | Open in IMG/M |
3300008011|Ga0100396_1193329 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 785 | Open in IMG/M |
3300008011|Ga0100396_1205118 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 753 | Open in IMG/M |
3300008011|Ga0100396_1206300 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 750 | Open in IMG/M |
3300008011|Ga0100396_1345071 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300008020|Ga0100398_1016068 | All Organisms → cellular organisms → Bacteria | 5644 | Open in IMG/M |
3300008020|Ga0100398_1021980 | All Organisms → cellular organisms → Bacteria | 4681 | Open in IMG/M |
3300008020|Ga0100398_1023727 | All Organisms → cellular organisms → Bacteria | 4462 | Open in IMG/M |
3300008020|Ga0100398_1030133 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 3826 | Open in IMG/M |
3300008020|Ga0100398_1034575 | All Organisms → cellular organisms → Bacteria | 3502 | Open in IMG/M |
3300008020|Ga0100398_1086794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 1807 | Open in IMG/M |
3300008020|Ga0100398_1099785 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
3300008020|Ga0100398_1131849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1308 | Open in IMG/M |
3300008020|Ga0100398_1155989 | Not Available | 1145 | Open in IMG/M |
3300008020|Ga0100398_1168052 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300008020|Ga0100398_1177481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1035 | Open in IMG/M |
3300008020|Ga0100398_1307326 | Not Available | 671 | Open in IMG/M |
3300008020|Ga0100398_1389295 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300008085|Ga0100378_1508776 | Not Available | 514 | Open in IMG/M |
3300008086|Ga0100388_10020587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4666 | Open in IMG/M |
3300008086|Ga0100388_10118144 | Not Available | 1483 | Open in IMG/M |
3300008086|Ga0100388_10136816 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
3300008086|Ga0100388_10313373 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300008086|Ga0100388_10492530 | Not Available | 563 | Open in IMG/M |
3300008093|Ga0100393_10119258 | All Organisms → cellular organisms → Bacteria | 1543 | Open in IMG/M |
3300008093|Ga0100393_10451993 | Not Available | 584 | Open in IMG/M |
3300008094|Ga0100387_10033724 | All Organisms → cellular organisms → Bacteria | 3449 | Open in IMG/M |
3300008094|Ga0100387_10271757 | Not Available | 843 | Open in IMG/M |
3300008094|Ga0100387_10337636 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300008094|Ga0100387_10407578 | Not Available | 634 | Open in IMG/M |
3300008094|Ga0100387_10421610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium CG07_land_8_20_14_0_80_52_14 | 619 | Open in IMG/M |
3300008094|Ga0100387_10553836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 514 | Open in IMG/M |
3300008095|Ga0100392_1142121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
3300008095|Ga0100392_1259308 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300008095|Ga0100392_1280997 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 790 | Open in IMG/M |
3300008095|Ga0100392_1317908 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300009004|Ga0100377_1021814 | All Organisms → cellular organisms → Bacteria | 3844 | Open in IMG/M |
3300009004|Ga0100377_1043665 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
3300009004|Ga0100377_1048393 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
3300009004|Ga0100377_1048429 | All Organisms → cellular organisms → Bacteria | 2172 | Open in IMG/M |
3300009004|Ga0100377_1049215 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
3300009004|Ga0100377_1054759 | All Organisms → cellular organisms → Bacteria | 1986 | Open in IMG/M |
3300009004|Ga0100377_1075329 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
3300009004|Ga0100377_1082631 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Ozemobacteria → Candidatus Ozemobacterales → Candidatus Ozemobacteraceae → Candidatus Ozemobacter → Candidatus Ozemobacter sibiricus | 1474 | Open in IMG/M |
3300009004|Ga0100377_1087098 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1420 | Open in IMG/M |
3300009004|Ga0100377_1094723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1337 | Open in IMG/M |
3300009004|Ga0100377_1106686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea | 1227 | Open in IMG/M |
3300009004|Ga0100377_1110673 | Not Available | 1195 | Open in IMG/M |
3300009004|Ga0100377_1301580 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 591 | Open in IMG/M |
3300014060|Ga0119967_10044103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Ozemobacteria → Candidatus Ozemobacterales → Candidatus Ozemobacteraceae → Candidatus Ozemobacter → Candidatus Ozemobacter sibiricus | 3134 | Open in IMG/M |
3300014060|Ga0119967_10090408 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Ozemobacteria → Candidatus Ozemobacterales → Candidatus Ozemobacteraceae → Candidatus Ozemobacter → Candidatus Ozemobacter sibiricus | 1771 | Open in IMG/M |
3300014060|Ga0119967_10159594 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1119 | Open in IMG/M |
3300025008|Ga0210029_1021255 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
3300025008|Ga0210029_1030325 | Not Available | 1786 | Open in IMG/M |
3300025008|Ga0210029_1043009 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1412 | Open in IMG/M |
3300025008|Ga0210029_1045751 | Not Available | 1355 | Open in IMG/M |
3300025008|Ga0210029_1062349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 1096 | Open in IMG/M |
3300025008|Ga0210029_1077969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 936 | Open in IMG/M |
3300025008|Ga0210029_1082837 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300025008|Ga0210029_1091409 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300025008|Ga0210029_1111456 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300025008|Ga0210029_1114017 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300025008|Ga0210029_1154897 | Not Available | 560 | Open in IMG/M |
3300025008|Ga0210029_1161044 | Not Available | 543 | Open in IMG/M |
3300025008|Ga0210029_1170269 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Ozemobacteria → Candidatus Ozemobacterales → Candidatus Ozemobacteraceae → Candidatus Ozemobacter → Candidatus Ozemobacter sibiricus | 519 | Open in IMG/M |
3300025014|Ga0210023_1091154 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300025017|Ga0210022_1123000 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 726 | Open in IMG/M |
3300025017|Ga0210022_1139554 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300025020|Ga0210030_1019952 | All Organisms → cellular organisms → Bacteria | 3079 | Open in IMG/M |
3300025020|Ga0210030_1033415 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
3300025020|Ga0210030_1073551 | Not Available | 1103 | Open in IMG/M |
3300025020|Ga0210030_1086350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 974 | Open in IMG/M |
3300025020|Ga0210030_1089504 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 948 | Open in IMG/M |
3300025020|Ga0210030_1162832 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 600 | Open in IMG/M |
3300025022|Ga0210056_1036650 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 2440 | Open in IMG/M |
3300025022|Ga0210056_1038135 | All Organisms → cellular organisms → Bacteria | 2369 | Open in IMG/M |
3300025022|Ga0210056_1059107 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 1716 | Open in IMG/M |
3300025022|Ga0210056_1067056 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300025022|Ga0210056_1074681 | Not Available | 1441 | Open in IMG/M |
3300025022|Ga0210056_1076808 | Not Available | 1411 | Open in IMG/M |
3300025022|Ga0210056_1077485 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin157 | 1402 | Open in IMG/M |
3300025022|Ga0210056_1093245 | Not Available | 1219 | Open in IMG/M |
3300025022|Ga0210056_1102482 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300025022|Ga0210056_1104885 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
3300025022|Ga0210056_1188237 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 718 | Open in IMG/M |
3300025022|Ga0210056_1201481 | Not Available | 682 | Open in IMG/M |
3300025022|Ga0210056_1233691 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 610 | Open in IMG/M |
3300025031|Ga0210024_1186013 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 580 | Open in IMG/M |
3300025032|Ga0210042_1115312 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300025032|Ga0210042_1163456 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300025032|Ga0210042_1250652 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 550 | Open in IMG/M |
3300025032|Ga0210042_1253147 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300025036|Ga0210049_1036769 | All Organisms → cellular organisms → Bacteria | 3059 | Open in IMG/M |
3300025036|Ga0210049_1054471 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 2302 | Open in IMG/M |
3300025036|Ga0210049_1055408 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 2274 | Open in IMG/M |
3300025036|Ga0210049_1068700 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
3300025036|Ga0210049_1073964 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
3300025036|Ga0210049_1078263 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
3300025036|Ga0210049_1079376 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
3300025036|Ga0210049_1079502 | All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Desulfurobacteriales → Desulfurobacteriaceae | 1741 | Open in IMG/M |
3300025036|Ga0210049_1088187 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
3300025036|Ga0210049_1108910 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1368 | Open in IMG/M |
3300025036|Ga0210049_1224498 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300025036|Ga0210049_1226386 | Not Available | 765 | Open in IMG/M |
3300025036|Ga0210049_1284981 | Not Available | 638 | Open in IMG/M |
3300025036|Ga0210049_1313117 | Not Available | 593 | Open in IMG/M |
3300025139|Ga0210021_1181919 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300025288|Ga0210044_10051061 | All Organisms → cellular organisms → Bacteria | 3340 | Open in IMG/M |
3300025288|Ga0210044_10084794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Riflebacteria → unclassified Candidatus Riflebacteria → Candidatus Riflebacteria bacterium | 2252 | Open in IMG/M |
3300025288|Ga0210044_10250091 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300025288|Ga0210044_10270142 | Not Available | 928 | Open in IMG/M |
3300025288|Ga0210044_10291244 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300025288|Ga0210044_10426864 | Not Available | 661 | Open in IMG/M |
3300025288|Ga0210044_10475962 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 611 | Open in IMG/M |
3300025288|Ga0210044_10494357 | Not Available | 594 | Open in IMG/M |
3300025288|Ga0210044_10496640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 592 | Open in IMG/M |
3300025288|Ga0210044_10618547 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 503 | Open in IMG/M |
3300025825|Ga0210046_1024024 | All Organisms → cellular organisms → Bacteria | 2750 | Open in IMG/M |
3300025826|Ga0210033_1064041 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300025826|Ga0210033_1064278 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1336 | Open in IMG/M |
3300025826|Ga0210033_1146043 | Not Available | 700 | Open in IMG/M |
3300025826|Ga0210033_1164675 | Not Available | 638 | Open in IMG/M |
3300025826|Ga0210033_1208732 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 532 | Open in IMG/M |
3300025827|Ga0210031_1177627 | Not Available | 584 | Open in IMG/M |
3300025831|Ga0210015_1059620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1786 | Open in IMG/M |
3300025831|Ga0210015_1066400 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1649 | Open in IMG/M |
3300025831|Ga0210015_1078699 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 1452 | Open in IMG/M |
3300025831|Ga0210015_1079238 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300025831|Ga0210015_1124828 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300025831|Ga0210015_1135113 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria | 943 | Open in IMG/M |
3300025831|Ga0210015_1151251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 858 | Open in IMG/M |
3300025831|Ga0210015_1178467 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 746 | Open in IMG/M |
3300025831|Ga0210015_1218422 | Not Available | 627 | Open in IMG/M |
3300025835|Ga0210039_1277469 | Not Available | 615 | Open in IMG/M |
3300025837|Ga0210016_1055392 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
3300025837|Ga0210016_1073649 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Ozemobacteria → Candidatus Ozemobacterales → Candidatus Ozemobacteraceae → Candidatus Ozemobacter → Candidatus Ozemobacter sibiricus | 1672 | Open in IMG/M |
3300025837|Ga0210016_1103523 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300025837|Ga0210016_1150500 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 969 | Open in IMG/M |
3300025837|Ga0210016_1340663 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 522 | Open in IMG/M |
3300025841|Ga0210028_1049918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1822 | Open in IMG/M |
3300025841|Ga0210028_1199928 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium CG2_30_54_10 | 639 | Open in IMG/M |
3300025841|Ga0210028_1209356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 617 | Open in IMG/M |
3300025842|Ga0210054_1204210 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300025842|Ga0210054_1229200 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300025842|Ga0210054_1239503 | Not Available | 618 | Open in IMG/M |
3300025844|Ga0210036_1229710 | Not Available | 622 | Open in IMG/M |
3300025850|Ga0210050_1041116 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
3300025868|Ga0210051_1041284 | All Organisms → cellular organisms → Bacteria | 3219 | Open in IMG/M |
3300025868|Ga0210051_1057232 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
3300025868|Ga0210051_1089325 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
3300025868|Ga0210051_1114131 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1447 | Open in IMG/M |
3300025868|Ga0210051_1114422 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300025868|Ga0210051_1141301 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1212 | Open in IMG/M |
3300025868|Ga0210051_1163037 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300025868|Ga0210051_1301751 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300025868|Ga0210051_1344825 | Not Available | 584 | Open in IMG/M |
3300025868|Ga0210051_1352875 | Not Available | 573 | Open in IMG/M |
3300025868|Ga0210051_1365835 | Not Available | 557 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 69.13% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 29.90% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003830 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter | Environmental | Open in IMG/M |
3300004088 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/10/14 0.8 um filter | Environmental | Open in IMG/M |
3300004107 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/8/14 3 um filter (version 2) | Environmental | Open in IMG/M |
3300004209 | Groundwater microbial communities from aquifer - Crystal Geyser CG22_combo_CG10-13_8/21/14_all | Environmental | Open in IMG/M |
3300004212 | Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00 | Environmental | Open in IMG/M |
3300005236 | Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 | Environmental | Open in IMG/M |
3300007964 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-24 | Environmental | Open in IMG/M |
3300007965 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-25 | Environmental | Open in IMG/M |
3300007985 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-05 | Environmental | Open in IMG/M |
3300007986 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-04 | Environmental | Open in IMG/M |
3300007987 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-03 | Environmental | Open in IMG/M |
3300007988 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-0102 | Environmental | Open in IMG/M |
3300008001 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13 | Environmental | Open in IMG/M |
3300008002 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-14 | Environmental | Open in IMG/M |
3300008003 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-15 | Environmental | Open in IMG/M |
3300008004 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-19 | Environmental | Open in IMG/M |
3300008005 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-09 | Environmental | Open in IMG/M |
3300008007 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-10 | Environmental | Open in IMG/M |
3300008008 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-23 | Environmental | Open in IMG/M |
3300008009 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-18 | Environmental | Open in IMG/M |
3300008010 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-21 | Environmental | Open in IMG/M |
3300008011 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 | Environmental | Open in IMG/M |
3300008020 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-22 | Environmental | Open in IMG/M |
3300008085 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-02 | Environmental | Open in IMG/M |
3300008086 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-12 | Environmental | Open in IMG/M |
3300008093 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-17 | Environmental | Open in IMG/M |
3300008094 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-11 | Environmental | Open in IMG/M |
3300008095 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-16 | Environmental | Open in IMG/M |
3300009004 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-01 | Environmental | Open in IMG/M |
3300014060 | Freshwater microbial communities from Crystal Geyser, Utah, USA - CG_3.0 | Environmental | Open in IMG/M |
3300025008 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-21 (SPAdes) | Environmental | Open in IMG/M |
3300025014 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-24 (SPAdes) | Environmental | Open in IMG/M |
3300025017 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 (SPAdes) | Environmental | Open in IMG/M |
3300025020 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-23 (SPAdes) | Environmental | Open in IMG/M |
3300025022 | Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 (SPAdes) | Environmental | Open in IMG/M |
3300025031 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-25 (SPAdes) | Environmental | Open in IMG/M |
3300025032 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-18 (SPAdes) | Environmental | Open in IMG/M |
3300025036 | Groundwater microbial communities from aquifer - Crystal Geyser CG06_land_8/20/14_3.00 (SPAdes) | Environmental | Open in IMG/M |
3300025139 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-17 (SPAdes) | Environmental | Open in IMG/M |
3300025288 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter (SPAdes) | Environmental | Open in IMG/M |
3300025825 | Groundwater microbial communities from aquifer - Crystal Geyser CG18_big_fil_WC_8/21/14_2.50 (SPAdes) | Environmental | Open in IMG/M |
3300025826 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-01 (SPAdes) | Environmental | Open in IMG/M |
3300025827 | Groundwater microbial communities from aquifer - Crystal Geyser CG03_land_8/20/14_0.80 (SPAdes) | Environmental | Open in IMG/M |
3300025831 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-22 (SPAdes) | Environmental | Open in IMG/M |
3300025835 | Groundwater microbial communities from aquifer - Crystal Geyser CG17_big_fil_post_rev_8/21/14_2.50 (SPAdes) | Environmental | Open in IMG/M |
3300025837 | Groundwater microbial communities from aquifer - Crystal Geyser CG02_land_8/20/14_3.00 (SPAdes) | Environmental | Open in IMG/M |
3300025841 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13 (SPAdes) | Environmental | Open in IMG/M |
3300025842 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-16 (SPAdes) | Environmental | Open in IMG/M |
3300025844 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-15 (SPAdes) | Environmental | Open in IMG/M |
3300025850 | Groundwater microbial communities from aquifer - Crystal Geyser CG22_combo_CG10-13_8/21/14_all (SPAdes) | Environmental | Open in IMG/M |
3300025868 | Groundwater microbial communities from aquifer - Crystal Geyser CG23_combo_of_CG06-09_8/20/14_all (SPAdes) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0051980_102581461 | 3300003830 | Groundwater | MSAKFLGSASISGRGILPRRSGWKPLPLFHWIPTEHFKAG |
Ga0051980_102699322 | 3300003830 | Groundwater | MSAKFLGLAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0051980_102760181 | 3300003830 | Groundwater | MSAKFLGSASNSGRGILARRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0051980_102950141 | 3300003830 | Groundwater | MSAKFLGSAPNSGRGILPRGSGWKPLPLFRWIPTEHFKAGIET* |
Ga0051980_104301322 | 3300003830 | Groundwater | MSAKFLGSTPNSGRGILPRRSGWNPLPLFRWIPTEHFKAGIET* |
Ga0051980_104339022 | 3300003830 | Groundwater | MSAKFLDSASNSGRGILPRRSGWKPLPLFHRIPTEHFKAGVET* |
Ga0051987_103148422 | 3300004088 | Groundwater | MSAKFLGSALNSGRGKMPRRSGFQPLPLFRWIPTEHFNAGIET |
Ga0065179_11498982 | 3300004107 | Groundwater | FLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0066649_103847812 | 3300004209 | Groundwater | MSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0066631_101644401 | 3300004212 | Groundwater | MSAEILGLAPNSGCGILPRRSGWKPLPLFRWIPTEHFKAG |
Ga0066636_100039901 | 3300005236 | Groundwater | MSAKFLGLAPNSGRGKMMRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0066636_100060371 | 3300005236 | Groundwater | MSAKFLGSVSNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIKHEFSEV |
Ga0066636_100072027 | 3300005236 | Groundwater | MFAKFLGSAPKSGRGILPRCSGWKSLPFFRWIPTEHFKAGIET* |
Ga0066636_100101763 | 3300005236 | Groundwater | MSAKFLGSASNSGRGILPRRIGWKPLPLFRWIPTEHFKAGIET* |
Ga0066636_100143714 | 3300005236 | Groundwater | MSAKFLGSATNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0066636_100147464 | 3300005236 | Groundwater | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEYFKAGIET* |
Ga0066636_100233031 | 3300005236 | Groundwater | SAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0066636_100239155 | 3300005236 | Groundwater | MSAKFLGSGSNSGRGKMPRRSGWKPLPLFRWIPTEHFNAGIET* |
Ga0066636_100256882 | 3300005236 | Groundwater | MSAKFLGLATNSGRGVLPRRSGWKPLRRFRWIPTEHFKAGIET* |
Ga0066636_100264024 | 3300005236 | Groundwater | MSAKFLGLAPNGGRGTLPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0066636_100304532 | 3300005236 | Groundwater | MFAKFLGSAPNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET* |
Ga0066636_100364243 | 3300005236 | Groundwater | MSAKFLGSASISGRGILPRRSGWKPLPLFHWIPTEHFKAGIET* |
Ga0066636_100364463 | 3300005236 | Groundwater | MSAKFLGSASNSGRGILPRRSGWKPLPLSRWIPTEHFKAGIET* |
Ga0066636_100423653 | 3300005236 | Groundwater | MSAKFLGSAPNSGRGILPRRSGWKPPPLFRWIPTEHFKAGIEK* |
Ga0066636_100517322 | 3300005236 | Groundwater | MSAKFLGSAPNSGRGILPRRSGRKPLPLFRWIPTEHFKAGIEA* |
Ga0066636_100595061 | 3300005236 | Groundwater | KFLGLAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0066636_100671743 | 3300005236 | Groundwater | MSAKFLGSASNSGRGILPRRSDWKPLPLFRWIPTEHFKAGIET* |
Ga0066636_100806271 | 3300005236 | Groundwater | MSAKFIGSALNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0066636_101018172 | 3300005236 | Groundwater | MSAKFLGSAPNSGRGILPRRSGWQPLPLFRWIPTEHFKAGIEK* |
Ga0066636_101207872 | 3300005236 | Groundwater | MSAKFLGSASNSGRGILPRRSGWKPQTLFHWIPTEHFKAGIET* |
Ga0066636_101727931 | 3300005236 | Groundwater | TMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKASIET* |
Ga0066636_102488781 | 3300005236 | Groundwater | TMSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKASIET* |
Ga0066636_102712142 | 3300005236 | Groundwater | MSAKFLGSALNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0066636_102915361 | 3300005236 | Groundwater | MPAKFLGSAPNSGRGILPRRRGWKPLPLFRRIPTEHFKAGIET* |
Ga0066636_103048421 | 3300005236 | Groundwater | MSVKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIE |
Ga0066636_103792022 | 3300005236 | Groundwater | MITDINSEEQPRLTMSAKFLGSAPNSGRGILPRRSGWKPLPLFRSIPTERFKAGIET* |
Ga0100400_10397603 | 3300007964 | Aquifer | MSAKFLGSALNSGRGKMPRRSGWKPLPLFRWIPTEHFNAGIET* |
Ga0100400_10576142 | 3300007964 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFLWIPTEHFKSGIET* |
Ga0100400_10683292 | 3300007964 | Aquifer | SNSGRGILPRRSGWKPLPLFHWIPTEHFKASIET* |
Ga0100400_10816271 | 3300007964 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFK |
Ga0100400_10829423 | 3300007964 | Aquifer | PNSGRGILPRRSSWKPLPLFRWIPTEHFKASIET* |
Ga0100400_10885631 | 3300007964 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLCHWIPTEHFKVGIET* |
Ga0100400_11770081 | 3300007964 | Aquifer | TGHKGPSRLTMSAKFLGSATNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100400_11950932 | 3300007964 | Aquifer | MSAKFLGLAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0100400_12033362 | 3300007964 | Aquifer | TMSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100400_12363712 | 3300007964 | Aquifer | MFAKFLGSAPNSGRGILPRRSGWKPLPLFRWMLTEHFKAGIET* |
Ga0100400_12547662 | 3300007964 | Aquifer | MSAKFLGSASNSGRGILPRRSGWEPLPLFRWIPTEHFKAGIET* |
Ga0100400_12665642 | 3300007964 | Aquifer | MFAKFLGSARNSGRGILPRRSGWKPLPLFRWIPTELFKAGIET* |
Ga0100400_12772001 | 3300007964 | Aquifer | MFAKFLGSAPISGRGILPRRSGWKLLPLFRWIPTEHFKAGIKR* |
Ga0100400_13228572 | 3300007964 | Aquifer | APNCGRGILPRRSGWKPLPLFRWIPTEHFKAGIEK* |
Ga0100401_10730391 | 3300007965 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100401_10808291 | 3300007965 | Aquifer | KFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100401_11341601 | 3300007965 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKAG |
Ga0100401_11865611 | 3300007965 | Aquifer | LTMSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKGGIET* |
Ga0100401_11952491 | 3300007965 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAI* |
Ga0100401_12215061 | 3300007965 | Aquifer | TMSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKAGFET* |
Ga0100401_13336901 | 3300007965 | Aquifer | GSASNSGRGILPRRSGWKPLPLFHWIPTEHFKASIET* |
Ga0100401_13580241 | 3300007965 | Aquifer | LTMSAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIEK* |
Ga0100381_13415761 | 3300007985 | Aquifer | PRLTMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100381_14636202 | 3300007985 | Aquifer | LTMSAKFLGSASNSGRGILPRRSGWKPLSLFHWIPTEHFKAGFET* |
Ga0100381_14674921 | 3300007985 | Aquifer | MSAKFIGSALNSGRGILPRRSGWKPLPLFRWIPTEHF |
Ga0100380_103442912 | 3300007986 | Aquifer | TMSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100380_103721812 | 3300007986 | Aquifer | MFAKFLGSVPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100380_103735861 | 3300007986 | Aquifer | AKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKVGIET* |
Ga0100380_105291131 | 3300007986 | Aquifer | MSAKFLGSVSNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIET* |
Ga0100380_105309812 | 3300007986 | Aquifer | RLTMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100379_102691382 | 3300007987 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIEA* |
Ga0100379_102992741 | 3300007987 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIET* |
Ga0100379_104549861 | 3300007987 | Aquifer | FLGSASNSGPGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100402_14588751 | 3300007988 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100389_10227761 | 3300008001 | Aquifer | RLTMSAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIEK* |
Ga0100389_11150372 | 3300008001 | Aquifer | LGSATNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET* |
Ga0100389_11390291 | 3300008001 | Aquifer | GSASNSGRGILPRRGGWKPLPLFHWIPTEHFKAGFET* |
Ga0100389_11838482 | 3300008001 | Aquifer | SAKFLGSAPNSGRGILPRRSGWQPLPLFRWIPTEHFKAGIEK* |
Ga0100389_12017592 | 3300008001 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHF |
Ga0100389_12103071 | 3300008001 | Aquifer | MSAKFLGSVSNSGRGILPRRSGWEPLPLFRWIPTEHFKAGIET* |
Ga0100389_12377073 | 3300008001 | Aquifer | RFSPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100389_12695432 | 3300008001 | Aquifer | SASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100389_13006721 | 3300008001 | Aquifer | MSAKFLGSAPNCGRGILPRRSGWKPLPLFRWIPTEHFKAGIEK* |
Ga0100389_13422671 | 3300008001 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHF |
Ga0100389_13709872 | 3300008001 | Aquifer | LTMSAKFLGSASNSGRGILPRRSGWKPLPLCHWIPTEHFKVGIET* |
Ga0100389_14266672 | 3300008001 | Aquifer | GSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100389_14676032 | 3300008001 | Aquifer | MSAKFLGSALNSGRGILPRRSGWKPPLPLFRWIPTEHFKAAIET* |
Ga0100389_15042611 | 3300008001 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAGTETLI* |
Ga0100390_100595341 | 3300008002 | Aquifer | MSAKFLGLAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGI |
Ga0100390_100795182 | 3300008002 | Aquifer | MRMPAARLTMSAKFLGWGSNSGHGILPRRIGWKPLPLFRWIPTEHFKAGIET* |
Ga0100390_101675101 | 3300008002 | Aquifer | QSPASRLTMSAKFLGSAPNSGRGILPRRSGWQPLPLFRWIPTEHFKAGIEK* |
Ga0100390_102779732 | 3300008002 | Aquifer | MSAKFIGSALNSGRGVLPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100390_103610201 | 3300008002 | Aquifer | NSFQQGKFPSRLTMSAKFLGSGSNSGRGKMPRRSGFQPLPLFRWIPTEHFKTGIET* |
Ga0100390_103737472 | 3300008002 | Aquifer | APNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100390_105223301 | 3300008002 | Aquifer | TMSAKFLGGARNIKKGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100391_10940363 | 3300008003 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHF |
Ga0100391_11016901 | 3300008003 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPAPLFRWIPTEHFKAGIET* |
Ga0100391_11222062 | 3300008003 | Aquifer | GSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAAVET* |
Ga0100391_11621301 | 3300008003 | Aquifer | MSAKFLGLAPNSGRGILPRRSGWKPLPLFRWIPTEHFKA |
Ga0100391_11870093 | 3300008003 | Aquifer | LTMSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEYFKAGIET* |
Ga0100391_11988031 | 3300008003 | Aquifer | FSPNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100391_12108202 | 3300008003 | Aquifer | SPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100391_12330721 | 3300008003 | Aquifer | LTMSAKFLGLAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIETWI* |
Ga0100391_12470761 | 3300008003 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKVG |
Ga0100391_12669241 | 3300008003 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFRWLPTEHFKAGIET* |
Ga0100391_12782902 | 3300008003 | Aquifer | SSTGHKGPSRLTMSAKFLGSATNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100391_12811982 | 3300008003 | Aquifer | MSAKFIGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIE |
Ga0100391_13438661 | 3300008003 | Aquifer | KFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKASIET* |
Ga0100391_14016351 | 3300008003 | Aquifer | MFAKFLGSAPISGRGILPRRSGWKPLPLFRWIPTEHFKA |
Ga0100391_14716302 | 3300008003 | Aquifer | MFAKFLGSAPNSGRGILARRSGWKPLPLFRWILTERFKAGIET* |
Ga0100391_14772151 | 3300008003 | Aquifer | SNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIET* |
Ga0100395_10641913 | 3300008004 | Aquifer | ARLTMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100395_11558571 | 3300008004 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEH |
Ga0100395_11984111 | 3300008004 | Aquifer | MSAKFIGSALNSGRGILPRRSGWKPLPLFRWIPTEHFKAGI |
Ga0100395_12681832 | 3300008004 | Aquifer | APNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIEK* |
Ga0100395_12927762 | 3300008004 | Aquifer | PNSGRGILPRRSSWKPLPLFRWIPTEHFKAGIET* |
Ga0100395_13396982 | 3300008004 | Aquifer | HNRTRLTMSAKFLGSASNSGRGILPRRGGWKPLPLFHWIPTEHFKAGIET* |
Ga0100395_14012512 | 3300008004 | Aquifer | FFARLTMSAKFLGSALNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100385_12198421 | 3300008005 | Aquifer | KLYFWGECPKSGGGFQPPRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100385_15239921 | 3300008005 | Aquifer | RLTMSAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTVHFKAGIET* |
Ga0100386_102283141 | 3300008007 | Aquifer | RLTMSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100386_102822362 | 3300008007 | Aquifer | SAKFLGSASNSGRGILPRRSGWKPLPLFRWLPTEHFKAGIET* |
Ga0100386_102933691 | 3300008007 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFK |
Ga0100386_104260721 | 3300008007 | Aquifer | ASNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIEA* |
Ga0100386_105434743 | 3300008007 | Aquifer | LTMSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKVGIET* |
Ga0100399_10310551 | 3300008008 | Aquifer | PLFDSYATRLTMSAKFLGSASNIERGILPRRSGWKPLPLFHWIPTEHFKAGIET* |
Ga0100399_10448421 | 3300008008 | Aquifer | ASNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100399_10614821 | 3300008008 | Aquifer | LTMSAKFIGSALNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100399_10685891 | 3300008008 | Aquifer | KFLGSAPISGRGILPRRSGWKLLPLFRWIPTEHFKAGIKR* |
Ga0100399_10719962 | 3300008008 | Aquifer | SRLTMSAKFLGSATNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET* |
Ga0100399_10855351 | 3300008008 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKASIET* |
Ga0100399_10922583 | 3300008008 | Aquifer | LGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100399_11519202 | 3300008008 | Aquifer | MSAKFIGSALNSGRGILPRRSGWKPLPLFRWIPTEHFK |
Ga0100399_12035332 | 3300008008 | Aquifer | SRFSPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100399_12690902 | 3300008008 | Aquifer | AKFLGSASNSGRGILPRRIGWKPLPLFRWIPTEHFKASIET* |
Ga0100399_13197491 | 3300008008 | Aquifer | MSAKFLGSASNSGRGILPRRGGWKPLPLFHWIPTEHFKAGIE |
Ga0100394_10894431 | 3300008009 | Aquifer | RLTMSAKFLGSATNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET* |
Ga0100394_11281351 | 3300008009 | Aquifer | MSAKFLGSAPISGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100394_11396822 | 3300008009 | Aquifer | SRLTMSAKFLGSATNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100394_13862421 | 3300008009 | Aquifer | FLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100394_14977841 | 3300008009 | Aquifer | FLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100397_10113041 | 3300008010 | Aquifer | MSAEILGLAPNSGCGILPRRSGWKPLPLFRWIPTEHFKAGI |
Ga0100397_10141653 | 3300008010 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLSLFRWIPTEHFKAAIET* |
Ga0100397_10171181 | 3300008010 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTVHFKAGIET |
Ga0100397_10249214 | 3300008010 | Aquifer | ASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100397_10303033 | 3300008010 | Aquifer | APRQTTGNSPNSGRGILPHRSGWKPLPLFRWIPTEHFKAGIEK* |
Ga0100397_10421081 | 3300008010 | Aquifer | TMSAKFLGSATNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET* |
Ga0100397_10632241 | 3300008010 | Aquifer | KFLGSAPNSGRGILPRRSGWKPLRLFRWIPTEHFKAGTET* |
Ga0100397_10947992 | 3300008010 | Aquifer | FLGLAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100397_10959061 | 3300008010 | Aquifer | MSAKFLGLAPNGGRGTLPRRSGWKPLRLFRWIPTEHFK |
Ga0100397_10985191 | 3300008010 | Aquifer | AKFLGAAPNIGHGILPRRSGWKPLPLFLWIPTEHFKSGIET* |
Ga0100397_10988271 | 3300008010 | Aquifer | MSAKFLGAASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100397_11218691 | 3300008010 | Aquifer | AKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAAVET* |
Ga0100397_11673601 | 3300008010 | Aquifer | MSAKFLGSASNSGRGILPRRGGWKPLPLFHWIPTEHFKAGIET* |
Ga0100397_11919293 | 3300008010 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIE |
Ga0100396_10241714 | 3300008011 | Aquifer | GSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIEK* |
Ga0100396_10260761 | 3300008011 | Aquifer | PNSGRGILPRRSGWKPLSLFRWIPTEHFKAGIET* |
Ga0100396_10700151 | 3300008011 | Aquifer | APNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET* |
Ga0100396_11933292 | 3300008011 | Aquifer | GSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100396_12051182 | 3300008011 | Aquifer | MSAKFLGSASNIGHGILPRRSGSKPLPLFHWIPTEHFKAGIET* |
Ga0100396_12063002 | 3300008011 | Aquifer | MSAKFLGSASNSERGILPRRSGWKPLPIFRWIPTEHFKAGIET* |
Ga0100396_13450712 | 3300008011 | Aquifer | MSVKFLGSASNSVRGILPCRSGWKPLPLFRWIPTEHFKAGIET |
Ga0100398_10160686 | 3300008020 | Aquifer | LAPNSGRGILPRRSGWKPLPLFRWIPTEHFKASIET* |
Ga0100398_10219801 | 3300008020 | Aquifer | LTVLIYFRYLTMFAKFLGSAPKSGRGILPRCSGWKSLPFFRWIPTEHFKAGIET* |
Ga0100398_10237275 | 3300008020 | Aquifer | AKFLGSAPISGRGILPRRSGWKPLPLFRWIPTEHFKAGIKR* |
Ga0100398_10301334 | 3300008020 | Aquifer | MSAKFLGAASNSGRGILPRRSGWKPLPLFRWIPTEHFKASI |
Ga0100398_10345754 | 3300008020 | Aquifer | LGSAPISGRGILPRRSGWKLLPLFRWIPTEHFKAGIKR* |
Ga0100398_10867941 | 3300008020 | Aquifer | LTMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0100398_10997854 | 3300008020 | Aquifer | MSAKFLGSAPNSVRGILPRRSGWKPLRLFRWIPTEHFKAGIET |
Ga0100398_11318492 | 3300008020 | Aquifer | SAKFLGSASSSGRGILPRRSGWKPLPLFRWIPTELFKGGIET* |
Ga0100398_11559891 | 3300008020 | Aquifer | QPRLTMSAKFLGSASNSGRGILPRRSGWKPLPLFRWLPTEHFKAGIET* |
Ga0100398_11680521 | 3300008020 | Aquifer | LTMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKASIET* |
Ga0100398_11774811 | 3300008020 | Aquifer | MSAKFLGSAPNIGRGILPRRSGWQPLPLFRWIPTEHFKAGIEK* |
Ga0100398_13073262 | 3300008020 | Aquifer | MSAKFLGSASNSGRGILPRPSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100398_13892952 | 3300008020 | Aquifer | SASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100378_15087762 | 3300008085 | Aquifer | AFPYWIPPRLTMSAKFLGSASNSGRGILPRRTGWKPLPLFRWIPTEHFKAGIET* |
Ga0100388_100205873 | 3300008086 | Aquifer | MSAKFLGSAPDSGRGILPRRSGWKLLPLFRWIPTEHFKAGIET* |
Ga0100388_101181442 | 3300008086 | Aquifer | MSAKFLGSAQNSGRGILPRRSGWKPLSLFRWIPTEHFKAGIET* |
Ga0100388_101368161 | 3300008086 | Aquifer | TMSAKFLGSAPNSGRRILPRGSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100388_103133733 | 3300008086 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKA |
Ga0100388_104925302 | 3300008086 | Aquifer | MSAKFLGAASNSGRGILPRRSGWKPLPLFCWIPTEHFKAGIET* |
Ga0100393_101192583 | 3300008093 | Aquifer | LRKYLPARLTISAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET* |
Ga0100393_104519932 | 3300008093 | Aquifer | MSAKFLGAAPISGRGILPRRSGWKPLPLFHWIPTEHFKAGIET* |
Ga0100387_100337241 | 3300008094 | Aquifer | KFLGLAPNSGRGILPRRSSWKPLPLFRWIPTEHFKASIET* |
Ga0100387_102717571 | 3300008094 | Aquifer | TMSAKFLGSASNSGRGILPRRSGWKPLPLFRWLPTEHFKAGIET* |
Ga0100387_103376361 | 3300008094 | Aquifer | SRLTMSAKFLGAPPIIRHDILARRSGWKPPPLFRWIPTEHFKAGIEK* |
Ga0100387_104075782 | 3300008094 | Aquifer | LGSALNSGRGKMPRRSSWKPLPLFRWIPTEHFNAGIET* |
Ga0100387_104216101 | 3300008094 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET* |
Ga0100387_105538361 | 3300008094 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHF |
Ga0100392_11421212 | 3300008095 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKAGFET* |
Ga0100392_12593081 | 3300008095 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAAVET* |
Ga0100392_12809972 | 3300008095 | Aquifer | GSALNSGRGILLRRSGWKPLPLFRWIPTEHFNAGIET* |
Ga0100392_13179081 | 3300008095 | Aquifer | MFAKFLGSAPISGRGILPRRSGWKPLPLFRWIQTEH |
Ga0100377_10218141 | 3300009004 | Aquifer | MSAKFLGSAPNSGRGILPRCSGWKPLQRFRWIPTEHFNAG |
Ga0100377_10436653 | 3300009004 | Aquifer | MSAKFLGSATNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET* |
Ga0100377_10483935 | 3300009004 | Aquifer | FLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKGGIET* |
Ga0100377_10484291 | 3300009004 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEH |
Ga0100377_10492154 | 3300009004 | Aquifer | KFLGSATNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET* |
Ga0100377_10547591 | 3300009004 | Aquifer | MSAKFLGFATNSGRGVLPRRSGWKPLRHFRWIPTEHFKAGIET* |
Ga0100377_10753293 | 3300009004 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAG |
Ga0100377_10826311 | 3300009004 | Aquifer | ARLTMSAKFLGSASNSGRGILPRRSGWKPLPLSRWIPTEHFKAGIET* |
Ga0100377_10870982 | 3300009004 | Aquifer | KFLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIEK* |
Ga0100377_10947231 | 3300009004 | Aquifer | NRLQSTLTMSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTELFKGGIET* |
Ga0100377_11066863 | 3300009004 | Aquifer | AKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKASIET* |
Ga0100377_11106732 | 3300009004 | Aquifer | AGTSIQPRLTMSAKFLGSASNSGRGILPRRSGWKPLPLFRWLPTEHFKAGIET* |
Ga0100377_13015802 | 3300009004 | Aquifer | MSAKFLGSASNSGRGILPHRSGWKPLPLFHWIPTEHFKAGIET* |
Ga0119967_100441031 | 3300014060 | Freshwater | MSAKFLGLAPNGGRGTLPRRSGWKPLRLFRWIPTE |
Ga0119967_100904082 | 3300014060 | Freshwater | MSAKFIGSALNSGRGILPRRSGWKPLPLSRWIPTEHFKAGIET* |
Ga0119967_101595941 | 3300014060 | Freshwater | FAPNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET* |
Ga0210029_10212552 | 3300025008 | Aquifer | MFAKFLGSAPNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET |
Ga0210029_10303252 | 3300025008 | Aquifer | ISLRPRLTMFAKFLGSAPNSGRGILARRSGWKPLPLFRWILTERFKAGIET |
Ga0210029_10430091 | 3300025008 | Aquifer | SAPISGRGILPRRSGWKPLPLFRWIPTEHFKAGIKR |
Ga0210029_10457512 | 3300025008 | Aquifer | ISRFSPNIGRGKMPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210029_10623492 | 3300025008 | Aquifer | KFLGSAPNSGRGILPRRSGWKPLRLFRWIPTEHFKAGTET |
Ga0210029_10779692 | 3300025008 | Aquifer | MSAKFLGSASNSGRGILPRRIGWKPLPLFRWIPTEHFKAGIET |
Ga0210029_10828372 | 3300025008 | Aquifer | MSAKFLGSTPNSGRGILPRRSGWNPLPLFRWIPTEHFKAGIET |
Ga0210029_10914092 | 3300025008 | Aquifer | MSAKFLGSVSNSGRGILPRRSGWEPLPLFRWIPTEHFKAGIET |
Ga0210029_11114563 | 3300025008 | Aquifer | MFAKFLGSAPKSGRGILPRCSGWKSLPFFRWIPTEHFKAGIET |
Ga0210029_11140172 | 3300025008 | Aquifer | RRRYSTVRLTMSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210029_11548971 | 3300025008 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIET |
Ga0210029_11610441 | 3300025008 | Aquifer | MSAKFLGSAPISGRGILPRRSGWKPLPLFRWIPTEHFKAGINR |
Ga0210029_11702692 | 3300025008 | Aquifer | FLGSASNSGRGILPRRSGWKPLPLSRWIPTEHFKAGIET |
Ga0210023_10911542 | 3300025014 | Aquifer | CAQPRLKMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAAVET |
Ga0210022_11230001 | 3300025017 | Aquifer | ARLTMSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKVGIET |
Ga0210022_11395541 | 3300025017 | Aquifer | SLPRLTMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAGIET |
Ga0210030_10199524 | 3300025020 | Aquifer | MSAKFLGSATNSGRGILPRRSGWKPLPLFRWILTEHFKAGIET |
Ga0210030_10334151 | 3300025020 | Aquifer | FLGSAPNSGRGILPRRSGWKPLSLFRWIPTEHFKAGIET |
Ga0210030_10735512 | 3300025020 | Aquifer | MSAKFLGSALNSGRGKMPRRSGWKPLPLFRWIPTEHFNAGIET |
Ga0210030_10863502 | 3300025020 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLSRWIPTEHFKAGIET |
Ga0210030_10895041 | 3300025020 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210030_11628321 | 3300025020 | Aquifer | FLGSALNSGRGILLRRSGWKPLPLFRWIPTEHFNAGIET |
Ga0210056_10366502 | 3300025022 | Groundwater | SAPNSGRGILPRGSGWKPLPLFRWIPTEHFKAGIET |
Ga0210056_10381351 | 3300025022 | Groundwater | KFLGSASNSVRGILPCRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210056_10591071 | 3300025022 | Groundwater | MSAKFIGSALNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210056_10670561 | 3300025022 | Groundwater | ASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET |
Ga0210056_10746812 | 3300025022 | Groundwater | MSAKFLGSATNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210056_10768085 | 3300025022 | Groundwater | AKFLGSASNSGRGILPRRSGWKPLPLFRWLPTEHFKAGIET |
Ga0210056_10774853 | 3300025022 | Groundwater | MSAKFLGSASNSGRGILARRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210056_10932452 | 3300025022 | Groundwater | TMSAKFLGSGSNSGRGKMPRRSGWKPLPLFRWIPTEHFNAGIET |
Ga0210056_11024821 | 3300025022 | Groundwater | ICPRAVRLTMSAKFLGSAPNSGRGILPRRSGWKPPPLFRWIPTEHFKAGIEK |
Ga0210056_11048851 | 3300025022 | Groundwater | CSRLTMSAKFLGSASNSGRGILPRRSGWEPLPLFRWIPTEHFKAGIET |
Ga0210056_11882371 | 3300025022 | Groundwater | LAPNGGRGTLPRRSGWKPLRLFRWIPTEHFKAGIET |
Ga0210056_12014812 | 3300025022 | Groundwater | GSASNSGRGILPRRSGWKPLPLFHWIPTEHFKASIET |
Ga0210056_12336911 | 3300025022 | Groundwater | MSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKA |
Ga0210024_11860131 | 3300025031 | Aquifer | RLTMSAKFLGSATNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210042_11153122 | 3300025032 | Aquifer | QPRLKMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAAVET |
Ga0210042_11634561 | 3300025032 | Aquifer | EEGMSAKFLGFATNSGRGVLPRRSGWKPLRHFRWIPTEHFKAGIET |
Ga0210042_12506521 | 3300025032 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWQPLPLFRWIPTEHFKAGIEK |
Ga0210042_12531472 | 3300025032 | Aquifer | MSAKFLGAASNSGRGILPRRSGWKPLPLFRWIPTEHFKASIET |
Ga0210049_10367693 | 3300025036 | Groundwater | MSAKFLGSAPNSGRGTLPRRSGWKPPPLFRWIPTEHFKAGIEK |
Ga0210049_10544711 | 3300025036 | Groundwater | KFLGLAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210049_10554083 | 3300025036 | Groundwater | MSAKFLGSAPNCGRGILPRRSGWKPLPLFRWIPTEHFKAGIEK |
Ga0210049_10687002 | 3300025036 | Groundwater | MSAKFLGSAPNSGRGILPRRSGWKPAPLFRWIPTEHFKAGIET |
Ga0210049_10739645 | 3300025036 | Groundwater | MSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFK |
Ga0210049_10782631 | 3300025036 | Groundwater | MRMPAARLTMSAKFLGSASNSGRGILPRRIGWKPLPLFRWIPTEHFKA |
Ga0210049_10793762 | 3300025036 | Groundwater | MSAKFLGSASSSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET |
Ga0210049_10795021 | 3300025036 | Groundwater | FLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET |
Ga0210049_10881871 | 3300025036 | Groundwater | SAKFLGLAPNSGRGKMMRRSGWKPLRLFRWIPTEHFKAGIET |
Ga0210049_11089102 | 3300025036 | Groundwater | MSAKFLGLAPNGGRGTLPRRSGWKPLRLFRWIPTEHFKAGIET |
Ga0210049_12244981 | 3300025036 | Groundwater | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKAGFET |
Ga0210049_12263862 | 3300025036 | Groundwater | SAKFLGSASNSGRGILPRRSGWKPLRLFHWIPTEHFKASIET |
Ga0210049_12849812 | 3300025036 | Groundwater | RLTMSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIET |
Ga0210049_13131171 | 3300025036 | Groundwater | MFAKFLGSAPNSGRGILARRSGWKPLPLFSWILTERFKAGIET |
Ga0210021_11819192 | 3300025139 | Aquifer | RLTMSAKFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAAVET |
Ga0210044_100510615 | 3300025288 | Groundwater | MFAKFLGSAPNSGRGILPRRSGWKPLPLFRWILTEHFK |
Ga0210044_100847942 | 3300025288 | Groundwater | MSAKFLGSAPNSGRGILPRGSGWKPLPLFRWIPTEHFKAGIET |
Ga0210044_102500911 | 3300025288 | Groundwater | ARLTMSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKAGFET |
Ga0210044_102701422 | 3300025288 | Groundwater | MSAKFLGLAPNSGRGKMMRRSGWKPLRLFRWIPTEHFKAGIET |
Ga0210044_102912442 | 3300025288 | Groundwater | FLGSAPNSGRGILPRRSGWKPPPLFRWIPTEHFKAGIEK |
Ga0210044_104268641 | 3300025288 | Groundwater | MSAKFLGSASNSGRGILPRGSGWKPLPLFHWIPTEHFKAGIET |
Ga0210044_104759621 | 3300025288 | Groundwater | MFAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTELFKAGIET |
Ga0210044_104943572 | 3300025288 | Groundwater | ARLTMSAKFLGSAPNSGRGILPRRSGWKPLSLFRWIPTEHFKAGIET |
Ga0210044_104966401 | 3300025288 | Groundwater | MSAKFLGSAPNSGRGKMPRCSGWKPLQRFRWIPTEHFN |
Ga0210044_106185471 | 3300025288 | Groundwater | KFLGSALNSGRGILLRRSGWKPLPLFRWIPTEHFNAGIET |
Ga0210046_10240241 | 3300025825 | Groundwater | MFAKFLGSAPISGRGILPRRSGWKPLPLFRWIPTEHFKAGI |
Ga0210033_10640411 | 3300025826 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTE |
Ga0210033_10642781 | 3300025826 | Aquifer | MSAKFLGSAPNCGRGILPRRSGWKPLPLFRWIPTEHFK |
Ga0210033_11460432 | 3300025826 | Aquifer | TRLTMSAKFLGLATNSGRGVLPRRSGWKPLRRFRWIPTEHFKAGIET |
Ga0210033_11646752 | 3300025826 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIEA |
Ga0210033_12087321 | 3300025826 | Aquifer | MSAKFLGSAPNSGRGILPRCSGWKPLQRFRWIPTEHFN |
Ga0210031_11776272 | 3300025827 | Groundwater | MSAKFLGSASNSGRRILPRRSGWKPLPLFHWIPTEHFKVGI |
Ga0210015_10596202 | 3300025831 | Aquifer | MFAKFLGSAPISGRGILPRRSGWKLLPLFRWIPTEHFKAGIKR |
Ga0210015_10664001 | 3300025831 | Aquifer | MSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEH |
Ga0210015_10786991 | 3300025831 | Aquifer | KFLGSASNSGRGILPRRSGWKPLRLFRWIPTEHFKAAVET |
Ga0210015_10792381 | 3300025831 | Aquifer | KFLGSASNSGRGILPRRSGWKPLSLFRWIPTEHFKAAIET |
Ga0210015_11248282 | 3300025831 | Aquifer | MSAKFLGSASNSGRGILPRRSGWEPLPLFRWIPTEHFKA |
Ga0210015_11351131 | 3300025831 | Aquifer | MSAKFIGSALNSGRGILPRRSGWKPLPLFRWIPTEH |
Ga0210015_11512512 | 3300025831 | Aquifer | MSAKFLGSALNSGRGKMPRRSGWKPLPLFRWIPTGF |
Ga0210015_11784671 | 3300025831 | Aquifer | FLGSATNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210015_12184221 | 3300025831 | Aquifer | MSAKFLGSASNSGRGILPRPSGWKPLPLFRWIPTEHFKAAIET |
Ga0210039_12774691 | 3300025835 | Groundwater | RLTMFAKFLGSAPISGRGILPRRSGWKPLPLFRWIPTEHFKAGIKR |
Ga0210016_10553922 | 3300025837 | Groundwater | MSAKFLGSAPNSGRGILPRRSGWKPLPLFLWIPTEHFKSGIET |
Ga0210016_10736493 | 3300025837 | Groundwater | LGSASNSGRGILPRRSGWKPLPLSRWIPTEHFKAGIET |
Ga0210016_11035231 | 3300025837 | Groundwater | SAKFLGSASNSGRGILPRRGGWKPLPLFHWIPTEHFKAGIET |
Ga0210016_11505001 | 3300025837 | Groundwater | KFLGSATNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210016_13406632 | 3300025837 | Groundwater | MSAKFLGSASNSGRGILPHRSGWKPLPLFHWIPTEHFKAGIET |
Ga0210028_10499182 | 3300025841 | Aquifer | MFAKFLGSAPISGRGILPRRSGWKPLPLFRWIPTEHFKAGIK |
Ga0210028_11999281 | 3300025841 | Aquifer | MSAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIE |
Ga0210028_12093562 | 3300025841 | Aquifer | MFAKFLGSAPNSGRGILPRRSGWKPLPLFRWMLTEHF |
Ga0210054_12042101 | 3300025842 | Aquifer | SASNSGRGILPRRSGWKPLRLFRWIPTEHFKAAVET |
Ga0210054_12292002 | 3300025842 | Aquifer | ISRFSPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210054_12395032 | 3300025842 | Aquifer | AKFLGSAPNSGRGILPRRRGWKPLPLFRRIPTEHFKAGIET |
Ga0210036_12297101 | 3300025844 | Aquifer | KFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKASIET |
Ga0210050_10411161 | 3300025850 | Groundwater | MSAKFLGSAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210051_10412843 | 3300025868 | Groundwater | MSAKFLGSVSNSGRGILPRRSGWKPLPLFHWIPTEHFKAGIET |
Ga0210051_10572323 | 3300025868 | Groundwater | MSAKFLGLAPNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIE |
Ga0210051_10893252 | 3300025868 | Groundwater | MRMPAARLTMSAKFLGSASNSGRGILPRRIGWKPLPLFRWIPTEHFKAGIET |
Ga0210051_11141311 | 3300025868 | Groundwater | GSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAGIET |
Ga0210051_11144221 | 3300025868 | Groundwater | LTMSAKFLGSASNSGRGILPRRSGWKPLPLFHWIPTEHFKAGFET |
Ga0210051_11413011 | 3300025868 | Groundwater | RLTMSAKFLGSASNSGRGILPRRSGWKPLPLFRWIPTEHFKAAIET |
Ga0210051_11630371 | 3300025868 | Groundwater | SGGEAQPRLTMSAKFLGSASNSGRGILPRRGGWKPLPLFHWIPTEHFKAGFET |
Ga0210051_13017511 | 3300025868 | Groundwater | RFSPNSGRGILPRRSGWKPLQLFRWIPTEHFKAGIET |
Ga0210051_13448251 | 3300025868 | Groundwater | MSAKFLGSAPNSGRGILPRRSGWKPLRLFRWIPTEHFK |
Ga0210051_13528751 | 3300025868 | Groundwater | LTMSAKFLGSAPISGRGILPRRSGWKPLPLFRWIPTEHFKAGINR |
Ga0210051_13658351 | 3300025868 | Groundwater | MSAKFLGSASNSGRGILPRRSGWKPLSLFRWIPTEHFKAAIET |
⦗Top⦘ |