Basic Information | |
---|---|
Family ID | F009713 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 314 |
Average Sequence Length | 39 residues |
Representative Sequence | VSKARLIYFAVFAVLIATALLPALHLWPDGPHDGAEI |
Number of Associated Samples | 220 |
Number of Associated Scaffolds | 314 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 71.25 % |
% of genes near scaffold ends (potentially truncated) | 17.83 % |
% of genes from short scaffolds (< 2000 bps) | 81.21 % |
Associated GOLD sequencing projects | 207 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.522 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.197 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.936 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.325 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 35.38% β-sheet: 0.00% Coil/Unstructured: 64.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 314 Family Scaffolds |
---|---|---|
PF13432 | TPR_16 | 22.93 |
PF12728 | HTH_17 | 13.06 |
PF13424 | TPR_12 | 9.24 |
PF13560 | HTH_31 | 4.46 |
PF00106 | adh_short | 4.14 |
PF00581 | Rhodanese | 1.91 |
PF03109 | ABC1 | 1.59 |
PF00586 | AIRS | 0.96 |
PF07719 | TPR_2 | 0.96 |
PF07690 | MFS_1 | 0.96 |
PF07721 | TPR_4 | 0.64 |
PF00188 | CAP | 0.32 |
PF00149 | Metallophos | 0.32 |
PF14492 | EFG_III | 0.32 |
PF05235 | CHAD | 0.32 |
PF13439 | Glyco_transf_4 | 0.32 |
PF04542 | Sigma70_r2 | 0.32 |
PF02540 | NAD_synthase | 0.32 |
PF01040 | UbiA | 0.32 |
PF13518 | HTH_28 | 0.32 |
PF01048 | PNP_UDP_1 | 0.32 |
PF02129 | Peptidase_S15 | 0.32 |
PF00005 | ABC_tran | 0.32 |
PF00067 | p450 | 0.32 |
PF01467 | CTP_transf_like | 0.32 |
PF13414 | TPR_11 | 0.32 |
PF16491 | Peptidase_M48_N | 0.32 |
PF02738 | MoCoBD_1 | 0.32 |
PF13193 | AMP-binding_C | 0.32 |
COG ID | Name | Functional Category | % Frequency in 314 Family Scaffolds |
---|---|---|---|
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 1.59 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.32 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.32 |
COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.32 |
COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.32 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.32 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.32 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.32 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.32 |
COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.32 |
COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.32 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.32 |
COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.52 % |
Unclassified | root | N/A | 25.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig80930 | Not Available | 575 | Open in IMG/M |
2170459007|GJ61VE201CRUY2 | Not Available | 512 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101988385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1566 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101988948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104704355 | Not Available | 661 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1012664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1189 | Open in IMG/M |
3300000880|AL20A1W_1332387 | Not Available | 762 | Open in IMG/M |
3300000891|JGI10214J12806_10458587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
3300000956|JGI10216J12902_102678276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
3300000956|JGI10216J12902_105786917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1253 | Open in IMG/M |
3300000956|JGI10216J12902_108256006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
3300000956|JGI10216J12902_108420228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1404 | Open in IMG/M |
3300000956|JGI10216J12902_109409417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
3300000956|JGI10216J12902_109610592 | Not Available | 508 | Open in IMG/M |
3300000956|JGI10216J12902_113356967 | Not Available | 533 | Open in IMG/M |
3300001205|C688J13580_1039168 | Not Available | 619 | Open in IMG/M |
3300001536|A1565W1_11124372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
3300001537|A2065W1_10211090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300001686|C688J18823_10232341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1232 | Open in IMG/M |
3300001686|C688J18823_10450591 | Not Available | 828 | Open in IMG/M |
3300002557|JGI25381J37097_1028159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
3300002568|C688J35102_119262009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300002908|JGI25382J43887_10425916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 561 | Open in IMG/M |
3300004081|Ga0063454_101522392 | Not Available | 573 | Open in IMG/M |
3300005167|Ga0066672_10039909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2633 | Open in IMG/M |
3300005171|Ga0066677_10335654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 865 | Open in IMG/M |
3300005172|Ga0066683_10195550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
3300005175|Ga0066673_10201079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
3300005176|Ga0066679_10178334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1345 | Open in IMG/M |
3300005176|Ga0066679_11013594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
3300005179|Ga0066684_10135509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1549 | Open in IMG/M |
3300005184|Ga0066671_10277418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1043 | Open in IMG/M |
3300005187|Ga0066675_10221907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1338 | Open in IMG/M |
3300005187|Ga0066675_10945484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 650 | Open in IMG/M |
3300005356|Ga0070674_100152923 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300005445|Ga0070708_100013640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6661 | Open in IMG/M |
3300005445|Ga0070708_100403012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1290 | Open in IMG/M |
3300005458|Ga0070681_11352325 | Not Available | 635 | Open in IMG/M |
3300005471|Ga0070698_100111493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2700 | Open in IMG/M |
3300005518|Ga0070699_100059589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3307 | Open in IMG/M |
3300005526|Ga0073909_10686382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
3300005530|Ga0070679_100898052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
3300005536|Ga0070697_100383579 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300005543|Ga0070672_100626910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 938 | Open in IMG/M |
3300005555|Ga0066692_10577276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 708 | Open in IMG/M |
3300005556|Ga0066707_10296693 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300005559|Ga0066700_10475923 | Not Available | 874 | Open in IMG/M |
3300005560|Ga0066670_10301536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
3300005561|Ga0066699_10440565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 932 | Open in IMG/M |
3300005561|Ga0066699_10797228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
3300005575|Ga0066702_10587857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
3300005576|Ga0066708_10128241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1538 | Open in IMG/M |
3300005598|Ga0066706_10417462 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300005713|Ga0066905_100067706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2281 | Open in IMG/M |
3300005764|Ga0066903_100508336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2045 | Open in IMG/M |
3300005841|Ga0068863_101519398 | Not Available | 678 | Open in IMG/M |
3300005937|Ga0081455_10301561 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300005985|Ga0081539_10081656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1697 | Open in IMG/M |
3300005985|Ga0081539_10154767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
3300006031|Ga0066651_10090858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1521 | Open in IMG/M |
3300006034|Ga0066656_10249852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1139 | Open in IMG/M |
3300006034|Ga0066656_10257172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1123 | Open in IMG/M |
3300006034|Ga0066656_10992536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
3300006046|Ga0066652_100188630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1765 | Open in IMG/M |
3300006046|Ga0066652_100437822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1200 | Open in IMG/M |
3300006173|Ga0070716_100031615 | All Organisms → cellular organisms → Bacteria | 2880 | Open in IMG/M |
3300006175|Ga0070712_100917413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 756 | Open in IMG/M |
3300006573|Ga0074055_10013382 | Not Available | 585 | Open in IMG/M |
3300006604|Ga0074060_11845902 | Not Available | 570 | Open in IMG/M |
3300006606|Ga0074062_12246768 | Not Available | 533 | Open in IMG/M |
3300006755|Ga0079222_10744246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
3300006755|Ga0079222_11752014 | Not Available | 598 | Open in IMG/M |
3300006794|Ga0066658_10363893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
3300006797|Ga0066659_10008444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5381 | Open in IMG/M |
3300006800|Ga0066660_10024974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3571 | Open in IMG/M |
3300006800|Ga0066660_10139482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1781 | Open in IMG/M |
3300006806|Ga0079220_10201404 | Not Available | 1150 | Open in IMG/M |
3300006806|Ga0079220_10235353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1085 | Open in IMG/M |
3300006806|Ga0079220_10541671 | Not Available | 809 | Open in IMG/M |
3300006845|Ga0075421_101421867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
3300006854|Ga0075425_100493001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1411 | Open in IMG/M |
3300006903|Ga0075426_10469817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 933 | Open in IMG/M |
3300006954|Ga0079219_10567895 | Not Available | 819 | Open in IMG/M |
3300006954|Ga0079219_11506702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300009012|Ga0066710_100000730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 21499 | Open in IMG/M |
3300009012|Ga0066710_100228152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2676 | Open in IMG/M |
3300009012|Ga0066710_100321354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2276 | Open in IMG/M |
3300009012|Ga0066710_100994713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1294 | Open in IMG/M |
3300009012|Ga0066710_101025237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
3300009012|Ga0066710_102066717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
3300009012|Ga0066710_102184360 | Not Available | 809 | Open in IMG/M |
3300009012|Ga0066710_102650593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
3300009038|Ga0099829_10012413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5584 | Open in IMG/M |
3300009038|Ga0099829_11035033 | Not Available | 681 | Open in IMG/M |
3300009038|Ga0099829_11303732 | Not Available | 600 | Open in IMG/M |
3300009088|Ga0099830_10889541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
3300009089|Ga0099828_10670496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
3300009090|Ga0099827_10000385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 19472 | Open in IMG/M |
3300009090|Ga0099827_10004152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8444 | Open in IMG/M |
3300009094|Ga0111539_10545846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1350 | Open in IMG/M |
3300009098|Ga0105245_11864732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
3300009137|Ga0066709_100003764 | All Organisms → cellular organisms → Bacteria | 11826 | Open in IMG/M |
3300009137|Ga0066709_100482721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1741 | Open in IMG/M |
3300009137|Ga0066709_100623948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1539 | Open in IMG/M |
3300009137|Ga0066709_100638264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1523 | Open in IMG/M |
3300009137|Ga0066709_100799668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1366 | Open in IMG/M |
3300009137|Ga0066709_100921891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
3300009137|Ga0066709_101829892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
3300009137|Ga0066709_102182885 | Not Available | 764 | Open in IMG/M |
3300009147|Ga0114129_10019724 | All Organisms → cellular organisms → Bacteria | 9596 | Open in IMG/M |
3300009147|Ga0114129_12484629 | Not Available | 620 | Open in IMG/M |
3300009148|Ga0105243_10833299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
3300009156|Ga0111538_10383399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1780 | Open in IMG/M |
3300009789|Ga0126307_10113122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2157 | Open in IMG/M |
3300010039|Ga0126309_10164438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
3300010039|Ga0126309_10240539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1021 | Open in IMG/M |
3300010040|Ga0126308_10417931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 897 | Open in IMG/M |
3300010041|Ga0126312_11264801 | Not Available | 545 | Open in IMG/M |
3300010044|Ga0126310_10048443 | All Organisms → cellular organisms → Bacteria | 2345 | Open in IMG/M |
3300010044|Ga0126310_11868738 | Not Available | 501 | Open in IMG/M |
3300010045|Ga0126311_10398071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1059 | Open in IMG/M |
3300010099|Ga0127450_1020779 | Not Available | 610 | Open in IMG/M |
3300010107|Ga0127494_1114004 | Not Available | 505 | Open in IMG/M |
3300010132|Ga0127455_1185598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300010147|Ga0126319_1178823 | Not Available | 507 | Open in IMG/M |
3300010147|Ga0126319_1375627 | Not Available | 766 | Open in IMG/M |
3300010154|Ga0127503_10568429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3554 | Open in IMG/M |
3300010323|Ga0134086_10137650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
3300010323|Ga0134086_10364538 | Not Available | 574 | Open in IMG/M |
3300010335|Ga0134063_10257358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 832 | Open in IMG/M |
3300010335|Ga0134063_10333009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
3300010371|Ga0134125_11811891 | Not Available | 664 | Open in IMG/M |
3300010396|Ga0134126_10377472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1650 | Open in IMG/M |
3300010397|Ga0134124_10272216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1567 | Open in IMG/M |
3300010398|Ga0126383_10335680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1526 | Open in IMG/M |
3300010400|Ga0134122_10310180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1358 | Open in IMG/M |
3300010403|Ga0134123_11845112 | Not Available | 659 | Open in IMG/M |
3300010999|Ga0138505_100033871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
3300011332|Ga0126317_10561601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
3300011991|Ga0120153_1009825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2603 | Open in IMG/M |
3300011994|Ga0120157_1007589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3016 | Open in IMG/M |
3300012096|Ga0137389_10869222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
3300012198|Ga0137364_10072816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2355 | Open in IMG/M |
3300012200|Ga0137382_10180133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1446 | Open in IMG/M |
3300012200|Ga0137382_10762381 | Not Available | 695 | Open in IMG/M |
3300012201|Ga0137365_11143964 | Not Available | 559 | Open in IMG/M |
3300012204|Ga0137374_10000913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 32412 | Open in IMG/M |
3300012204|Ga0137374_10028563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6146 | Open in IMG/M |
3300012204|Ga0137374_10051958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4210 | Open in IMG/M |
3300012204|Ga0137374_10113992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2506 | Open in IMG/M |
3300012204|Ga0137374_10250092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
3300012204|Ga0137374_10257913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1457 | Open in IMG/M |
3300012206|Ga0137380_10089300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2816 | Open in IMG/M |
3300012208|Ga0137376_10334299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1315 | Open in IMG/M |
3300012212|Ga0150985_108834655 | Not Available | 698 | Open in IMG/M |
3300012212|Ga0150985_109632539 | Not Available | 518 | Open in IMG/M |
3300012212|Ga0150985_114389118 | Not Available | 623 | Open in IMG/M |
3300012212|Ga0150985_118861620 | Not Available | 600 | Open in IMG/M |
3300012212|Ga0150985_119510516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 530 | Open in IMG/M |
3300012350|Ga0137372_11067172 | Not Available | 557 | Open in IMG/M |
3300012353|Ga0137367_10620437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 756 | Open in IMG/M |
3300012354|Ga0137366_10576652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 808 | Open in IMG/M |
3300012355|Ga0137369_10449361 | Not Available | 920 | Open in IMG/M |
3300012356|Ga0137371_10004396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 11055 | Open in IMG/M |
3300012357|Ga0137384_10249041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1482 | Open in IMG/M |
3300012358|Ga0137368_10109690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2119 | Open in IMG/M |
3300012360|Ga0137375_10168097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2120 | Open in IMG/M |
3300012395|Ga0134044_1297707 | Not Available | 545 | Open in IMG/M |
3300012469|Ga0150984_101430851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300012469|Ga0150984_102202829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 554 | Open in IMG/M |
3300012469|Ga0150984_119803723 | Not Available | 530 | Open in IMG/M |
3300012685|Ga0137397_11286636 | Not Available | 521 | Open in IMG/M |
3300012915|Ga0157302_10512592 | Not Available | 521 | Open in IMG/M |
3300012922|Ga0137394_10078650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2758 | Open in IMG/M |
3300012922|Ga0137394_11004265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300012929|Ga0137404_10058843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2974 | Open in IMG/M |
3300012938|Ga0162651_100008894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1194 | Open in IMG/M |
3300012938|Ga0162651_100014174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1021 | Open in IMG/M |
3300012944|Ga0137410_10246498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1399 | Open in IMG/M |
3300012948|Ga0126375_10841520 | Not Available | 731 | Open in IMG/M |
3300012957|Ga0164303_10011294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3122 | Open in IMG/M |
3300012957|Ga0164303_10999934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
3300012958|Ga0164299_11648684 | Not Available | 507 | Open in IMG/M |
3300012960|Ga0164301_11271826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
3300012972|Ga0134077_10439438 | Not Available | 569 | Open in IMG/M |
3300013768|Ga0120155_1009452 | All Organisms → cellular organisms → Bacteria | 3497 | Open in IMG/M |
3300014052|Ga0120109_1003600 | All Organisms → cellular organisms → Bacteria | 3511 | Open in IMG/M |
3300014058|Ga0120149_1235824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
3300014154|Ga0134075_10399481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 607 | Open in IMG/M |
3300014157|Ga0134078_10307507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
3300014488|Ga0182001_10358636 | Not Available | 617 | Open in IMG/M |
3300014823|Ga0120170_1107875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
3300015209|Ga0167629_1067724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
3300015241|Ga0137418_10454295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
3300015371|Ga0132258_10052623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9326 | Open in IMG/M |
3300015371|Ga0132258_13345886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
3300017966|Ga0187776_10049179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2395 | Open in IMG/M |
3300017997|Ga0184610_1206464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 657 | Open in IMG/M |
3300017997|Ga0184610_1208110 | Not Available | 654 | Open in IMG/M |
3300018027|Ga0184605_10000731 | All Organisms → cellular organisms → Bacteria | 10014 | Open in IMG/M |
3300018027|Ga0184605_10026291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2372 | Open in IMG/M |
3300018027|Ga0184605_10084939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1384 | Open in IMG/M |
3300018027|Ga0184605_10151068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1045 | Open in IMG/M |
3300018027|Ga0184605_10407708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
3300018028|Ga0184608_10001843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6309 | Open in IMG/M |
3300018028|Ga0184608_10236367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
3300018056|Ga0184623_10096368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1366 | Open in IMG/M |
3300018061|Ga0184619_10015077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3111 | Open in IMG/M |
3300018071|Ga0184618_10058918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1417 | Open in IMG/M |
3300018071|Ga0184618_10080056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1248 | Open in IMG/M |
3300018074|Ga0184640_10308092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 719 | Open in IMG/M |
3300018081|Ga0184625_10036144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2439 | Open in IMG/M |
3300018433|Ga0066667_10041793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2689 | Open in IMG/M |
3300018433|Ga0066667_10231949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1384 | Open in IMG/M |
3300018433|Ga0066667_10687867 | Not Available | 857 | Open in IMG/M |
3300018433|Ga0066667_10953703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
3300018433|Ga0066667_11613066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300018468|Ga0066662_10575022 | Not Available | 1048 | Open in IMG/M |
3300018468|Ga0066662_10970110 | Not Available | 840 | Open in IMG/M |
3300018482|Ga0066669_10128189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1822 | Open in IMG/M |
3300018482|Ga0066669_10623175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
3300018482|Ga0066669_10821300 | Not Available | 825 | Open in IMG/M |
3300018482|Ga0066669_11643230 | Not Available | 588 | Open in IMG/M |
3300019255|Ga0184643_1284385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 625 | Open in IMG/M |
3300019279|Ga0184642_1138450 | Not Available | 714 | Open in IMG/M |
3300019279|Ga0184642_1701862 | Not Available | 633 | Open in IMG/M |
3300019873|Ga0193700_1058849 | Not Available | 591 | Open in IMG/M |
3300019886|Ga0193727_1046765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1411 | Open in IMG/M |
3300019887|Ga0193729_1000002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 258348 | Open in IMG/M |
3300020001|Ga0193731_1112530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 695 | Open in IMG/M |
3300020012|Ga0193732_1083935 | Not Available | 514 | Open in IMG/M |
3300020069|Ga0197907_10234534 | Not Available | 606 | Open in IMG/M |
3300021073|Ga0210378_10128082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 984 | Open in IMG/M |
3300021363|Ga0193699_10023228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2280 | Open in IMG/M |
3300021418|Ga0193695_1007803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2084 | Open in IMG/M |
3300021418|Ga0193695_1039312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1023 | Open in IMG/M |
3300021445|Ga0182009_10198750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
3300021560|Ga0126371_10565548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1286 | Open in IMG/M |
3300022694|Ga0222623_10113838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1054 | Open in IMG/M |
3300024330|Ga0137417_1465930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1253 | Open in IMG/M |
3300025910|Ga0207684_10033626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4360 | Open in IMG/M |
3300025928|Ga0207700_11242330 | Not Available | 664 | Open in IMG/M |
3300025932|Ga0207690_11167389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 642 | Open in IMG/M |
3300025934|Ga0207686_10288259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1215 | Open in IMG/M |
3300026295|Ga0209234_1054409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1521 | Open in IMG/M |
3300026301|Ga0209238_1070933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1225 | Open in IMG/M |
3300026317|Ga0209154_1032492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2391 | Open in IMG/M |
3300026330|Ga0209473_1159915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
3300026497|Ga0257164_1059667 | Not Available | 623 | Open in IMG/M |
3300026529|Ga0209806_1079375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1453 | Open in IMG/M |
3300026530|Ga0209807_1193535 | Not Available | 723 | Open in IMG/M |
3300026536|Ga0209058_1125648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1257 | Open in IMG/M |
3300026538|Ga0209056_10642618 | Not Available | 535 | Open in IMG/M |
3300026542|Ga0209805_1084118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1534 | Open in IMG/M |
3300026547|Ga0209156_10231666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 868 | Open in IMG/M |
3300026550|Ga0209474_10103046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1918 | Open in IMG/M |
3300026552|Ga0209577_10015427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6855 | Open in IMG/M |
3300026552|Ga0209577_10528097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
3300027561|Ga0209887_1005999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3397 | Open in IMG/M |
3300027562|Ga0209735_1009406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1868 | Open in IMG/M |
3300027681|Ga0208991_1114802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
3300027738|Ga0208989_10279021 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 538 | Open in IMG/M |
3300027765|Ga0209073_10170828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
3300027765|Ga0209073_10520414 | Not Available | 504 | Open in IMG/M |
3300027787|Ga0209074_10530669 | Not Available | 515 | Open in IMG/M |
3300027846|Ga0209180_10809181 | Not Available | 501 | Open in IMG/M |
3300027882|Ga0209590_10002278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7658 | Open in IMG/M |
3300027882|Ga0209590_10002715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7153 | Open in IMG/M |
3300028047|Ga0209526_10029760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3836 | Open in IMG/M |
3300028536|Ga0137415_10114899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2539 | Open in IMG/M |
3300028705|Ga0307276_10002538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2695 | Open in IMG/M |
3300028705|Ga0307276_10017106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
3300028713|Ga0307303_10014804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1435 | Open in IMG/M |
3300028717|Ga0307298_10079080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 921 | Open in IMG/M |
3300028719|Ga0307301_10051444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1268 | Open in IMG/M |
3300028719|Ga0307301_10223310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
3300028755|Ga0307316_10257230 | Not Available | 635 | Open in IMG/M |
3300028755|Ga0307316_10295193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
3300028768|Ga0307280_10324947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
3300028791|Ga0307290_10050633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1497 | Open in IMG/M |
3300028793|Ga0307299_10052117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1508 | Open in IMG/M |
3300028799|Ga0307284_10251627 | Not Available | 703 | Open in IMG/M |
3300028802|Ga0307503_10147377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1064 | Open in IMG/M |
3300028807|Ga0307305_10058787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1772 | Open in IMG/M |
3300028810|Ga0307294_10258848 | Not Available | 620 | Open in IMG/M |
3300028811|Ga0307292_10228201 | Not Available | 770 | Open in IMG/M |
3300028814|Ga0307302_10020876 | All Organisms → cellular organisms → Bacteria | 2963 | Open in IMG/M |
3300028819|Ga0307296_10750021 | Not Available | 533 | Open in IMG/M |
3300028828|Ga0307312_11126564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
3300028878|Ga0307278_10013022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3875 | Open in IMG/M |
3300028881|Ga0307277_10228913 | Not Available | 818 | Open in IMG/M |
3300028881|Ga0307277_10421484 | Not Available | 597 | Open in IMG/M |
3300028884|Ga0307308_10284434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 792 | Open in IMG/M |
3300028884|Ga0307308_10367407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
3300030990|Ga0308178_1154515 | Not Available | 530 | Open in IMG/M |
3300030993|Ga0308190_1179476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
3300031091|Ga0308201_10187947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
3300031092|Ga0308204_10274603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
3300031093|Ga0308197_10433445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
3300031094|Ga0308199_1042639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
3300031125|Ga0308182_1006572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
3300031421|Ga0308194_10068221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 954 | Open in IMG/M |
3300031421|Ga0308194_10099063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 835 | Open in IMG/M |
3300031421|Ga0308194_10103490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
3300031421|Ga0308194_10134882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
3300031421|Ga0308194_10220452 | Not Available | 623 | Open in IMG/M |
3300031421|Ga0308194_10380033 | Not Available | 510 | Open in IMG/M |
3300031421|Ga0308194_10383448 | Not Available | 508 | Open in IMG/M |
3300031938|Ga0308175_102088682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300032180|Ga0307471_100462808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1410 | Open in IMG/M |
3300034384|Ga0372946_0370744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
3300034644|Ga0370548_139843 | Not Available | 517 | Open in IMG/M |
3300034644|Ga0370548_144462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.61% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.87% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.50% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.18% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.87% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.23% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.59% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.59% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.59% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.27% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.27% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.27% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.96% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.64% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.64% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.64% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.64% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.32% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.32% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.32% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.32% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.32% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.32% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.32% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.32% | |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.32% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300001536 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010099 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
3300011994 | Permafrost microbial communities from Nunavut, Canada - A7_65cm_12M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
3300034644 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_00242660 | 2124908016 | MSKSRLIYFAVFAMIIAMAVLPALSFWPLGPHDGANL | |
L02_03468380 | 2170459007 | Grass Soil | VTTVSKARLIYFAVFAIIIVTALLPALAFWPDGPHDGSEI |
INPhiseqgaiiFebDRAFT_1019883853 | 3300000364 | Soil | VSKARLIYXAVFXVLIVVALLPAMAFMTDGPHEGAGV* |
INPhiseqgaiiFebDRAFT_1019889482 | 3300000364 | Soil | VSKARLIYLAVFXVLIXVALLPAMAFXTXGPHEGAGV* |
INPhiseqgaiiFebDRAFT_1047043552 | 3300000364 | Soil | VSKARLIYFAVFAVLIATALLPALHLWPDGPHDGAEI* |
AP72_2010_repI_A100DRAFT_10126642 | 3300000837 | Forest Soil | LTKARLIYVAVFAILLAMALLPALGRFPLGGHEGGEL* |
AL20A1W_13323872 | 3300000880 | Permafrost | MSKARLIYFAVFAVLIFTALLPALSFLPDGNHDGGEI* |
JGI10214J12806_104585872 | 3300000891 | Soil | MSRARLIYFAVFAVLIGVALLPALSLWPDGSHDGHEI* |
JGI10216J12902_1026782762 | 3300000956 | Soil | VSKARLIYFAVFAVLIALALLPAMQFWPEGPHEGNGI* |
JGI10216J12902_1057869172 | 3300000956 | Soil | MSRARLIYFAVFAVLIATALLPALQFFPAGPHDGAD* |
JGI10216J12902_1082560062 | 3300000956 | Soil | VSKARLIYFAVFAIMIVTALLPALSLWPDGPHDGAEI* |
JGI10216J12902_1084202283 | 3300000956 | Soil | MKGGVHVSKARLIYFAVFAIIIVAALLPALSLWPEGQHDGADF* |
JGI10216J12902_1094094172 | 3300000956 | Soil | VSTLTKARLIYLAVFAILIAMALLPALAHLPCGGHEGSDF* |
JGI10216J12902_1096105922 | 3300000956 | Soil | MSKARLIYFAVFAILIGSALLSAIGPLWPDGPHEGGEI* |
JGI10216J12902_1133569672 | 3300000956 | Soil | DHVSKARLIYFAVFAILIASALLSALSYWPDGPHEGSEV* |
C688J13580_10391682 | 3300001205 | Soil | VSKARVIYFAVFAILIAMALLPAMQFWPFGPHEGSDF* |
A1565W1_111243722 | 3300001536 | Permafrost | VSRARLIYFAVFAIIIVSALLPALSLWPEGPHDGAEI* |
A2065W1_102110902 | 3300001537 | Permafrost | MSRAQLIYFAVFAVLIGAALLPALQFFPDGPHDGAE* |
C688J18823_102323413 | 3300001686 | Soil | VSKARLIYFAVFAILIAAALLPALAFRPLGAHDGAEI* |
C688J18823_104505912 | 3300001686 | Soil | MSKGRLIYFAIFAVLVAMALLPALAFLPLGGHEGSDF* |
JGI25381J37097_10281591 | 3300002557 | Grasslands Soil | VTTVSKARIIYFAIFAILIVTALLPALSFWPDGPHDGAEI* |
C688J35102_1192620092 | 3300002568 | Soil | QGGDSRLSKARLIYFAVFAVLIALALLPAIQFWPEGPHEGNGV* |
JGI25382J43887_104259161 | 3300002908 | Grasslands Soil | HLSKGGDHMSKARLIYFAVFAILIATALLPALSYSPFGMHDGGEI* |
Ga0063454_1015223922 | 3300004081 | Soil | APKGGDHVSKARLMYFAVFAILIAAALLPAFAFLPLGGHDGAEI* |
Ga0066672_100399093 | 3300005167 | Soil | MEGGVHVSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEL* |
Ga0066677_103356542 | 3300005171 | Soil | VTTVSKARIIYFAVFAILIVTALLPALAFLPDGPHDGAEI* |
Ga0066683_101955502 | 3300005172 | Soil | VTTVSKARLIYFAVFAILIGSALLSALSLWPDGPHDGAEI* |
Ga0066673_102010792 | 3300005175 | Soil | MKGGVHMSKARFIYIAVFTVLLVTALLPALAFLPEGMHDGGQI* |
Ga0066679_101783343 | 3300005176 | Soil | VTTVSKARIIYFAVFAILIVTALLPALSFWPDGPHDGAEI* |
Ga0066679_110135942 | 3300005176 | Soil | EGGVHVSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEL* |
Ga0066684_101355091 | 3300005179 | Soil | VLLVSKARLIYFAIFAILIASALMPALVRFWPDGPHDGGEL* |
Ga0066671_102774182 | 3300005184 | Soil | LLVSKARLIYFAIFAILIASALMPALVRFWPYGPHDGGEI* |
Ga0066675_102219072 | 3300005187 | Soil | MKGGVHVSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEI* |
Ga0066675_109454841 | 3300005187 | Soil | EVTTVSKARLIYFAVFAIIIATALLPALSLWPEGPHDGAEI* |
Ga0070674_1001529234 | 3300005356 | Miscanthus Rhizosphere | NAPKGGDHVSKARLMYFAVFAILIAAALLPALAFMPLGGHDGAEI* |
Ga0070708_1000136403 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTVSKARLIYFAVFAIIIVTALLPALAFWPDGPHDGAEI* |
Ga0070708_1004030122 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MHVSKARLIYMAVFVVLIITALLPALAFVPLGGHDGNEI* |
Ga0070681_113523252 | 3300005458 | Corn Rhizosphere | EGGESLSKARLIYFAVFAVLIALALLPALQFWPEGPHEGSGI* |
Ga0070698_1001114935 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MHVSKARLIYMAVFVVLIVTALLPALAFVPLGGHDGNEI* |
Ga0070699_1000595893 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTVSKARLIYVAVFAIIIVTALLPALSLWPDGPHDGAEI* |
Ga0073909_106863821 | 3300005526 | Surface Soil | SSFRKGVTTLSRARLIYFAVFSILIATALLPALHFWPDGPHDGAD* |
Ga0070679_1008980522 | 3300005530 | Corn Rhizosphere | NAPKGGDHVSKARLMYFAVFAILIAAAMLPALARMPLGAHDGGEI* |
Ga0070697_1003835792 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTVSKARLIYFAVFAIIIVTALLPALAFWPDGPHDGSEI* |
Ga0070672_1006269102 | 3300005543 | Miscanthus Rhizosphere | MSRARLIYFAVFSILIATALLPALHFWPDGPHDGAD* |
Ga0066692_105772762 | 3300005555 | Soil | VTTVSKARLIYFAVFAIIIVTALLPALSFWPDGPHDGAEI* |
Ga0066707_102966932 | 3300005556 | Soil | VSKARFIYFLVFAIIIAAALLPALSLWPEGPHDGSEI* |
Ga0066700_104759232 | 3300005559 | Soil | VSKARLIYFAVFAIMFAAAILPVLSLLPDGPHEGGEF* |
Ga0066670_103015362 | 3300005560 | Soil | MKGGVPVSKARLIYITVFVVLVVTALLPALAFLPDGMHDGG |
Ga0066699_104405651 | 3300005561 | Soil | GGVHVSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEL* |
Ga0066699_107972281 | 3300005561 | Soil | VSKARLIYFAVFAIMFAAAILPVLSLLPDGPHEGGE |
Ga0066702_105878572 | 3300005575 | Soil | VHVSKARLIYFAIFAILIASALMPALVRFWPYGPHDGGEI* |
Ga0066708_101282414 | 3300005576 | Soil | MSKARLIYIAVFAVLIVTALLPALAFLPDGMHDGGEI* |
Ga0066706_104174622 | 3300005598 | Soil | VHVSKARLIYLAVFVVLIVTALLPALAFVPCGMHDGGEI* |
Ga0066905_1000677063 | 3300005713 | Tropical Forest Soil | LSKARLIYFAVFAVIIALALLPAMQFWPDGPHEGSGI* |
Ga0066903_1005083362 | 3300005764 | Tropical Forest Soil | LTKARLIYVAVFAILIAMALLPAMGLLPLGGHEGSDF* |
Ga0068863_1015193982 | 3300005841 | Switchgrass Rhizosphere | VTKARLIYLAVFAVLIALALLPAMQFWPLGPHEGAGV* |
Ga0081455_103015612 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTKARVIYLAVLAILIASALLPALQLWPDGPSDGAEI* |
Ga0081539_100816563 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VSKARLIYFAVFAVLIATALLPALMFLSEGPHEGSEF* |
Ga0081539_101547672 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MSKSRLIYFAVFAMIIAMAVLPALSFWPLGPHDGTDL* |
Ga0066651_100908582 | 3300006031 | Soil | LSKARLIYFAVFAVLIALALLPAIQFWPEGPHEGNGV* |
Ga0066656_102498523 | 3300006034 | Soil | KARLIYFAIFAILIASALMPALVRFWPDGPHDGGEL* |
Ga0066656_102571721 | 3300006034 | Soil | VTTVSKARLIYFAVFAIIIATALLPALSLWPEGPHDGAEI* |
Ga0066656_109925361 | 3300006034 | Soil | VSKARLIYFAVFAILIGSALLSALSLWPDGPHDGAEI* |
Ga0066652_1001886302 | 3300006046 | Soil | LSKARLIYFAVFAVLIALALLPALQFWPEGPHEGGSI* |
Ga0066652_1004378222 | 3300006046 | Soil | VSKARLIYFAVFAILIAMALLPAMQFWPLGPHEGSDF* |
Ga0070716_1000316152 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKARLMYFAVFAILIAAAMLPALARMPLGAHDGGEI* |
Ga0070712_1009174132 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | NAPKGGDHVSKARLMYFAVFAILIAAALLPALALMPLGGHDGAEI* |
Ga0074055_100133821 | 3300006573 | Soil | VSKARLMYFAVFAILIAAALLPAFARMPLGGHDGAEI* |
Ga0074060_118459021 | 3300006604 | Soil | VSKARLMYFAVFAILIAAAVLPAFARMPLGGHDGAEI* |
Ga0074062_122467682 | 3300006606 | Soil | HLSKGGDHMSRARLIYFAVFSILIATALLPALHFWPDGPHDGAD* |
Ga0079222_107442462 | 3300006755 | Agricultural Soil | LSKARLIYFAVFAALIALALLPALQFWPEGPHEGNGI* |
Ga0079222_117520142 | 3300006755 | Agricultural Soil | VSKARLIYFAVFAMLIAMALLPAMQFWPFGPHEGSDF* |
Ga0066658_103638932 | 3300006794 | Soil | VKGGVHVSKARLIYFAIFAILIASALMPALVRFWPDGPHDGGEL* |
Ga0066659_100084447 | 3300006797 | Soil | VSKARIIYFAVFAILIVTALLPALAFLPDGPHDGAEI* |
Ga0066660_100249745 | 3300006800 | Soil | VSKARLIYFAIFAILIASALMPALVRFWPYGPHDGGEI* |
Ga0066660_101394823 | 3300006800 | Soil | VHVSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEL* |
Ga0079220_102014042 | 3300006806 | Agricultural Soil | LSKARLIYLAVFALLIVMALLPAMQVPLLGPHEGAGV* |
Ga0079220_102353532 | 3300006806 | Agricultural Soil | LSKARLIYFAVFAVLIALALLPALQFWPEGPHEGSGI* |
Ga0079220_105416712 | 3300006806 | Agricultural Soil | VSKARLIYFAVFAILIAMALLPAMQFWPFGPHEGSDF* |
Ga0075421_1014218671 | 3300006845 | Populus Rhizosphere | VSKATLIYVAVFAILLATALLPALQFFPEGPHDGARF* |
Ga0075425_1004930012 | 3300006854 | Populus Rhizosphere | VSKARLIYFAVFAVLIALALLPALQFWPEGPHEGSGI* |
Ga0075426_104698172 | 3300006903 | Populus Rhizosphere | LSKARLIYFAVFAVLIALALLPALQFWPEGPHEGNGV* |
Ga0079219_105678952 | 3300006954 | Agricultural Soil | LSKARLIYFAVFALLIVMALLPAMQVPLLGPHEGAGV* |
Ga0079219_115067022 | 3300006954 | Agricultural Soil | LSKARLIYFAVFAVLIALALLPAMAFAPLGAHEGGSI* |
Ga0066710_10000073014 | 3300009012 | Grasslands Soil | VSKARIIYFAVFAILIVTALLPALAFLPDGPHDGAEI |
Ga0066710_1002281522 | 3300009012 | Grasslands Soil | VSKARLIYFGVFAIIIVTALLPALSLWPDGPHDGSEI |
Ga0066710_1003213542 | 3300009012 | Grasslands Soil | VSKARLIYFAVFAVIIAVALLPALQFWPDGPHDGSEI |
Ga0066710_1009947132 | 3300009012 | Grasslands Soil | VSKARLIYFAVFAIMIVTALLPALNLWPDGPHDGAEI |
Ga0066710_1010252372 | 3300009012 | Grasslands Soil | VTHVSKARLIYFAVFAILIATALLPALQFWPDGPHEGGEI |
Ga0066710_1020667172 | 3300009012 | Grasslands Soil | MKGGVPVSKARLIYFAVFAVLIVTALLPALALLTDGPHEGGEI |
Ga0066710_1021843602 | 3300009012 | Grasslands Soil | MKGGVHMSKARLIYIAVFAVLIVTALLPALAFLPDGMHDGGEI |
Ga0066710_1026505932 | 3300009012 | Grasslands Soil | VTTVSKARLIYFAVFAILIGSALLSALSLWPDGPHDGAEI |
Ga0099829_100124134 | 3300009038 | Vadose Zone Soil | VTTVSKARLIYFAVFAIIIVTALLPALSFWPDGPHDGSEI* |
Ga0099829_110350332 | 3300009038 | Vadose Zone Soil | VSKARLIYFAVFAILIVTALLPALSLWPEGPHDGAEI* |
Ga0099829_113037322 | 3300009038 | Vadose Zone Soil | MSRARLIYFAVFAVLIATALLPALLQILPDGMHDGGEI* |
Ga0099830_108895411 | 3300009088 | Vadose Zone Soil | MSKARLIYFTVFAILIVAALLPALTLWPGGPHDGSEI* |
Ga0099828_106704962 | 3300009089 | Vadose Zone Soil | VSKARLIYFAVFAILIVTALLPALSLWPAGPHDGAEI* |
Ga0099827_1000038512 | 3300009090 | Vadose Zone Soil | VSKARLIYFAVFAILLATALLPALQLWPDGPHDGTEI* |
Ga0099827_100041523 | 3300009090 | Vadose Zone Soil | MSKARLIYFAVFAILIATALLPALSYSPFGMHDGGEI* |
Ga0111539_105458462 | 3300009094 | Populus Rhizosphere | VTKARVIYLAVLAVLIASALLPALQLWPDGPSDGAEI* |
Ga0105245_118647321 | 3300009098 | Miscanthus Rhizosphere | VSKARLTYFLVFAILIAMALLPAMQFWPFGPHEGGEI* |
Ga0066709_1000037647 | 3300009137 | Grasslands Soil | VIRLSKARLIYFAVFAILIAFALLPALVLFGMHDGSDF* |
Ga0066709_1004827212 | 3300009137 | Grasslands Soil | VSKARLIYFAVFAVIIAVALLPALQFWPDGPHDGSEI* |
Ga0066709_1006239484 | 3300009137 | Grasslands Soil | MKGGVPVSKARLIYFAVFAVLIVTALLPALALLTDGPHEGGEI* |
Ga0066709_1006382641 | 3300009137 | Grasslands Soil | VSKARLIYFAVFAIMIVTALLPALNLWPDGPHDGAEI* |
Ga0066709_1007996682 | 3300009137 | Grasslands Soil | MKGGVHVSKARLIYFAVFALLFAGTILPALPDGMHDGGQI* |
Ga0066709_1009218912 | 3300009137 | Grasslands Soil | VTTVSKARLIYFAVFAIIIVTALLPALSLWPEGPHDGAEI* |
Ga0066709_1018298922 | 3300009137 | Grasslands Soil | VTTVSKARLIYFAVFAIIIVTALLPALSLLPDGPHDGAE* |
Ga0066709_1021828851 | 3300009137 | Grasslands Soil | MSKARLIYFAVFAILIATALLPALSFSPFGMHDGGEI* |
Ga0114129_1001972411 | 3300009147 | Populus Rhizosphere | MSKSRLIYFAVFAMIIAMAVLPALSLWPLGPHDGADL* |
Ga0114129_124846292 | 3300009147 | Populus Rhizosphere | VSKARLIYLAVFVVLIAVALLPAMAFMTEGPHEGAGV* |
Ga0105243_108332992 | 3300009148 | Miscanthus Rhizosphere | MSKARLIYFAVFAVLIGAALLPALSLWPDGSHDGHEI* |
Ga0111538_103833994 | 3300009156 | Populus Rhizosphere | LSKARLIYFAVFAVLIALALLPALQFWPEGPHEGNGI* |
Ga0126307_101131222 | 3300009789 | Serpentine Soil | VSKARLIYVAVFAILLATALLPALHFWPEGPHDGAEI* |
Ga0126309_101644382 | 3300010039 | Serpentine Soil | MPKGGDHMTKARLIYVAVFAILIATALLPALHFWPEGPHEGGEI* |
Ga0126309_102405391 | 3300010039 | Serpentine Soil | REEVTNVSKARLIYLAVFAILIATALLPALHFWPEGAHEGSEI* |
Ga0126308_104179312 | 3300010040 | Serpentine Soil | MRGGDHVTKARFIYFAVLAILIASALLPAMHLWPDGPSDGAEI* |
Ga0126312_112648012 | 3300010041 | Serpentine Soil | VTKARLIYLAVFAILIATALLPAFQLFIDGPHDGNAF* |
Ga0126310_100484432 | 3300010044 | Serpentine Soil | VSKARLIYFAVFAILLASALLPALAFLADGPHEGGEI* |
Ga0126310_118687381 | 3300010044 | Serpentine Soil | RGGGHVSKARLIYFAVFAILIVTALLPALYLWTEGPHEGGEI* |
Ga0126311_103980712 | 3300010045 | Serpentine Soil | MSKARLTYFLVFAILIAMAVLPAMQFWPFGPHEGGEI* |
Ga0127450_10207792 | 3300010099 | Grasslands Soil | LSKARLIYLAVFALLIVLALLPAMQFWPEGPHEGGSI* |
Ga0127494_11140042 | 3300010107 | Grasslands Soil | LSKARLIDFAVFAVLIVLALLPAMQFWPEGPHEGGSI* |
Ga0127455_11855982 | 3300010132 | Grasslands Soil | VSKARLIYFAVFAILIAMALLPAMQFWPLGPHEGGEI* |
Ga0126319_11788231 | 3300010147 | Soil | MSRARLIYFAVFAILIATALLPALSLWPAGPHDGAEI* |
Ga0126319_13756272 | 3300010147 | Soil | VSKARLIYFAVFAILIAMALLPAMQFLPLGPHEGGEI* |
Ga0127503_105684293 | 3300010154 | Soil | VTTVSKARLIYFAVFAIIIATALLPALHMWPDGPHDGAEI* |
Ga0134086_101376502 | 3300010323 | Grasslands Soil | VTTVSKARLIYFAVFAILIASALLPALFLFGMHDGSDF* |
Ga0134086_103645381 | 3300010323 | Grasslands Soil | GELVSKARLIYFAVFAILIAMALLPAMQFWPLGPHEGGEF* |
Ga0134063_102573583 | 3300010335 | Grasslands Soil | MSKARFIYIAVFTVLLVTALLPALAFLPEGMHDGGQI* |
Ga0134063_103330092 | 3300010335 | Grasslands Soil | MSKGRLIYLAVFAVLVTLALLPALAFLPLGGHEGSDF* |
Ga0134125_118118912 | 3300010371 | Terrestrial Soil | MSKARLIYFAVFAVIIVTALLPALAFLPDGPHDGAEL* |
Ga0134126_103774722 | 3300010396 | Terrestrial Soil | MSKSRLIYFAVFAMIIAMAVLPALSFWPLGPHDGADL* |
Ga0134124_102722163 | 3300010397 | Terrestrial Soil | VSKARLIYFAVFAVLIGVALLPALMHLWPEGPHDG |
Ga0126383_103356802 | 3300010398 | Tropical Forest Soil | LTKARLIYVAVFAILIAMALLPALAFLPYGGHEGSDF* |
Ga0134122_103101802 | 3300010400 | Terrestrial Soil | MSRARLIYFAVFAVLIGAALLPALSLWPDGAHDGHEI* |
Ga0134123_118451122 | 3300010403 | Terrestrial Soil | VSKARLTYFLVFAILIAMALLPAMQFWPFGPHEGGER* |
Ga0138505_1000338712 | 3300010999 | Soil | VTTVSKARLIYFTVFAILIAAALLPALAFLPLGGHDGAEI* |
Ga0126317_105616012 | 3300011332 | Soil | VSKARLIYFLVFAILIATALLPALQFLPDGPHEGGEI* |
Ga0120153_10098254 | 3300011991 | Permafrost | MSRARLIYFAVFAILIATALLPALQFLPEGPHDGAEL* |
Ga0120157_10075894 | 3300011994 | Permafrost | MSRARLIYFAVFAIIIATALLPALLQILPDGMHDGGEI* |
Ga0137389_108692221 | 3300012096 | Vadose Zone Soil | VTKARLIYFVVFAIIIASALLPALCWPGGPNDGAEI* |
Ga0137364_100728164 | 3300012198 | Vadose Zone Soil | VTTVSKARLIYFAVFAIIIVTALLPALSLWPDGPHDGAEI* |
Ga0137382_101801332 | 3300012200 | Vadose Zone Soil | VTTVSKALLIYFAVFAIIIVTALLPALSFWPDGPHDGAEI* |
Ga0137382_107623812 | 3300012200 | Vadose Zone Soil | MSKARLIYFAVFAILVATALLPALSFLPFGMHDGAD* |
Ga0137365_111439642 | 3300012201 | Vadose Zone Soil | VTHVSKARLIYFAVFAIIIATALLPALHLWPDGPHEGGEI* |
Ga0137374_1000091328 | 3300012204 | Vadose Zone Soil | MSRARLIYLAVFAVLIATALLPALQFFPGGPHDGAD* |
Ga0137374_100285635 | 3300012204 | Vadose Zone Soil | MKGGVYVSKARLIYFAVFAIIIVTALLPALSLWPEGQHDGADF* |
Ga0137374_100519583 | 3300012204 | Vadose Zone Soil | VTKARLIYFAVFAILIASALLPALTLWPDGPSDGAEI* |
Ga0137374_101139922 | 3300012204 | Vadose Zone Soil | VSRARLIYFAVFAILIATALLPALSLLPDGPHEGGEI* |
Ga0137374_102500922 | 3300012204 | Vadose Zone Soil | VSKARLIYFAVFATLIVIALLPALTFWPDGPHEGGEI* |
Ga0137374_102579132 | 3300012204 | Vadose Zone Soil | VSKARLIYFAVFAILIATALLPALQLWPDGPHEGGEV* |
Ga0137380_100893004 | 3300012206 | Vadose Zone Soil | VSKARLIYFAVFAVLIVTALLPALQLWPDGPHEGGEI* |
Ga0137376_103342992 | 3300012208 | Vadose Zone Soil | MSRARLIYFVVFAVLIATALLPALQFFPGGPHDGAE* |
Ga0150985_1088346552 | 3300012212 | Avena Fatua Rhizosphere | VSKARLVYFLVFALLIATALLPALQFFPDGPHEGGEI* |
Ga0150985_1096325391 | 3300012212 | Avena Fatua Rhizosphere | MSKGRLIYFAVFAVLVTMALLPALAFLPLGGHEGSDF* |
Ga0150985_1143891182 | 3300012212 | Avena Fatua Rhizosphere | DSVSKARVIYFAVFAILIAMALLPAMQFWPFGPHEGSDF* |
Ga0150985_1188616202 | 3300012212 | Avena Fatua Rhizosphere | MSKGRLIYFAVFAVLVAMALLPALAFLPLGGHEGSDF* |
Ga0150985_1195105161 | 3300012212 | Avena Fatua Rhizosphere | VTNVSKARLIYFAVFAILIVTALLPALYLWPDGPHDGSQI* |
Ga0137372_110671722 | 3300012350 | Vadose Zone Soil | MSKARLIYFAVFAILIATCSLPALSFSPFGMHDGGEI* |
Ga0137367_106204372 | 3300012353 | Vadose Zone Soil | MKGGVHVSKARLIYFAVFAIIIVTALLPALSLWPEGQHDGADF* |
Ga0137366_105766522 | 3300012354 | Vadose Zone Soil | VSKARLIYFAVFAILIFSALLPAFFLLVDGSHDGNEI* |
Ga0137369_104493612 | 3300012355 | Vadose Zone Soil | VSKARLIYFALFAILIATAFLPAINLWPDGPHDGSSF* |
Ga0137371_100043966 | 3300012356 | Vadose Zone Soil | VTTVSKARLIYFAIFAILIVTALLPALSFWPDGPHDGAEI* |
Ga0137384_102490412 | 3300012357 | Vadose Zone Soil | MSKARLIYFAVFAILIATALLPALQFLPDGMHDGGEI* |
Ga0137368_101096903 | 3300012358 | Vadose Zone Soil | VSKARLIYFAVFAILIATALLPALSLWPDGPHEGGEI* |
Ga0137375_101680973 | 3300012360 | Vadose Zone Soil | VTKARLIYFAVFAILIASALLPALNLWPDGPSDGAEI* |
Ga0134044_12977072 | 3300012395 | Grasslands Soil | LSKARLIYFAVFALLIVLALLPAMQFWPEGPHEGGSI* |
Ga0150984_1014308512 | 3300012469 | Avena Fatua Rhizosphere | VLRARVIYFAVFAILIGMALLPAMQFWPFGPHEGSDF* |
Ga0150984_1022028291 | 3300012469 | Avena Fatua Rhizosphere | MSKARLIYFLVFAILIATALLPALSFWPEGPRDGAQI* |
Ga0150984_1198037232 | 3300012469 | Avena Fatua Rhizosphere | VSKARLIYVAIIAILIAMAFLPALQLFPLGPHDGGRF* |
Ga0137397_112866361 | 3300012685 | Vadose Zone Soil | KGGESVSKARLIYFAVFAIIIVTALLPALSLWPDGPHDGAEI* |
Ga0157302_105125922 | 3300012915 | Soil | VSKARLIYLAVFAVLIALALLPAMAFAPLGAHEGGSI |
Ga0137394_100786503 | 3300012922 | Vadose Zone Soil | MSRARLIYFAVFAVLVATALLPALQFFPGGPHDGAE* |
Ga0137394_110042652 | 3300012922 | Vadose Zone Soil | VSKARIIYFAVFAILIVTALLPALSFWPDGPHDGAEI* |
Ga0137404_100588432 | 3300012929 | Vadose Zone Soil | VTTVSKARLIYFAVFAILIVTALLPALSLLPDGPHDGADV* |
Ga0162651_1000088942 | 3300012938 | Soil | GDSVSKARLIYVAVFALLIAMALLPALQFFPLGPHDGARF* |
Ga0162651_1000141742 | 3300012938 | Soil | VSKARLIYFTVFAILIAAALLPALAFLPLGGHDGAEI* |
Ga0137410_102464981 | 3300012944 | Vadose Zone Soil | VSKARIIYFAIFAILIVTALLPALSFWPDGPHDGAEI* |
Ga0126375_108415201 | 3300012948 | Tropical Forest Soil | VSKARLIYLAVFAVLIALALLPAMAFAPLGAHEGGSI* |
Ga0164303_100112944 | 3300012957 | Soil | MSKARLIYFAVFAVLIGVALLPALSLWPDGSHDGHEI* |
Ga0164303_109999342 | 3300012957 | Soil | SRARLIYFAVFSILIANALLPALHFWPEGPHDGAD* |
Ga0164299_116486842 | 3300012958 | Soil | LSKARVIYFAVFAVLIALALLPALQFWPDGAHEGSGI* |
Ga0164301_112718262 | 3300012960 | Soil | MSRARLIYFAVFAVIIVTALLPALAFLPDGPHDGAEL* |
Ga0134077_104394382 | 3300012972 | Grasslands Soil | VSKARLIYFAVFAIIIVTAILPALSLWPDGPHDGAEI* |
Ga0120155_10094524 | 3300013768 | Permafrost | MSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGHEI* |
Ga0120109_10036005 | 3300014052 | Permafrost | MSRARLIYFAVFAILIATALLPALQFLPDGMHDGGEI* |
Ga0120149_12358241 | 3300014058 | Permafrost | KGGDSMSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGHEI* |
Ga0134075_103994811 | 3300014154 | Grasslands Soil | KGGESVSKARLIYFGVFAIIIVTALLPALSLWPDGPHDGAEI* |
Ga0134078_103075072 | 3300014157 | Grasslands Soil | VTTVSKARIIYFAVFAILIVTALLPELTFWPDGPHDGAEI* |
Ga0182001_103586362 | 3300014488 | Soil | VSKARLTYFLVFAILIGTALLPALWIFGDGPHEGGEI* |
Ga0120170_11078751 | 3300014823 | Permafrost | VSKAQLIYFAVFAIIIATALLPALLQILPDGMHDGGEI* |
Ga0167629_10677242 | 3300015209 | Glacier Forefield Soil | MSRVRLIYFAVFAILIATALLPALAFLSVGMHDGGEI* |
Ga0137418_104542952 | 3300015241 | Vadose Zone Soil | MSRARLIYFAVFAVLIATALLPALLQFLPDGPHDGAEL* |
Ga0132258_1005262311 | 3300015371 | Arabidopsis Rhizosphere | VTKARLIYLAVLAVLIASALLPALQLWPDGPSDGAEI* |
Ga0132258_133458862 | 3300015371 | Arabidopsis Rhizosphere | LTKARLIYVAVFAILVAMALLPALGFLPLGGHEGSDF* |
Ga0187776_100491792 | 3300017966 | Tropical Peatland | VTRLTKARLIYVAVFAILIAVALLPALAFLPCGGHEGSDF |
Ga0184610_12064642 | 3300017997 | Groundwater Sediment | MRGGDYVTKARLIYFAVFAVLIASALLPALSFWPDGPSDGAEI |
Ga0184610_12081102 | 3300017997 | Groundwater Sediment | VSKARLIYFAVFAILIAMALLPAMQFWPYGPHEGGEI |
Ga0184605_100007312 | 3300018027 | Groundwater Sediment | VTTVSKARLIYFAVFAIIIVTALLPALSLWPAGPHDGAE |
Ga0184605_100262912 | 3300018027 | Groundwater Sediment | VTTVSKARLIYFAVFAIIIVTALLPALSLWPEGPHDGAEI |
Ga0184605_100849392 | 3300018027 | Groundwater Sediment | VSKARLIYFAVFAILIAMALLPAMQFWPLGPHEGGEI |
Ga0184605_101510683 | 3300018027 | Groundwater Sediment | MSRARLIYFAVFAILIATALLPALSFSPFGMHDGGEI |
Ga0184605_104077081 | 3300018027 | Groundwater Sediment | VSKARLIYFAVFAIIIATALLPALSLWPEGPHDGAEI |
Ga0184608_100018433 | 3300018028 | Groundwater Sediment | VSKARLMYFAVFAILIAAALLPALAFLPLGAHDGAEI |
Ga0184608_102363672 | 3300018028 | Groundwater Sediment | MSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGHEI |
Ga0184623_100963681 | 3300018056 | Groundwater Sediment | MKGGDYVTKARLIYFAVFATLIVSALLPALSLLPDGPSDGAEI |
Ga0184619_100150772 | 3300018061 | Groundwater Sediment | MSRARLIYFAVFAVLIATALLPALQFFPAGPHDGAD |
Ga0184618_100589183 | 3300018071 | Groundwater Sediment | MSRARLIYFAVFAVLIGAALLPALSLWADGSHDGHEI |
Ga0184618_100800562 | 3300018071 | Groundwater Sediment | VTTVSKARLIYFAVFAIIIVTALLPALSLWPDGPHDGAEI |
Ga0184640_103080921 | 3300018074 | Groundwater Sediment | GDLVSKARMIYFAVSAILLATALLPALNFWPDGPHDGAEI |
Ga0184625_100361444 | 3300018081 | Groundwater Sediment | VSKARLIYFTVFAILIAAALLPALAFLPLGGHDGAEI |
Ga0066667_100417934 | 3300018433 | Grasslands Soil | MKGGVHVSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEI |
Ga0066667_102319491 | 3300018433 | Grasslands Soil | VTTVSKARIIYFAVFAILIVTALLPALAFLPDGPHDGAEI |
Ga0066667_106878672 | 3300018433 | Grasslands Soil | MKGGVHMSKARFIYIAVFTVLLVTALLPALAFLPEGMHDGGQI |
Ga0066667_109537032 | 3300018433 | Grasslands Soil | MSKGRLIYLAVFAVLVTLALLPALAFLPLGGHEGSDF |
Ga0066667_116130662 | 3300018433 | Grasslands Soil | LSKARLIYFAVFAVLIALALLPAIQFWPEGPHEGN |
Ga0066662_105750223 | 3300018468 | Grasslands Soil | VTTVSKARLIYFAVFAIIIVTALLPALSFWPDGPHDGSEI |
Ga0066662_109701102 | 3300018468 | Grasslands Soil | VHVSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEL |
Ga0066669_101281892 | 3300018482 | Grasslands Soil | VTTVSKARIIYFAVFAILIVTALLPALTFWPDGPHDGAEI |
Ga0066669_106231752 | 3300018482 | Grasslands Soil | LSKARLIYFAVFAVLIALALLPAIQFWPEGPHEGNGV |
Ga0066669_108213002 | 3300018482 | Grasslands Soil | VSKARLIYVAVFAILLAMALLPAFAFLPLGPHDGADL |
Ga0066669_116432301 | 3300018482 | Grasslands Soil | MKGGVPVSKARLIYITVFVVLVVTALLPALACLPEGMHDGRQI |
Ga0184643_12843852 | 3300019255 | Groundwater Sediment | VTTVSKARLIYFAVFAIIIATALLPALSLWPEGPHDGAEI |
Ga0184642_11384501 | 3300019279 | Groundwater Sediment | EVTTVSKARLIYFAVFAIIIVTALLPALSLWPAGPHDGAE |
Ga0184642_17018622 | 3300019279 | Groundwater Sediment | MSRARLIYFAVFAILIAAALLPALSLWPGGPHDGAEI |
Ga0193700_10588492 | 3300019873 | Soil | MSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGNEI |
Ga0193727_10467652 | 3300019886 | Soil | VSKARLMYFAVFAILIAAALLPAFAFLPLGGHDGAEI |
Ga0193729_1000002200 | 3300019887 | Soil | MSRARLIYFAVFAIIIATALLPALLQILPDGMHDGGEI |
Ga0193731_11125302 | 3300020001 | Soil | TVSKARLIYFAVFAIIIATALLPALSLWPEGPHDGAEI |
Ga0193732_10839351 | 3300020012 | Soil | VSKARLMYFAVFAILIAAALLPALAFLPLGGHDGA |
Ga0197907_102345342 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKARLIYFAVFAVLIALALLPALQFWPEGPHEGSGI |
Ga0210378_101280821 | 3300021073 | Groundwater Sediment | MRGGDYVTKARLIYFAVFAALIAFALLPALSFWPDGPSDGAEI |
Ga0193699_100232281 | 3300021363 | Soil | DHVSKARLMYFAVFAILIAAALLPAFAFLPLGGHDGAEI |
Ga0193695_10078032 | 3300021418 | Soil | MSKARLIYFAVFAILVATALLPALSFLPFGMHDGAD |
Ga0193695_10393123 | 3300021418 | Soil | VSKARLIYFAVFAIIIVTALLPALSLWPEGPHDGAEI |
Ga0182009_101987502 | 3300021445 | Soil | LSKARLIYFAVFVVLIVLALLPALQVWPEGPHEGAGV |
Ga0126371_105655482 | 3300021560 | Tropical Forest Soil | VTKARLIYVAVFAILIAMALLPALGRIPLGAHEGGEL |
Ga0222623_101138382 | 3300022694 | Groundwater Sediment | MSRARLIYFAVFAILIATALLPALHFWPEGPHDGADV |
Ga0137417_14659301 | 3300024330 | Vadose Zone Soil | VSRARLIYFAVFAIIIVSALLPALSLWPEGPHDGAEI |
Ga0207684_100336262 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKARLIYFVVLAVLIASALLPALQFLPVGPHDGHEI |
Ga0207700_112423302 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKARLMYFAVFAILIAAAMLPALARMPLGAHDGGEI |
Ga0207690_111673891 | 3300025932 | Corn Rhizosphere | VTKARVIYLAVLAVLIASALLPALQLWPDGPSDGAEI |
Ga0207686_102882592 | 3300025934 | Miscanthus Rhizosphere | MSKARLIYFAVFAVLIGAALLPALSLWPDGSHDGHEI |
Ga0209234_10544092 | 3300026295 | Grasslands Soil | VTTVSKARIIYFAIFAILIVTALLPALSFWPDGPHDGAEI |
Ga0209238_10709332 | 3300026301 | Grasslands Soil | VTTVSKARIIYFAIFAILIVTAVLPALSFWPDGPHDGAEI |
Ga0209154_10324922 | 3300026317 | Soil | MEGGVHVSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEL |
Ga0209473_11599152 | 3300026330 | Soil | LLVSKARLIYFAIFAILIASALMPALVRFWPDGPHDGGEL |
Ga0257164_10596671 | 3300026497 | Soil | VTTVSKARLIYFAVFAILVVTALLPALSLWPDGPHDGAEI |
Ga0209806_10793753 | 3300026529 | Soil | VSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEL |
Ga0209807_11935352 | 3300026530 | Soil | MEGGVHVSKARLIYIAVFVVLIVTALLPALAFLPDGMHDGGEI |
Ga0209058_11256483 | 3300026536 | Soil | MSKARLIYFAVFAILIATALLPALSFSPFGMHDGGEI |
Ga0209056_106426181 | 3300026538 | Soil | VSKARLIYLAVFVVLIVTALLPALAFVPCGMHDGGEI |
Ga0209805_10841182 | 3300026542 | Soil | VHVSKARLIYFAIFAILIASALMPALVRFWPYGPHDGGEI |
Ga0209156_102316661 | 3300026547 | Soil | VIRLSKARLIYFAVFAILIAFALLPALVLFGMHDGSDF |
Ga0209474_101030463 | 3300026550 | Soil | VSKARLIYFAIFAILIASALMPALVRFWPDGPHDGGEL |
Ga0209577_100154274 | 3300026552 | Soil | VSKARLIYFAIFAILIASALMPALVRFWPYGPHDGGEI |
Ga0209577_105280972 | 3300026552 | Soil | VSKARLIYFAVFAIMFAAAILPVLSLLPDGPHEGGEF |
Ga0209887_10059993 | 3300027561 | Groundwater Sand | VSKARLIYLAVFAILLATALLPIGSMFLDGPHDGAEI |
Ga0209735_10094061 | 3300027562 | Forest Soil | MSRARLIYFAVFSILIATALLPALHFWPEGPHDGAEL |
Ga0208991_11148022 | 3300027681 | Forest Soil | VSKARLIYFAVFAIIIVTALLPALGLWPDGPHDGAEI |
Ga0208989_102790212 | 3300027738 | Forest Soil | VTSVSKARLIYFAVFAIIIVTALLPALGLWPDGPHDGAEI |
Ga0209073_101708281 | 3300027765 | Agricultural Soil | VSKARLIYFAVFAVLIALALLPALQFWPEGPHEGSGI |
Ga0209073_105204142 | 3300027765 | Agricultural Soil | VSKARLIYFAVFAILIAMALLPAMQFWPFGPHEGSDF |
Ga0209074_105306692 | 3300027787 | Agricultural Soil | VSKARLIYFAVFAMLIAMALLPAMQFWPFGPHEGSDF |
Ga0209180_108091811 | 3300027846 | Vadose Zone Soil | VSKARLIYFAVFAILIVTALLPALSLWPEGPHDGAEI |
Ga0209590_100022786 | 3300027882 | Vadose Zone Soil | MSKARLIYFAVFAILIATALLPALSYSPFGMHDGGEI |
Ga0209590_100027154 | 3300027882 | Vadose Zone Soil | VSKARLIYFAVFAILLATALLPALQLWPDGPHDGTEI |
Ga0209526_100297602 | 3300028047 | Forest Soil | MSRARVIYFAVFVILIATALLPALNLWPEGPHDGAQI |
Ga0137415_101148992 | 3300028536 | Vadose Zone Soil | VTTVSKARIIYFAVFAILIVTALLPALSFWPDGPHDGAEI |
Ga0307276_100025384 | 3300028705 | Soil | VTKARLIYLAVFAILIATALLPALHFWPEGPHEGGEI |
Ga0307276_100171063 | 3300028705 | Soil | MSRARLIYFAVFAVLIGAALLPALSLWPEGSHDGHEI |
Ga0307303_100148042 | 3300028713 | Soil | VSKARLIYFAVFAILIATALLPAMHLWPDGPHEGGEI |
Ga0307298_100790802 | 3300028717 | Soil | MSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGHE |
Ga0307301_100514441 | 3300028719 | Soil | KGGDHVSKARLMYFAVFAILIAAALLPALAFLPLGAHDGAEI |
Ga0307301_102233101 | 3300028719 | Soil | VSKARLIYFAVFAMMFVFALLPALHFMPGGPHDGAEI |
Ga0307316_102572302 | 3300028755 | Soil | MSRARLIYFAIFSILIATALLPALHFWPEGPHDGAEL |
Ga0307316_102951932 | 3300028755 | Soil | MSKARLIYFAVFAVLIGVALLPALSLWPEGGHDGHEI |
Ga0307280_103249471 | 3300028768 | Soil | KGGDSMSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGNEI |
Ga0307290_100506331 | 3300028791 | Soil | DPVSKARLIYFAVFAILIAMALLPAMQFWPLGPHEGGEI |
Ga0307299_100521172 | 3300028793 | Soil | VSKARLIYFAVFAILIAMALLPAMQFWPLGPHEGG |
Ga0307284_102516272 | 3300028799 | Soil | AAKGGVHVSKARLIYFVVFAILVATALLPAMHLFPDGPHDGGQF |
Ga0307503_101473772 | 3300028802 | Soil | MSRARLIYFAVFSILIATALLPALHFWPDGPHDGAD |
Ga0307305_100587872 | 3300028807 | Soil | VSKARLIYFVVFAILVATALLPAMHLFPDGPHDGGQF |
Ga0307294_102588481 | 3300028810 | Soil | DHVSKARLMYFAVFAILIAAALLPALAFLPLGAHDGAEI |
Ga0307292_102282012 | 3300028811 | Soil | VSKARLIYFAVFAILIATALLPALHLWPEGPHEGGEI |
Ga0307302_100208762 | 3300028814 | Soil | MSRARLIYFAVFAVLIATALLPALQFFPGGPHDGAE |
Ga0307296_107500211 | 3300028819 | Soil | MSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGH |
Ga0307312_111265642 | 3300028828 | Soil | LVSKARMIYFAVSAILLATALLPALNFWPDGPHDGAEI |
Ga0307278_100130224 | 3300028878 | Soil | MSKARLIYFAVFAVLIATALLPALQLFPEGPHDGAE |
Ga0307277_102289132 | 3300028881 | Soil | VSKARLIYFAVFAILIATALLPALHLWPDGPHEGGEV |
Ga0307277_104214841 | 3300028881 | Soil | GDPVSKARLIYFAVFAILIAMALLPAMQFWPLGPHEGGEI |
Ga0307308_102844341 | 3300028884 | Soil | KGGDSMSRARLIYFAVFAVLIGAALLPALSLWPEGSHDGHEI |
Ga0307308_103674072 | 3300028884 | Soil | VTHVSKARLIYFAIFAIIIATALLPALHLWPDGPHEGGEI |
Ga0308178_11545152 | 3300030990 | Soil | VSKARLIYFAVFAILIAMALLPAMQFSPLGPHEGGEI |
Ga0308190_11794761 | 3300030993 | Soil | HLSKGGDSMSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGHEI |
Ga0308201_101879471 | 3300031091 | Soil | VSKARLIYFVVFAILVATALLPALHLFPDGPHDGGQ |
Ga0308201_103148562 | 3300031091 | Soil | LLTQLSKGGDSMSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGNEI |
Ga0308204_102746031 | 3300031092 | Soil | QLSKGGDSMSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGHEI |
Ga0308197_104334452 | 3300031093 | Soil | SKGGDSMSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGNEI |
Ga0308199_10426391 | 3300031094 | Soil | VSKARLIYFAVFAIIIVTALLPALSLWPDGPHDGAEI |
Ga0308182_10065722 | 3300031125 | Soil | MSRARLIYFAVFAILIAAALLPALSLWPEGPHDGAEI |
Ga0308194_100682212 | 3300031421 | Soil | MSKARLIYFAVFAILIATALLPALSFSPFGMHDGAD |
Ga0308194_100990631 | 3300031421 | Soil | VSKARLIYFAVFAIIIVTALLPALNLWPDGPHDGAEI |
Ga0308194_101034902 | 3300031421 | Soil | VSRARLIYFAVLAVLIATAVLPALSLWPDGPHDGA |
Ga0308194_101348822 | 3300031421 | Soil | MSKARLIYFAVIAILIAATLLPALAIWPLGASDGAEI |
Ga0308194_102204522 | 3300031421 | Soil | VSKAQLIYFAVFAIIIATALLPALAFLPDGMGDGAEI |
Ga0308194_103800332 | 3300031421 | Soil | MKGGVHVSKARLIYFAVFALLFAGFILPALPDGMHDGGQI |
Ga0308194_103834482 | 3300031421 | Soil | MSRARLIYFAVFAIIIATALLPAMHMWPGGPHDGAQI |
Ga0308175_1020886822 | 3300031938 | Soil | MSKGRLIYFAIFAVLLAMALLPALAFLPLGGHEGSDF |
Ga0307471_1004628082 | 3300032180 | Hardwood Forest Soil | VTTVSKARLIYFAVVAIIIVTALLPALSFWPDGPHDGAEI |
Ga0372946_0370744_124_237 | 3300034384 | Soil | MSKARLIYLAVFSVLILSAALPALSLWLDGPHDGAQI |
Ga0370548_139843_405_515 | 3300034644 | Soil | MSRARLIYFAVLAVLIATAVLPALSLWPDGPHDGAEI |
Ga0370548_144462_381_509 | 3300034644 | Soil | KGGDSMSRARLIYFAVFAVLIGAALLPALSLWPDGSHDGHEI |
⦗Top⦘ |