Basic Information | |
---|---|
Family ID | F009605 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 315 |
Average Sequence Length | 39 residues |
Representative Sequence | MKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN |
Number of Associated Samples | 136 |
Number of Associated Scaffolds | 315 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 91.03 % |
% of genes near scaffold ends (potentially truncated) | 12.06 % |
% of genes from short scaffolds (< 2000 bps) | 61.90 % |
Associated GOLD sequencing projects | 117 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (59.683 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (28.571 % of family members) |
Environment Ontology (ENVO) | Unclassified (73.016 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (85.079 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 315 Family Scaffolds |
---|---|---|
PF12697 | Abhydrolase_6 | 9.52 |
PF07883 | Cupin_2 | 3.17 |
PF00487 | FA_desaturase | 2.86 |
PF00565 | SNase | 2.54 |
PF06094 | GGACT | 1.27 |
PF06941 | NT5C | 0.95 |
PF13759 | 2OG-FeII_Oxy_5 | 0.95 |
PF01223 | Endonuclease_NS | 0.95 |
PF02777 | Sod_Fe_C | 0.95 |
PF07819 | PGAP1 | 0.95 |
PF12708 | Pectate_lyase_3 | 0.95 |
PF00534 | Glycos_transf_1 | 0.63 |
PF12695 | Abhydrolase_5 | 0.63 |
PF00155 | Aminotran_1_2 | 0.63 |
PF12705 | PDDEXK_1 | 0.63 |
PF00535 | Glycos_transf_2 | 0.63 |
PF01521 | Fe-S_biosyn | 0.63 |
PF03477 | ATP-cone | 0.63 |
PF00268 | Ribonuc_red_sm | 0.63 |
PF00574 | CLP_protease | 0.63 |
PF03851 | UvdE | 0.63 |
PF13772 | AIG2_2 | 0.63 |
PF03401 | TctC | 0.32 |
PF00550 | PP-binding | 0.32 |
PF00081 | Sod_Fe_N | 0.32 |
PF01126 | Heme_oxygenase | 0.32 |
PF01177 | Asp_Glu_race | 0.32 |
PF04055 | Radical_SAM | 0.32 |
PF07691 | PA14 | 0.32 |
PF00383 | dCMP_cyt_deam_1 | 0.32 |
PF01909 | NTP_transf_2 | 0.32 |
PF01471 | PG_binding_1 | 0.32 |
PF06347 | SH3_4 | 0.32 |
PF06821 | Ser_hydrolase | 0.32 |
PF00004 | AAA | 0.32 |
PF13394 | Fer4_14 | 0.32 |
PF13673 | Acetyltransf_10 | 0.32 |
PF13884 | Peptidase_S74 | 0.32 |
PF03741 | TerC | 0.32 |
PF03783 | CsgG | 0.32 |
PF02678 | Pirin | 0.32 |
PF16861 | Carbam_trans_C | 0.32 |
PF10118 | Metal_hydrol | 0.32 |
PF05996 | Fe_bilin_red | 0.32 |
PF10263 | SprT-like | 0.32 |
PF05637 | Glyco_transf_34 | 0.32 |
PF10528 | GLEYA | 0.32 |
PF03061 | 4HBT | 0.32 |
COG ID | Name | Functional Category | % Frequency in 315 Family Scaffolds |
---|---|---|---|
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 2.86 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 2.86 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.27 |
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.27 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.27 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.95 |
COG1075 | Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold | Lipid transport and metabolism [I] | 0.95 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.95 |
COG2267 | Lysophospholipase, alpha-beta hydrolase superfamily | Lipid transport and metabolism [I] | 0.95 |
COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.95 |
COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.63 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.63 |
COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.63 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.63 |
COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.32 |
COG1462 | Curli biogenesis system outer membrane secretion channel CsgG | Cell wall/membrane/envelope biogenesis [M] | 0.32 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.32 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.32 |
COG3230 | Heme oxygenase | Inorganic ion transport and metabolism [P] | 0.32 |
COG3545 | Predicted esterase of the alpha/beta hydrolase fold | General function prediction only [R] | 0.32 |
COG5398 | Heme oxygenase | Coenzyme transport and metabolism [H] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.11 % |
Unclassified | root | N/A | 28.89 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000756|JGI12421J11937_10038011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1663 | Open in IMG/M |
3300000756|JGI12421J11937_10147175 | Not Available | 586 | Open in IMG/M |
3300000756|JGI12421J11937_10171850 | Not Available | 521 | Open in IMG/M |
3300000882|FwDRAFT_10292354 | Not Available | 529 | Open in IMG/M |
3300002139|M3t2BS2_1876187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300002142|M2t2FKB2_1050267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300002408|B570J29032_109599896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
3300002835|B570J40625_100078030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4314 | Open in IMG/M |
3300002835|B570J40625_100242345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1891 | Open in IMG/M |
3300002835|B570J40625_100586211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300002835|B570J40625_100659086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
3300002835|B570J40625_100912502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
3300003277|JGI25908J49247_10000491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12074 | Open in IMG/M |
3300003277|JGI25908J49247_10000658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10625 | Open in IMG/M |
3300003277|JGI25908J49247_10002037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6482 | Open in IMG/M |
3300003277|JGI25908J49247_10002163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6279 | Open in IMG/M |
3300003277|JGI25908J49247_10002972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5413 | Open in IMG/M |
3300003277|JGI25908J49247_10009730 | Not Available | 3001 | Open in IMG/M |
3300003277|JGI25908J49247_10011216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2779 | Open in IMG/M |
3300003277|JGI25908J49247_10015611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2318 | Open in IMG/M |
3300003277|JGI25908J49247_10023487 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1817 | Open in IMG/M |
3300003277|JGI25908J49247_10057942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
3300003277|JGI25908J49247_10086851 | Not Available | 765 | Open in IMG/M |
3300003277|JGI25908J49247_10153294 | Not Available | 537 | Open in IMG/M |
3300003277|JGI25908J49247_10157981 | Not Available | 527 | Open in IMG/M |
3300003388|JGI25910J50241_10002984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6155 | Open in IMG/M |
3300003388|JGI25910J50241_10015670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2687 | Open in IMG/M |
3300003388|JGI25910J50241_10166492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300003394|JGI25907J50239_1001054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6610 | Open in IMG/M |
3300003411|JGI25911J50253_10009327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3717 | Open in IMG/M |
3300003497|JGI25925J51416_10077065 | Not Available | 828 | Open in IMG/M |
3300003783|Ga0007850_1000110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8550 | Open in IMG/M |
3300003986|Ga0063233_10093931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
3300004112|Ga0065166_10230668 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300004124|Ga0066178_10067680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300004763|Ga0007746_1049309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1777 | Open in IMG/M |
3300004769|Ga0007748_11426944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300004810|Ga0007757_11470727 | Not Available | 510 | Open in IMG/M |
3300005415|Ga0007743_1284757 | Not Available | 680 | Open in IMG/M |
3300005415|Ga0007743_1305973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300005517|Ga0070374_10011903 | Not Available | 4279 | Open in IMG/M |
3300005517|Ga0070374_10013403 | All Organisms → cellular organisms → Bacteria | 4062 | Open in IMG/M |
3300005517|Ga0070374_10013623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4033 | Open in IMG/M |
3300005517|Ga0070374_10025772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3014 | Open in IMG/M |
3300005517|Ga0070374_10161052 | Not Available | 1163 | Open in IMG/M |
3300005517|Ga0070374_10185352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1074 | Open in IMG/M |
3300005517|Ga0070374_10699900 | Not Available | 500 | Open in IMG/M |
3300005527|Ga0068876_10021630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4065 | Open in IMG/M |
3300005581|Ga0049081_10000329 | Not Available | 18375 | Open in IMG/M |
3300005581|Ga0049081_10011243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3383 | Open in IMG/M |
3300005581|Ga0049081_10051780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1554 | Open in IMG/M |
3300005582|Ga0049080_10019091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2392 | Open in IMG/M |
3300005582|Ga0049080_10026662 | Not Available | 2018 | Open in IMG/M |
3300005582|Ga0049080_10042636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1574 | Open in IMG/M |
3300005582|Ga0049080_10068228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1221 | Open in IMG/M |
3300005582|Ga0049080_10099649 | Not Available | 988 | Open in IMG/M |
3300005583|Ga0049085_10149371 | Not Available | 789 | Open in IMG/M |
3300005583|Ga0049085_10194376 | Not Available | 675 | Open in IMG/M |
3300005584|Ga0049082_10071647 | Not Available | 1217 | Open in IMG/M |
3300005662|Ga0078894_10016774 | Not Available | 5862 | Open in IMG/M |
3300005662|Ga0078894_10017187 | All Organisms → cellular organisms → Bacteria | 5791 | Open in IMG/M |
3300005662|Ga0078894_10028381 | All Organisms → cellular organisms → Bacteria | 4594 | Open in IMG/M |
3300005662|Ga0078894_10102754 | Not Available | 2525 | Open in IMG/M |
3300005662|Ga0078894_10163968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2002 | Open in IMG/M |
3300005662|Ga0078894_10263656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1562 | Open in IMG/M |
3300005662|Ga0078894_10276024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1525 | Open in IMG/M |
3300005662|Ga0078894_10280447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1512 | Open in IMG/M |
3300005662|Ga0078894_10328676 | Not Available | 1386 | Open in IMG/M |
3300005662|Ga0078894_10381364 | Not Available | 1275 | Open in IMG/M |
3300005662|Ga0078894_10675602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
3300005662|Ga0078894_10684420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300005662|Ga0078894_11149287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300005941|Ga0070743_10119785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
3300006484|Ga0070744_10033004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1529 | Open in IMG/M |
3300007545|Ga0102873_1213702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300007548|Ga0102877_1178751 | Not Available | 598 | Open in IMG/M |
3300007551|Ga0102881_1121518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300007559|Ga0102828_1035607 | Not Available | 1129 | Open in IMG/M |
3300007597|Ga0102919_1132611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 784 | Open in IMG/M |
3300007630|Ga0102903_1128346 | Not Available | 697 | Open in IMG/M |
3300007642|Ga0102876_1060020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
3300008111|Ga0114344_1001562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13521 | Open in IMG/M |
3300008111|Ga0114344_1017914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2886 | Open in IMG/M |
3300008113|Ga0114346_1044394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2252 | Open in IMG/M |
3300008113|Ga0114346_1281707 | Not Available | 589 | Open in IMG/M |
3300008119|Ga0114354_1079999 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1335 | Open in IMG/M |
3300008964|Ga0102889_1231482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 535 | Open in IMG/M |
3300008999|Ga0102816_1184803 | Not Available | 650 | Open in IMG/M |
3300009026|Ga0102829_1319771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300009068|Ga0114973_10144892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1323 | Open in IMG/M |
3300009068|Ga0114973_10353874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
3300009068|Ga0114973_10723282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300009151|Ga0114962_10002080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16995 | Open in IMG/M |
3300009151|Ga0114962_10005618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9795 | Open in IMG/M |
3300009151|Ga0114962_10026067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4064 | Open in IMG/M |
3300009151|Ga0114962_10096364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1849 | Open in IMG/M |
3300009151|Ga0114962_10105103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1753 | Open in IMG/M |
3300009151|Ga0114962_10561679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 596 | Open in IMG/M |
3300009151|Ga0114962_10726839 | Not Available | 506 | Open in IMG/M |
3300009155|Ga0114968_10000035 | Not Available | 122003 | Open in IMG/M |
3300009155|Ga0114968_10025088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4057 | Open in IMG/M |
3300009155|Ga0114968_10095723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1822 | Open in IMG/M |
3300009158|Ga0114977_10010232 | Not Available | 5944 | Open in IMG/M |
3300009158|Ga0114977_10697942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300009159|Ga0114978_10017338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5380 | Open in IMG/M |
3300009159|Ga0114978_10027222 | All Organisms → cellular organisms → Bacteria | 4123 | Open in IMG/M |
3300009159|Ga0114978_10101851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1896 | Open in IMG/M |
3300009159|Ga0114978_10151515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1493 | Open in IMG/M |
3300009159|Ga0114978_10270648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1049 | Open in IMG/M |
3300009159|Ga0114978_10277621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
3300009159|Ga0114978_10390365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300009159|Ga0114978_10530510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300009160|Ga0114981_10131529 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1383 | Open in IMG/M |
3300009160|Ga0114981_10437904 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300009164|Ga0114975_10000393 | Not Available | 32931 | Open in IMG/M |
3300009164|Ga0114975_10000446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 31118 | Open in IMG/M |
3300009164|Ga0114975_10000499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 29659 | Open in IMG/M |
3300009164|Ga0114975_10002597 | Not Available | 12319 | Open in IMG/M |
3300009164|Ga0114975_10010325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5828 | Open in IMG/M |
3300009164|Ga0114975_10024111 | All Organisms → cellular organisms → Bacteria | 3671 | Open in IMG/M |
3300009164|Ga0114975_10037579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2882 | Open in IMG/M |
3300009164|Ga0114975_10048268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2513 | Open in IMG/M |
3300009164|Ga0114975_10123465 | All Organisms → Viruses → Predicted Viral | 1491 | Open in IMG/M |
3300009164|Ga0114975_10174653 | All Organisms → Viruses → Predicted Viral | 1221 | Open in IMG/M |
3300009164|Ga0114975_10417974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300009164|Ga0114975_10524071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 637 | Open in IMG/M |
3300009164|Ga0114975_10573506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300009164|Ga0114975_10747622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300009164|Ga0114975_10765083 | Not Available | 508 | Open in IMG/M |
3300009182|Ga0114959_10014264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5298 | Open in IMG/M |
3300009182|Ga0114959_10167108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
3300009182|Ga0114959_10352937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300009183|Ga0114974_10468599 | Not Available | 711 | Open in IMG/M |
3300009187|Ga0114972_10595672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300009419|Ga0114982_1003161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6863 | Open in IMG/M |
3300009419|Ga0114982_1004396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5592 | Open in IMG/M |
3300009419|Ga0114982_1033308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1666 | Open in IMG/M |
3300009419|Ga0114982_1144152 | Not Available | 735 | Open in IMG/M |
3300010157|Ga0114964_10078644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1665 | Open in IMG/M |
3300010160|Ga0114967_10182755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1140 | Open in IMG/M |
3300010334|Ga0136644_10087773 | All Organisms → Viruses → Predicted Viral | 1947 | Open in IMG/M |
3300010885|Ga0133913_10192858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5434 | Open in IMG/M |
3300010885|Ga0133913_10772019 | Not Available | 2507 | Open in IMG/M |
3300010885|Ga0133913_10882983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2323 | Open in IMG/M |
3300010885|Ga0133913_12503324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300010885|Ga0133913_12611178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1226 | Open in IMG/M |
3300010885|Ga0133913_13205796 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
3300011010|Ga0139557_1003619 | All Organisms → Viruses → Predicted Viral | 3350 | Open in IMG/M |
3300011010|Ga0139557_1010414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1828 | Open in IMG/M |
3300011011|Ga0139556_1028893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300012352|Ga0157138_1004626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2325 | Open in IMG/M |
3300012663|Ga0157203_1000207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19749 | Open in IMG/M |
3300012663|Ga0157203_1002669 | Not Available | 3919 | Open in IMG/M |
3300012663|Ga0157203_1006511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2141 | Open in IMG/M |
3300012663|Ga0157203_1010665 | Not Available | 1520 | Open in IMG/M |
3300012663|Ga0157203_1011378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1451 | Open in IMG/M |
3300012663|Ga0157203_1014541 | Not Available | 1224 | Open in IMG/M |
3300012663|Ga0157203_1018991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1019 | Open in IMG/M |
3300012663|Ga0157203_1051644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300012665|Ga0157210_1000190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30350 | Open in IMG/M |
3300012665|Ga0157210_1000235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 26884 | Open in IMG/M |
3300012665|Ga0157210_1002548 | All Organisms → cellular organisms → Bacteria | 4639 | Open in IMG/M |
3300012665|Ga0157210_1005543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2556 | Open in IMG/M |
3300012665|Ga0157210_1007314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2096 | Open in IMG/M |
3300012665|Ga0157210_1039328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300012665|Ga0157210_1039928 | Not Available | 724 | Open in IMG/M |
3300012667|Ga0157208_10008213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1526 | Open in IMG/M |
3300013004|Ga0164293_10149705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1735 | Open in IMG/M |
3300013004|Ga0164293_10525684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
3300013005|Ga0164292_10152071 | Not Available | 1690 | Open in IMG/M |
3300013006|Ga0164294_10000156 | Not Available | 62615 | Open in IMG/M |
3300013285|Ga0136642_1001903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8563 | Open in IMG/M |
3300013285|Ga0136642_1096817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300013285|Ga0136642_1101418 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300013285|Ga0136642_1109131 | Not Available | 708 | Open in IMG/M |
3300013285|Ga0136642_1156259 | Not Available | 566 | Open in IMG/M |
3300013286|Ga0136641_1000730 | Not Available | 13915 | Open in IMG/M |
3300013286|Ga0136641_1007584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3757 | Open in IMG/M |
3300013286|Ga0136641_1033319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1545 | Open in IMG/M |
3300013372|Ga0177922_11320426 | Not Available | 592 | Open in IMG/M |
3300017761|Ga0181356_1086492 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 1035 | Open in IMG/M |
3300017778|Ga0181349_1023572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2500 | Open in IMG/M |
3300017780|Ga0181346_1302970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300017784|Ga0181348_1135021 | Not Available | 936 | Open in IMG/M |
3300019784|Ga0181359_1004201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4546 | Open in IMG/M |
3300019784|Ga0181359_1060584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1449 | Open in IMG/M |
3300020141|Ga0211732_1039183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300020141|Ga0211732_1043497 | Not Available | 1384 | Open in IMG/M |
3300020141|Ga0211732_1067323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1969 | Open in IMG/M |
3300020141|Ga0211732_1104413 | Not Available | 3499 | Open in IMG/M |
3300020141|Ga0211732_1143192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18644 | Open in IMG/M |
3300020141|Ga0211732_1250121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
3300020151|Ga0211736_10270451 | Not Available | 1806 | Open in IMG/M |
3300020151|Ga0211736_10369794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3615 | Open in IMG/M |
3300020151|Ga0211736_10411071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1143 | Open in IMG/M |
3300020151|Ga0211736_10951476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2063 | Open in IMG/M |
3300020151|Ga0211736_10986588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
3300020159|Ga0211734_10742353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2820 | Open in IMG/M |
3300020160|Ga0211733_11109289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3040 | Open in IMG/M |
3300020161|Ga0211726_10714979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300020162|Ga0211735_10986525 | Not Available | 558 | Open in IMG/M |
3300020205|Ga0211731_10262278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300020205|Ga0211731_10438098 | Not Available | 912 | Open in IMG/M |
3300020205|Ga0211731_10822917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1819 | Open in IMG/M |
3300020528|Ga0208224_1007618 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
3300020528|Ga0208224_1023980 | Not Available | 835 | Open in IMG/M |
3300020566|Ga0208222_1052631 | Not Available | 716 | Open in IMG/M |
3300020572|Ga0207909_1058959 | Not Available | 582 | Open in IMG/M |
3300021141|Ga0214163_1099822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 673 | Open in IMG/M |
3300021336|Ga0210307_1209669 | Not Available | 702 | Open in IMG/M |
3300021519|Ga0194048_10031775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2217 | Open in IMG/M |
3300021519|Ga0194048_10192790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300021956|Ga0213922_1110085 | Not Available | 549 | Open in IMG/M |
3300021963|Ga0222712_10438677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300022190|Ga0181354_1080107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1078 | Open in IMG/M |
3300022407|Ga0181351_1253101 | Not Available | 547 | Open in IMG/M |
3300022407|Ga0181351_1272155 | Not Available | 514 | Open in IMG/M |
3300022602|Ga0248169_104146 | Not Available | 15641 | Open in IMG/M |
3300024346|Ga0244775_10006029 | Not Available | 12157 | Open in IMG/M |
3300024346|Ga0244775_10078020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2834 | Open in IMG/M |
3300024346|Ga0244775_10115623 | Not Available | 2275 | Open in IMG/M |
3300024346|Ga0244775_10123448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2193 | Open in IMG/M |
3300024346|Ga0244775_10168980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1842 | Open in IMG/M |
3300024346|Ga0244775_10403193 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300024346|Ga0244775_10460133 | Not Available | 1042 | Open in IMG/M |
3300024346|Ga0244775_10718277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300024346|Ga0244775_11177292 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300024853|Ga0255252_1083315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300025358|Ga0208504_1000034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 38055 | Open in IMG/M |
3300027145|Ga0255114_1067161 | Not Available | 622 | Open in IMG/M |
3300027292|Ga0255134_1080467 | Not Available | 505 | Open in IMG/M |
3300027418|Ga0208022_1061244 | Not Available | 815 | Open in IMG/M |
3300027534|Ga0255125_1068993 | Not Available | 734 | Open in IMG/M |
3300027563|Ga0209552_1041942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1317 | Open in IMG/M |
3300027563|Ga0209552_1086546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300027586|Ga0208966_1118206 | Not Available | 718 | Open in IMG/M |
3300027586|Ga0208966_1155244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300027600|Ga0255117_1013845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1892 | Open in IMG/M |
3300027608|Ga0208974_1000045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 55066 | Open in IMG/M |
3300027608|Ga0208974_1000112 | Not Available | 35732 | Open in IMG/M |
3300027608|Ga0208974_1001112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10634 | Open in IMG/M |
3300027608|Ga0208974_1009610 | Not Available | 3173 | Open in IMG/M |
3300027621|Ga0208951_1181010 | Not Available | 535 | Open in IMG/M |
3300027631|Ga0208133_1013887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2159 | Open in IMG/M |
3300027642|Ga0209135_1099390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
3300027644|Ga0209356_1145184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300027679|Ga0209769_1018810 | Not Available | 2449 | Open in IMG/M |
3300027679|Ga0209769_1209654 | Not Available | 602 | Open in IMG/M |
3300027708|Ga0209188_1021931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3243 | Open in IMG/M |
3300027708|Ga0209188_1056282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1721 | Open in IMG/M |
3300027708|Ga0209188_1148848 | Not Available | 886 | Open in IMG/M |
3300027708|Ga0209188_1247205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300027710|Ga0209599_10007407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3576 | Open in IMG/M |
3300027710|Ga0209599_10010962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2768 | Open in IMG/M |
3300027710|Ga0209599_10053883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
3300027710|Ga0209599_10120446 | Not Available | 693 | Open in IMG/M |
3300027732|Ga0209442_1000022 | Not Available | 89871 | Open in IMG/M |
3300027732|Ga0209442_1156249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300027732|Ga0209442_1162242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300027733|Ga0209297_1097621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
3300027734|Ga0209087_1013070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4196 | Open in IMG/M |
3300027736|Ga0209190_1058766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1904 | Open in IMG/M |
3300027746|Ga0209597_1000008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 116631 | Open in IMG/M |
3300027749|Ga0209084_1000399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 40377 | Open in IMG/M |
3300027749|Ga0209084_1011102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5425 | Open in IMG/M |
3300027749|Ga0209084_1102214 | Not Available | 1261 | Open in IMG/M |
3300027756|Ga0209444_10173579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300027759|Ga0209296_1000991 | Not Available | 23109 | Open in IMG/M |
3300027759|Ga0209296_1007046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7039 | Open in IMG/M |
3300027759|Ga0209296_1007992 | Not Available | 6543 | Open in IMG/M |
3300027759|Ga0209296_1016061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4364 | Open in IMG/M |
3300027759|Ga0209296_1163830 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 986 | Open in IMG/M |
3300027759|Ga0209296_1283846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300027763|Ga0209088_10092783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1395 | Open in IMG/M |
3300027763|Ga0209088_10281583 | Not Available | 680 | Open in IMG/M |
3300027763|Ga0209088_10343272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300027769|Ga0209770_10003110 | Not Available | 8193 | Open in IMG/M |
3300027769|Ga0209770_10136370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
3300027769|Ga0209770_10316214 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300027782|Ga0209500_10066690 | Not Available | 1866 | Open in IMG/M |
3300027782|Ga0209500_10082826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1624 | Open in IMG/M |
3300027782|Ga0209500_10139257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1154 | Open in IMG/M |
3300027782|Ga0209500_10315135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300027785|Ga0209246_10018340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2613 | Open in IMG/M |
3300027797|Ga0209107_10026388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3340 | Open in IMG/M |
3300027797|Ga0209107_10526641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300027798|Ga0209353_10047503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1977 | Open in IMG/M |
3300027798|Ga0209353_10073840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1551 | Open in IMG/M |
3300027892|Ga0209550_10008041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9749 | Open in IMG/M |
3300027963|Ga0209400_1000145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 62162 | Open in IMG/M |
3300027963|Ga0209400_1009735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6157 | Open in IMG/M |
3300027963|Ga0209400_1085898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1503 | Open in IMG/M |
3300027969|Ga0209191_1001632 | Not Available | 14679 | Open in IMG/M |
3300027969|Ga0209191_1012532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4442 | Open in IMG/M |
3300027969|Ga0209191_1015450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3910 | Open in IMG/M |
3300027969|Ga0209191_1021215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3216 | Open in IMG/M |
3300027969|Ga0209191_1100052 | All Organisms → Viruses → Predicted Viral | 1237 | Open in IMG/M |
3300027969|Ga0209191_1276638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300028393|Ga0304728_1182126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300028394|Ga0304730_1004420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9216 | Open in IMG/M |
3300028394|Ga0304730_1024668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3198 | Open in IMG/M |
3300032092|Ga0315905_10023420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6260 | Open in IMG/M |
3300032092|Ga0315905_10942549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300033978|Ga0334977_0027612 | Not Available | 3223 | Open in IMG/M |
3300033992|Ga0334992_0001335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19561 | Open in IMG/M |
3300033994|Ga0334996_0303347 | Not Available | 793 | Open in IMG/M |
3300034082|Ga0335020_0027997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3112 | Open in IMG/M |
3300034082|Ga0335020_0038540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2574 | Open in IMG/M |
3300034093|Ga0335012_0080428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1841 | Open in IMG/M |
3300034102|Ga0335029_0300069 | Not Available | 1014 | Open in IMG/M |
3300034102|Ga0335029_0666560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 570 | Open in IMG/M |
3300034356|Ga0335048_0425073 | Not Available | 653 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 28.57% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.52% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.71% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 5.40% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.44% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.81% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.86% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.54% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.59% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.59% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.59% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.27% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.63% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.63% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.63% |
Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.63% |
Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 0.32% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.32% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.32% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
3300002139 | M3t2BS2 (117f) | Environmental | Open in IMG/M |
3300002142 | M2t3t2 FKB2 (115f) | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300003783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 | Environmental | Open in IMG/M |
3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004810 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005415 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021336 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024853 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
3300027292 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8d | Environmental | Open in IMG/M |
3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
3300027534 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12421J11937_100380112 | 3300000756 | Freshwater And Sediment | MKTIVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS* |
JGI12421J11937_101471753 | 3300000756 | Freshwater And Sediment | MKTILNTVWSVIVAFGEARYAASLARQGRIEESKAVYNGRA* |
JGI12421J11937_101718501 | 3300000756 | Freshwater And Sediment | MKTIVNSIWSFLEAFGQARYAASLARQGRIEESKAVYNGPA* |
FwDRAFT_102923543 | 3300000882 | Freshwater And Marine | MKTIVNAIWAFLEAFGQARAAASLARQGRIAEAKAIYGA* |
M3t2BS2_18761872 | 3300002139 | Marine | MKTILNSIWSFLEALGQARYAASLARQGRISEAKAVYK* |
M2t2FKB2_10502673 | 3300002142 | Marine | MKTILNSIWSFLEALGQARYAASLARQGRISEAKAVY |
B570J29032_1095998962 | 3300002408 | Freshwater | MNSILNSILNSIWSVLESFAQARAAAVLARQGRIEEAKAVYGN* |
B570J40625_1000780307 | 3300002835 | Freshwater | MKKIVNSIWSFLEALGQARAASILARQGRIEEAKAIYGA* |
B570J40625_1002423452 | 3300002835 | Freshwater | MKTILNSIWSFLEAFGEARYAASLARQGRTEEAKAVYGA* |
B570J40625_1005862112 | 3300002835 | Freshwater | MKTILNSIWAVLEAFGQARYAASLARQGRIAESKAVYES* |
B570J40625_1006590861 | 3300002835 | Freshwater | MKTILNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA* |
B570J40625_1009125022 | 3300002835 | Freshwater | MKTILNTIWSFLEAFGQARYAASLARQGRTEEAKAVYGS* |
JGI25908J49247_100004919 | 3300003277 | Freshwater Lake | MNSILNSIWSVLEAFGQARAAASLARQGRIDEAKAVYNGQQ* |
JGI25908J49247_1000065816 | 3300003277 | Freshwater Lake | MKTILNTIWSVLEAFGQARYAASLARQGRVEESKAVYNGRA* |
JGI25908J49247_100020379 | 3300003277 | Freshwater Lake | MKTILNSIWSVLESFAQARAAASLARQGRIDEAKAVYTN* |
JGI25908J49247_1000216312 | 3300003277 | Freshwater Lake | MKKIVNSLWSFLEALGQARAASILARQGRIEEAKAVYNGPA* |
JGI25908J49247_100029723 | 3300003277 | Freshwater Lake | MKTILNTIWSVIVAFGEARYAASLARQGRIEESKAVYNGRA* |
JGI25908J49247_100097303 | 3300003277 | Freshwater Lake | MKTITNAIWSFLEAFGQARYAASLARQGRIAESKAVYNGPA* |
JGI25908J49247_100112162 | 3300003277 | Freshwater Lake | MKTILNSIWSFLEAFGQARVAASLARQGRIEESKAVYNGPA* |
JGI25908J49247_100156115 | 3300003277 | Freshwater Lake | MKTIVNTIWLFLEAFGQARAAASLARQGRIAEAKAVYGN* |
JGI25908J49247_100234874 | 3300003277 | Freshwater Lake | MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN* |
JGI25908J49247_100579422 | 3300003277 | Freshwater Lake | MKTILNTIWSWLVAFGEARYAASLARQGRVAEAKAVYGS* |
JGI25908J49247_100868513 | 3300003277 | Freshwater Lake | MKTIXNSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA* |
JGI25908J49247_101532942 | 3300003277 | Freshwater Lake | MKTILNSIWSVLEAFGQARAAASLVRQGRIAEAKAIYGN* |
JGI25908J49247_101579812 | 3300003277 | Freshwater Lake | MKTIINSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA* |
JGI25910J50241_100029842 | 3300003388 | Freshwater Lake | MKTILNSIWSVLESFGQARAAASLARQGKIAEAKAIYGN* |
JGI25910J50241_100156707 | 3300003388 | Freshwater Lake | MKTILNTIWSVLEAFGQARYAASLARQGRVEESKAVYNGRA |
JGI25910J50241_101664922 | 3300003388 | Freshwater Lake | MKTIVNSIWSLLEVFGQARYAASLARQGRIAEAKAVYGA* |
JGI25907J50239_100105410 | 3300003394 | Freshwater Lake | MKTILNSIWSVLESFGQARAAASLARQGRIDEAKAVYTN* |
JGI25911J50253_100093276 | 3300003411 | Freshwater Lake | MKTILNSIWSFLETFGQARVAASLARQGRIEESKAVYNGPA* |
JGI25925J51416_100770653 | 3300003497 | Freshwater Lake | MKTITNAIWSFLEAFGQARAAASLARXGRIEEAKAVYTN* |
JGI25925J51416_101585782 | 3300003497 | Freshwater Lake | TTLKKGXLXMKTIVNSIWSLLEXFGQARXAAXLARQGRIXEAKAVYGA* |
Ga0007850_100011010 | 3300003783 | Freshwater | MKSILKSIWTVLEAVGQARYAAHLARQGRIADAKAIYGE* |
Ga0063233_100939313 | 3300003986 | Freshwater Lake | SMKTITNAIWSFLEAFAQARAAASLARMGDIEGAKAVYK* |
Ga0065166_102306682 | 3300004112 | Freshwater Lake | MKTILNSIWSFLVAFGEARYAASLARQGRVEEAKAVYNN* |
Ga0066178_100676801 | 3300004124 | Freshwater Lake | IQFSKGTLSMKTILNTIWSWLVAFGEARYAASLARQGRVAEAKAVYGS* |
Ga0007746_10493094 | 3300004763 | Freshwater Lake | MKTIINSIWSFLEAFGQARYAASLARQGRVEESKAVYNGRA* |
Ga0007748_114269441 | 3300004769 | Freshwater Lake | SMKTITNAIWSFLEVFAQARAAASLARMGDIEGAKAAYK* |
Ga0007757_114707272 | 3300004810 | Freshwater Lake | MKTILNTIWSWLEAFGQARYAASLARQGRMEESKAVYNGRA* |
Ga0007743_12847573 | 3300005415 | Freshwater Lake | MNSILNSIWSVLEAFGQARAAASLARQGRIDEAKAVYNGQQ*SSRIGG |
Ga0007743_13059733 | 3300005415 | Freshwater Lake | MKTIVNSIWSFLESFAQARAAASLARQGRIEEAKAIYGN* |
Ga0070374_100119034 | 3300005517 | Freshwater Lake | MKTITNAIWSFLEAFAQARAAASLARMGDIEGAKAVYK* |
Ga0070374_100134033 | 3300005517 | Freshwater Lake | MKTILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK* |
Ga0070374_100136233 | 3300005517 | Freshwater Lake | MKTITNAIWSFLEVFAQARAAASLARMGDIEGAKAAYK* |
Ga0070374_100257726 | 3300005517 | Freshwater Lake | MKTIINTIWSWLEAFGQARYAASLARQGRIEESKAVYNGRA* |
Ga0070374_101610524 | 3300005517 | Freshwater Lake | MKNILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK* |
Ga0070374_101853522 | 3300005517 | Freshwater Lake | MKTIVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA* |
Ga0070374_106999002 | 3300005517 | Freshwater Lake | MKTILNSIWSMLEAFGQARAAASLARMGDIEGAKAVYK* |
Ga0068876_100216307 | 3300005527 | Freshwater Lake | MKTITNAIWSFLQAFGQARAAASLARQGRIEEAKAIYGN* |
Ga0049081_100003295 | 3300005581 | Freshwater Lentic | MKTILNTIWSVIVAFGEARYAASLARQGRVEEAKAVYDGPA* |
Ga0049081_100112434 | 3300005581 | Freshwater Lentic | MKTILNSIWSVLVAFGEARYAASLARQGKIKESKAVYGA* |
Ga0049081_100517803 | 3300005581 | Freshwater Lentic | MKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN* |
Ga0049080_100190915 | 3300005582 | Freshwater Lentic | MKTILNSIWSVLVSFGEARYAASLARQGKIKESKAVYGA* |
Ga0049080_100266626 | 3300005582 | Freshwater Lentic | MKTIVNTFWSFLEAFGQARAAAILARQGRIEEAKAIYIN* |
Ga0049080_100426362 | 3300005582 | Freshwater Lentic | MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGN* |
Ga0049080_100682282 | 3300005582 | Freshwater Lentic | MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYRA* |
Ga0049080_100996493 | 3300005582 | Freshwater Lentic | MKTILNSIWSVLEAFGQARAAASLVRQGRIAEAKAVYGN* |
Ga0049085_101493713 | 3300005583 | Freshwater Lentic | MKTFTNAIWSFLEAFGQARAAASLARQGRIEEAKAVYNAQA* |
Ga0049085_101943763 | 3300005583 | Freshwater Lentic | MKTILNSIWSFLEAFGQARVAASLARQGRIEEAKAVYGN* |
Ga0049082_100716474 | 3300005584 | Freshwater Lentic | MKTIVNAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA* |
Ga0078894_1001677410 | 3300005662 | Freshwater Lake | MKSFINAIWSFLESVGQARAAASLARLGKIEEAKAIFSK* |
Ga0078894_1001718710 | 3300005662 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGA* |
Ga0078894_100283816 | 3300005662 | Freshwater Lake | MKTIIDAIWSFLEAFGQARAAASLARQGRIDEAKAVYE* |
Ga0078894_101027546 | 3300005662 | Freshwater Lake | MKTIANYLWSMLEAFGQARAAASLARMGDIEGAKSVYK* |
Ga0078894_101639684 | 3300005662 | Freshwater Lake | MKTFIKSIWSFLEAFAQARAAASLARQGKTAEAKAVYGS* |
Ga0078894_102636564 | 3300005662 | Freshwater Lake | MKTILNSIWSFLVAFGEARYAASLARQGRVAEAKAVYGS* |
Ga0078894_102760244 | 3300005662 | Freshwater Lake | MKSILNSIWSVLEAFGQARYAASLARQGRTEEAKAVYGA* |
Ga0078894_102804474 | 3300005662 | Freshwater Lake | MKTIVNSIWSFLESFAQARAAASLARQGRVEEAKAVYTN* |
Ga0078894_103286762 | 3300005662 | Freshwater Lake | MKTILNSIWSFLVAFGEARYAASLARQGRTEEAKAIYNN* |
Ga0078894_103813642 | 3300005662 | Freshwater Lake | MKNFIQSIWSFFESFGQARYAAFLARQGRIEEAKAIYSK* |
Ga0078894_106756023 | 3300005662 | Freshwater Lake | MKTILNSIWSFLVAFGEARYAASLARQGRVEEAKAVYGA* |
Ga0078894_106844202 | 3300005662 | Freshwater Lake | MKTILTSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA* |
Ga0078894_111492871 | 3300005662 | Freshwater Lake | ISMKNFINSFWSFLEAFGQARYATFLTRQGRIDEAKALYE* |
Ga0070743_101197852 | 3300005941 | Estuarine | MKTITNAIWSFLEAFGQARAAASLARMGDIEGAKAVYK* |
Ga0070744_100330044 | 3300006484 | Estuarine | MKTIVNSIWSFLEAFAQARAAASLARQGKIAESKAVYK* |
Ga0102873_12137021 | 3300007545 | Estuarine | LSMKTIVNAIWAFLEAFGQARAAASLARQGRIAEAKAIYGA* |
Ga0102877_11787512 | 3300007548 | Estuarine | MNSITNAIWSFLEAFGQARAAASLARQGRIAESKAVYNGPA* |
Ga0102881_11215182 | 3300007551 | Estuarine | KSIWSFLEAFGQARYAASLARQGRTEEAKAVYRA* |
Ga0102828_10356071 | 3300007559 | Estuarine | MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYTN* |
Ga0102919_11326112 | 3300007597 | Estuarine | MKTIINSIWSFLEAFGQARTAASLARQGKIDEAKAVYGN* |
Ga0102903_11283463 | 3300007630 | Estuarine | MKTIVNSIWSFLEAFGQARTAASLARQGRVAEAKAVYGS* |
Ga0102876_10600204 | 3300007642 | Estuarine | LSMKTILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK* |
Ga0114344_10015626 | 3300008111 | Freshwater, Plankton | MKTITNAIWSFLQALGQARAAASLARQGRIEEAKAIYGN* |
Ga0114344_10179142 | 3300008111 | Freshwater, Plankton | MKTITNAIWSFLVAFGEARYAASLARQGRVAEAKDVYKS* |
Ga0114346_10443942 | 3300008113 | Freshwater, Plankton | MKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGN* |
Ga0114346_12817073 | 3300008113 | Freshwater, Plankton | MKTILNYIWTVLEAFGQARYAASLARQGRTEEAKA |
Ga0114354_10799992 | 3300008119 | Freshwater, Plankton | MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGA* |
Ga0102889_12314822 | 3300008964 | Estuarine | MKTIINTIWSFLVAFGQARYAASLARQGRIEESKAVYNGQA* |
Ga0102816_11848031 | 3300008999 | Estuarine | MKTIINSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS* |
Ga0102829_13197711 | 3300009026 | Estuarine | ITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGN* |
Ga0114973_101448923 | 3300009068 | Freshwater Lake | MKTILNSIWSFLEAFAQARAAASLARQGKIAESKAVYGN* |
Ga0114973_103538742 | 3300009068 | Freshwater Lake | MKKIINSIWSLLEAFGQARAAASLARQGRIAEAKAVYGA* |
Ga0114973_107232822 | 3300009068 | Freshwater Lake | MKTILNSIWSVLEAFGQARYAASLARQGRIAESKAVYGS* |
Ga0114962_1000208015 | 3300009151 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYK* |
Ga0114962_100056184 | 3300009151 | Freshwater Lake | MKTVLNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA* |
Ga0114962_100260673 | 3300009151 | Freshwater Lake | MKTIVNAIWSFLESFAQARAAASLARQGRVEEAKAIYGS* |
Ga0114962_100963642 | 3300009151 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGA* |
Ga0114962_101051032 | 3300009151 | Freshwater Lake | MKSIINSIWSVLLTFGEARYAASLARQGRVAEAKAVYRN* |
Ga0114962_105616792 | 3300009151 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLARQGKIAESKAVYGA* |
Ga0114962_107268392 | 3300009151 | Freshwater Lake | MKSVLNTIWSVLVSFGEARHAASLARQGRVAEAKAVYGA* |
Ga0114968_100000354 | 3300009155 | Freshwater Lake | MKKVLNAIWLFLVAFGEARYAASLARQGRVAEAKAVYGA* |
Ga0114968_100250886 | 3300009155 | Freshwater Lake | MKTIINSIWSFLEAFGQARAAASLARQGKIAESKAVYGS* |
Ga0114968_100957233 | 3300009155 | Freshwater Lake | MKTVLNSIWSFLEAFGQARYAASLVRQGRITEAKAVYGS* |
Ga0114977_100102324 | 3300009158 | Freshwater Lake | MKTIINSIWSFLEAFGQARAAASLARMGDIEGAKAVYK* |
Ga0114977_106979421 | 3300009158 | Freshwater Lake | GKISMKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGA* |
Ga0114978_100173381 | 3300009159 | Freshwater Lake | MKTVLNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGS* |
Ga0114978_100272227 | 3300009159 | Freshwater Lake | MKTILNSIWSFLESFAQARAAASLARQGRIEEAKAVYTN* |
Ga0114978_101018513 | 3300009159 | Freshwater Lake | MKTILNSIWSFLEAFGQARAAASLARQGKIAESKAIYGS* |
Ga0114978_101515154 | 3300009159 | Freshwater Lake | MKTIVNSIWSVLEAFGQARAAASLARQGRIAEAKAVYK* |
Ga0114978_102706482 | 3300009159 | Freshwater Lake | MKTILNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA* |
Ga0114978_102776212 | 3300009159 | Freshwater Lake | MKTFVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS* |
Ga0114978_103903652 | 3300009159 | Freshwater Lake | MKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGA* |
Ga0114978_105305101 | 3300009159 | Freshwater Lake | KTITNAIWSFLEAFGQARAAASLARQGKIAESKAVYGS* |
Ga0114981_101315294 | 3300009160 | Freshwater Lake | MKTILNTIWSFLEAFGQARYAASLARQGRTEEAKAV |
Ga0114981_104379042 | 3300009160 | Freshwater Lake | MKTIVNSIWSFFEAMGQARAAASLARLGDIAGAKAIYK* |
Ga0114975_1000039313 | 3300009164 | Freshwater Lake | MKTILNSIWSVLESFAQARAAAVLVRQGRIEEAKAVYGA* |
Ga0114975_1000044647 | 3300009164 | Freshwater Lake | MKTIINSIWSFLEAFGQARAAASLARQGRVAEAKA |
Ga0114975_100004992 | 3300009164 | Freshwater Lake | MKTIINSIWSFLEAFGQARAAASLARQGRVAEAKAVYGA* |
Ga0114975_1000259716 | 3300009164 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLARQGRFEEAKAVYGA* |
Ga0114975_100103255 | 3300009164 | Freshwater Lake | MKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGS* |
Ga0114975_100241113 | 3300009164 | Freshwater Lake | MKTILNSIWSVLEAFGQARYAASLARQGRVEEAKAIYGS* |
Ga0114975_100375792 | 3300009164 | Freshwater Lake | MKTVLNSIWSVLVSFGEARYAASLARQGRIAEAKAIYNN* |
Ga0114975_100482686 | 3300009164 | Freshwater Lake | MKNFINAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA* |
Ga0114975_101234653 | 3300009164 | Freshwater Lake | MKTILNAIWSFLVAFGEARYAASLARQGKIDKAKAVYGS* |
Ga0114975_101746532 | 3300009164 | Freshwater Lake | MKTILNSIWSFLEAFGQARTAASLVRQGRIEEAKAVYGS* |
Ga0114975_104179743 | 3300009164 | Freshwater Lake | MKSVLNTIWSFLEAFGQARAAASLARQGRIAEAKAVYGA* |
Ga0114975_105240712 | 3300009164 | Freshwater Lake | MKTILNSIWSFLESFAQARAAASLARQGRIEEAKAVYGS* |
Ga0114975_105735062 | 3300009164 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLARQGRVAEAKAVYGS* |
Ga0114975_107476222 | 3300009164 | Freshwater Lake | MKTILNSIWSWLEAFGQARAAASLARQGRVAEAKAVYGA* |
Ga0114975_107650831 | 3300009164 | Freshwater Lake | MKTIVNSIWSWLEAFGQARAAASLARQGRIAEAKAVYGA* |
Ga0114959_100142647 | 3300009182 | Freshwater Lake | MKSIFNSIWSFLEAFGEARYAASLARQGRTAEAKALYGG* |
Ga0114959_101671084 | 3300009182 | Freshwater Lake | MKSVLNTIWSVLVSFGEARYAASLARQGRVAEAKAVYGA* |
Ga0114959_103529373 | 3300009182 | Freshwater Lake | MKSILNSIWSVLVAFGEARYAASLARQGRVAEAKAVYGN* |
Ga0114974_104685992 | 3300009183 | Freshwater Lake | MKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAIYGA* |
Ga0114972_105956721 | 3300009187 | Freshwater Lake | ILNSIWSFLEAFAQARAAASLARQGKIAESKAVYGN* |
Ga0114982_10031613 | 3300009419 | Deep Subsurface | MKTIANSIWSFLEAFGQARAAAILARQGRVEEAKAIYGS* |
Ga0114982_10043968 | 3300009419 | Deep Subsurface | MKTIVNSIWSFLEAFGQARAAAILARQGKIEEAKAVYGS* |
Ga0114982_10333083 | 3300009419 | Deep Subsurface | MKTFIKSIWSFLEAFAQARAAASLARQGKIDEAKAVYGS* |
Ga0114982_11441523 | 3300009419 | Deep Subsurface | MKTILNTIWSVLVAFGEARYAASLARQGRIDEAKAVYGS* |
Ga0114964_100786443 | 3300010157 | Freshwater Lake | MKSVLNTIWSILLSFGEARHAASLARQGRVAEAKAVYGA* |
Ga0114967_101827552 | 3300010160 | Freshwater Lake | MKTIINTIWSWLEAFGQARCAASLARQGRIAEAKAVYGA* |
Ga0136644_100877735 | 3300010334 | Freshwater Lake | TVPMKSVLNTIWSVLVSFGEAGHAASLARQGRVAEAKAVYGA* |
Ga0133913_1019285811 | 3300010885 | Freshwater Lake | MKTVVNAIWSFLEAFGQARAAASLARQGKIAESKAVYGS* |
Ga0133913_107720191 | 3300010885 | Freshwater Lake | MKTIINSIWSFLEAFGQARAAASLARQGRIEEAKAIYGA* |
Ga0133913_108829835 | 3300010885 | Freshwater Lake | MKTVLNSIWSFLVAFGEARYAASLARQGRVAEAKAIYNN* |
Ga0133913_125033242 | 3300010885 | Freshwater Lake | MKSIVKSIWSFLETFGQARAAASLARQGRVAEAKAIYGA* |
Ga0133913_126111782 | 3300010885 | Freshwater Lake | MKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGA* |
Ga0133913_132057962 | 3300010885 | Freshwater Lake | MKTILNSIWSFLEAFGQARAAASLARQGKFNEAKAVYGN* |
Ga0139557_10036191 | 3300011010 | Freshwater | MKTILNSIWSVLESFAQARAAASLARQGRIDEAKAVY |
Ga0139557_10104142 | 3300011010 | Freshwater | MKTILNTIWSVLVAFGEARYAASLARQGRIEESKAVYNGRA* |
Ga0139556_10288931 | 3300011011 | Freshwater | MKTILNSIWSFLEAFGQARAAASLARQGRIEEAKAVYTN* |
Ga0157138_10046264 | 3300012352 | Freshwater | MKTIINKLWSILESFGQARYAASLARQGRVDEAKAVYE* |
Ga0157203_10002079 | 3300012663 | Freshwater | MKTILNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGN* |
Ga0157203_100266910 | 3300012663 | Freshwater | MKIILNSIWSFLEAFGQARVAASLARQGKIEEAKAMYGA* |
Ga0157203_10065114 | 3300012663 | Freshwater | MKTILNSIWSVLESFAQARAAAVLARQGKIEEAKAVYGA* |
Ga0157203_10106651 | 3300012663 | Freshwater | MKTILNTIWSVIVAFGEARYAASLARQGRIAEAKAVYGA* |
Ga0157203_10113783 | 3300012663 | Freshwater | MKTIVKSIWSFLEAFGQARAAAILARQGRIEEAKAVYTN* |
Ga0157203_10145413 | 3300012663 | Freshwater | MKTFLNSIWSVLEAFGQARAAATLARIGDIEGAKAVYK* |
Ga0157203_10189913 | 3300012663 | Freshwater | MKTILNSIWSFLVAFGEARYAASLARQGRVAEAKAVYGA* |
Ga0157203_10516442 | 3300012663 | Freshwater | MKTFLNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA* |
Ga0157210_100019044 | 3300012665 | Freshwater | MKSILNSIWSVLEAFGQARAAATLARIGDIEGAKAVYK* |
Ga0157210_100023514 | 3300012665 | Freshwater | MKSILNTIWSVLESFGQARYAASLARQGRVDEAKAVYE* |
Ga0157210_10025484 | 3300012665 | Freshwater | MKTFLNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGS* |
Ga0157210_10055434 | 3300012665 | Freshwater | MKQFFNTIWNVLVAIGEARYAASLARQGRIEEAKAVYGA* |
Ga0157210_10073144 | 3300012665 | Freshwater | MKTIANSIWLFLEAFGQARYAASLARQGRTEEAKAVYRS* |
Ga0157210_10393282 | 3300012665 | Freshwater | MKTILNYIWTALMAFSEARYAASLARQGRFDEAKAVYE* |
Ga0157210_10399282 | 3300012665 | Freshwater | MKQIFNTIWSVLVAFGEARYAASLARQGRVAEAKAVYGS* |
Ga0157208_100082134 | 3300012667 | Freshwater | MKTIVKSIWSFLEAFGQARAAAILARQGRVAEAKAVYGA* |
Ga0164293_101497051 | 3300013004 | Freshwater | MKTIVNSIWLFLEAFGQARDAASLARQGRIEEAKAVYGN* |
Ga0164293_105256841 | 3300013004 | Freshwater | KGNLSMKTILNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA* |
Ga0164292_101520715 | 3300013005 | Freshwater | MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGN* |
Ga0164294_1000015647 | 3300013006 | Freshwater | MKTIFNSIWSVLEAFAQARAAASLARMGDIEGAKAVYK* |
Ga0136642_100190314 | 3300013285 | Freshwater | MKSITNAIWSFLEAFGQARAAASLARQGRVTEAKALYGR* |
Ga0136642_10968172 | 3300013285 | Freshwater | MKTILNSIWSFLEAFGQARAAASLARQGRVAEAKAVYGA* |
Ga0136642_11014182 | 3300013285 | Freshwater | MKYILKSIWSVLEAVGEARYAAHLARQGRIADAKAVYGE* |
Ga0136642_11091313 | 3300013285 | Freshwater | MKTILNSIWSFLEVFGQARAAASLARQGKIAESKAVYGA* |
Ga0136642_11562592 | 3300013285 | Freshwater | MKSIVNSIWSFFEAMGQARAAASLARIGDIAGAKAIYK* |
Ga0136641_10007303 | 3300013286 | Freshwater | MKTILNSIWSFLEVFGQARYAASLARQGRTAEAKAVYGK* |
Ga0136641_10075848 | 3300013286 | Freshwater | MKTILNSIWLFLETFGQARYAASLARQGRTAEAKAVYGA* |
Ga0136641_10333192 | 3300013286 | Freshwater | MKTITSAIWSFLEIFGQARAAASLARQGKIAESKAVYGA* |
Ga0177922_113204263 | 3300013372 | Freshwater | MKTILNSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA* |
Ga0181356_10864924 | 3300017761 | Freshwater Lake | MKTILNSMWSVLEAFGQARAAASLARMGDIEGAKAVYK |
Ga0181349_10235725 | 3300017778 | Freshwater Lake | MKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGN |
Ga0181346_13029701 | 3300017780 | Freshwater Lake | ELSKGNISMKTILNSIWSVLESFGQARAAASLARQGKIAEAKAIYGN |
Ga0181348_11350214 | 3300017784 | Freshwater Lake | MKTILNSIWSFLETFGQARVAASLARQGRIEESKAVYNG |
Ga0181359_10042012 | 3300019784 | Freshwater Lake | MKTILNSIWSVLEAFGQARAAASLVRQGRIAEAKAIYGN |
Ga0181359_10605842 | 3300019784 | Freshwater Lake | MKTIVNTIWLFLEAFGQARAAASLARQGRIAEAKAVYGN |
Ga0211732_10391832 | 3300020141 | Freshwater | MKTIVKSIWSFLEAFAQARAAASLARQGRVEEAKAVYGA |
Ga0211732_10434972 | 3300020141 | Freshwater | MKNFINAIWSFLEAFGQARAAASLARQGRIAEAKSIYGA |
Ga0211732_10673233 | 3300020141 | Freshwater | MKTIVNSIWSFLEAFGQARAAASLARQGKIDEAKAVYGN |
Ga0211732_11044135 | 3300020141 | Freshwater | MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGN |
Ga0211732_114319215 | 3300020141 | Freshwater | MKTIINSIWSFLEAFGQARAAASLARQGKTAEAKAIYGA |
Ga0211732_12501211 | 3300020141 | Freshwater | MKQVLNTILQFLEAFGQARAAASLARQGRINEAKAVYAK |
Ga0211736_102704513 | 3300020151 | Freshwater | MKQVLNTILQFLEAFGQARAAASLTRQGRIDEAKAIYAK |
Ga0211736_103697947 | 3300020151 | Freshwater | MKTIVNSIWSFLEAFGQVRAAASLARQGRVEEAKAVYIN |
Ga0211736_104110712 | 3300020151 | Freshwater | MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGN |
Ga0211736_109514762 | 3300020151 | Freshwater | MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAIYTN |
Ga0211736_109865884 | 3300020151 | Freshwater | MKTIINSIWSFLVAFGEARYAASLARQGRVEEAKAVYGA |
Ga0211734_107423534 | 3300020159 | Freshwater | MKQVLNTIFQFLEAFGQARAAASLARQGRIDEAKAIYAK |
Ga0211733_111092897 | 3300020160 | Freshwater | MKNIINSIWSFLEAFGQARAASILARQGRIEEAKAIYGN |
Ga0211726_107149791 | 3300020161 | Freshwater | MKNIINSIWSFLEAFGQARAASILARQGKIEEAKAIYGN |
Ga0211735_109865252 | 3300020162 | Freshwater | MKTILNTIWSVIVSFGEARYAASLARQGRVEEAKAVYNGPA |
Ga0211731_102622781 | 3300020205 | Freshwater | MKTIVNSIWSFLEAFAQARAAASLARQGKIEEAKAVYGA |
Ga0211731_103231143 | 3300020205 | Freshwater | LNTILQFFEAMGQARAAASLTRQGRINEAKAIYAK |
Ga0211731_104380983 | 3300020205 | Freshwater | MKTIINSVWSFLEAFGQARAAASLARQGRIEEAKAIYE |
Ga0211731_108229175 | 3300020205 | Freshwater | MKTIVNSIWSLLEAFGQARAAASLARQGKIEEAKAVYKA |
Ga0211731_113512643 | 3300020205 | Freshwater | MKQVLNTILQFFEAMGQARAAASLTRQGRIDEAKAIYAK |
Ga0208224_10076181 | 3300020528 | Freshwater | MKTIVNSIWLFLEAFGQARDAASLARQGRIEEAKAVYGN |
Ga0208224_10239803 | 3300020528 | Freshwater | MKTITNAIWSFLQAFGQARAAASLARQGRIEEAKAIYGN |
Ga0208222_10526312 | 3300020566 | Freshwater | MKTIVNSIWLFLEAFGQARAAASLARQGRIEEAKAVYGN |
Ga0207909_10589593 | 3300020572 | Freshwater | MKTILNSIWSVLESFAQARAAAVLARQGRIEEAKAVYGN |
Ga0214163_10998222 | 3300021141 | Freshwater | MKTILNSIWSFLEAFGQARYAASLARQGRIAESKAVYES |
Ga0210307_12096691 | 3300021336 | Estuarine | MKTILNSIWSVLEAFGQARAAASLARQGRIDDAKAVYK |
Ga0194048_100317753 | 3300021519 | Anoxic Zone Freshwater | MKTIINTIWSVIVAFGEARYAASLARQGRVEEAKAVYNGPA |
Ga0194048_101927902 | 3300021519 | Anoxic Zone Freshwater | MKTFVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS |
Ga0213922_11100852 | 3300021956 | Freshwater | MKSILNLIWSVLESFGQARAAAVLARQGRIEEAKAIYGS |
Ga0222712_104386772 | 3300021963 | Estuarine Water | MKSVLNSIWSFLESFAQARAAASLARQGRVEEAKAVYKN |
Ga0181354_10801073 | 3300022190 | Freshwater Lake | MKTITNAIWSFLEVFAQARAAASLARMGDIEGAKAAYK |
Ga0181351_12531012 | 3300022407 | Freshwater Lake | MKTILNSIWSVLEAFGEARYAASLARQGRVAEAKAVYGA |
Ga0181351_12721552 | 3300022407 | Freshwater Lake | MKTITNAIWSFLEAFGQARYAASLARQGRIAESKAVYNGPA |
Ga0248169_1041468 | 3300022602 | Freshwater | MKSILNSIWTVLVAVGQARHAAYLARQGRLAEAKAVYGN |
Ga0244775_1000602916 | 3300024346 | Estuarine | MKTITNAIWSFLEAFGQARAAASLARMGDIEGAKAVYK |
Ga0244775_100780205 | 3300024346 | Estuarine | LSMKTIVNSIWSFLEAFAQARAAASLARQGKIAEAKAVYGA |
Ga0244775_101156235 | 3300024346 | Estuarine | MKTIVNLIWSWLETFGQARAAASLARQGRIDEAKAVYK |
Ga0244775_101234482 | 3300024346 | Estuarine | MNSITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN |
Ga0244775_101689805 | 3300024346 | Estuarine | MKTIVNAIWAFLEAFGQARAAASLARQGRIAEAKAIYGA |
Ga0244775_104031932 | 3300024346 | Estuarine | MKTIVNSIWSFLEAFGQARAAASLARQGRIEESKAVYNGPA |
Ga0244775_104601334 | 3300024346 | Estuarine | MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYRN |
Ga0244775_107182772 | 3300024346 | Estuarine | MKTIINSIRSFLEAFGQARTAASLARQGRIEEAKAVYNAPA |
Ga0244775_111772921 | 3300024346 | Estuarine | LNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS |
Ga0255252_10833152 | 3300024853 | Freshwater | GKIPMKTILNTIWSVLEAFGQARYAASLARQGRVEESKAVYNGRA |
Ga0208504_100003413 | 3300025358 | Freshwater | MKSILKSIWTVLEAVGQARYAAHLARQGRIADAKAIYGE |
Ga0255114_10671611 | 3300027145 | Freshwater | SMKTILNSIWSMLEAFGQARAAASLARMGDIEGAKAVYK |
Ga0255134_10804672 | 3300027292 | Freshwater | MKTILNSIWSVLEAFAQARAAASLARMGDIEGAKAVYK |
Ga0208022_10612443 | 3300027418 | Estuarine | MKTITNAIWSFLEAFAQARAAASLARMGDIEGAKAVYK |
Ga0255125_10689932 | 3300027534 | Freshwater | MKTILNSIWSVLEAFGQARAAASLARIGDIEGAKAVYK |
Ga0209552_10419422 | 3300027563 | Freshwater Lake | MKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN |
Ga0209552_10865462 | 3300027563 | Freshwater Lake | SMKTIINSIWSFLEAFGQARYAASLARQGRVEESKAVYNGRA |
Ga0208966_11182061 | 3300027586 | Freshwater Lentic | MKTILNTIWSVIVAFGEARYAASLARQGRIEESKAVYNGRAXSSRR |
Ga0208966_11552442 | 3300027586 | Freshwater Lentic | MKTIVNAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA |
Ga0255117_10138455 | 3300027600 | Freshwater | MKTIVNSIWSFLEAFGQARAAASLARQGRIAEAKAIYGA |
Ga0208974_10000457 | 3300027608 | Freshwater Lentic | MKKIVNSLWSFLEALGQARAASILARQGRIEEAKAVYNGPA |
Ga0208974_100011265 | 3300027608 | Freshwater Lentic | MKTILNTIWSVIVAFGEARYAASLARQGRVEEAKAVYDGPA |
Ga0208974_100111217 | 3300027608 | Freshwater Lentic | MKTILNSIWSVLVAFGEARYAASLARQGKIKESKAVYGA |
Ga0208974_10096105 | 3300027608 | Freshwater Lentic | FSKGKLSMKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN |
Ga0208951_11810102 | 3300027621 | Freshwater Lentic | MKTIVNSIWSLLEVFGQARYAASLARQGRIAEAKAVYGA |
Ga0208133_10138871 | 3300027631 | Estuarine | SMNSITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN |
Ga0209135_10993902 | 3300027642 | Freshwater Lake | MKTIVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA |
Ga0209356_11451842 | 3300027644 | Freshwater Lake | MKTIVNTIWSVLEAFGQARAAASLARMGDIEGAKAVYK |
Ga0209769_10188102 | 3300027679 | Freshwater Lake | MKTILNSIWSVLESFGQARAAASLARQGKIAEAKAIYGN |
Ga0209769_12096542 | 3300027679 | Freshwater Lake | MNSILNSIWSVLEAFGQARAAASLARQGRIDEAKAVYNGQQ |
Ga0209188_10219317 | 3300027708 | Freshwater Lake | MKSIFNSIWSFLEAFGEARYAASLARQGRTAEAKALYGG |
Ga0209188_10562822 | 3300027708 | Freshwater Lake | MKSIINSIWSVLLTFGEARYAASLARQGRVAEAKAVYRN |
Ga0209188_11488482 | 3300027708 | Freshwater Lake | MKSVLNTIWSVLVSFGEARHAASLARQGRVAEAKAVYGA |
Ga0209188_12472052 | 3300027708 | Freshwater Lake | MKTIVNAIWSFLESFAQARAAASLARQGRVEEAKAIYGS |
Ga0209599_100074078 | 3300027710 | Deep Subsurface | MKTIVNSIWSFLEAFGQARAAAILARQGKIEEAKAVYGS |
Ga0209599_100109623 | 3300027710 | Deep Subsurface | MKTIANSIWSFLEAFGQARAAAILARQGRVEEAKAIYGS |
Ga0209599_100538833 | 3300027710 | Deep Subsurface | MKTIVKSIWSFLEAFAQARAAASLARQGKIDEAKAVYGS |
Ga0209599_101204463 | 3300027710 | Deep Subsurface | MKTILNTIWSVLVAFGEARYAASLARQGRIDEAKAVYGS |
Ga0209442_1000022110 | 3300027732 | Freshwater Lake | MKNILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK |
Ga0209442_11562492 | 3300027732 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLASQGKIAEAKAVYK |
Ga0209442_11622422 | 3300027732 | Freshwater Lake | MKTIVNSIWSFLESFAQARAAASLARQGKIAESKAVYK |
Ga0209297_10976213 | 3300027733 | Freshwater Lake | MKTIINSIWSFLEAFGQARAAASLARMGDIEGAKAVYK |
Ga0209087_10130705 | 3300027734 | Freshwater Lake | MKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGS |
Ga0209190_10587663 | 3300027736 | Freshwater Lake | MKTILNSIWSVLEAFGQARYAASLARQGRIAESKAVYGS |
Ga0209597_100000860 | 3300027746 | Freshwater Lake | MKTIINTIWSWLEAFGQARCAASLARQGRIAEAKAVYGA |
Ga0209084_100039955 | 3300027749 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGA |
Ga0209084_101110210 | 3300027749 | Freshwater Lake | MKTVLNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA |
Ga0209084_11022142 | 3300027749 | Freshwater Lake | MKSVLNTIWSILLSFGEARHAASLARQGRVAEAKAVYGA |
Ga0209444_101735794 | 3300027756 | Freshwater Lake | ILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN |
Ga0209296_100099112 | 3300027759 | Freshwater Lake | MKTILNSIWSFLESFAQARAAASLARQGRIEEAKAVYGS |
Ga0209296_10070465 | 3300027759 | Freshwater Lake | MKTILNSIWSVLESFAQARAAAVLVRQGRIEEAKAVYGA |
Ga0209296_10079929 | 3300027759 | Freshwater Lake | MKTILNTIWSFLEAFGQARYAASLARQGRTEEAKAVYGS |
Ga0209296_10160619 | 3300027759 | Freshwater Lake | MKSVLNTIWSFLEAFGQARAAASLARQGRIAEAKAVYGA |
Ga0209296_11638301 | 3300027759 | Freshwater Lake | MKTILNSIWSVLEAFGQARYAASLARQGRVEEAKAIYGS |
Ga0209296_12838462 | 3300027759 | Freshwater Lake | MKTIINSIWSFLEAFGQARAAASLARQGRVAEAKAVYGA |
Ga0209088_100927832 | 3300027763 | Freshwater Lake | MKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGA |
Ga0209088_102815833 | 3300027763 | Freshwater Lake | MKTITNAIWSFLEAFGQARAAASLARQGKIAESKAVYGS |
Ga0209088_103432721 | 3300027763 | Freshwater Lake | MKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGA |
Ga0209770_1000311011 | 3300027769 | Freshwater Lake | MKNFINSFWSFLEAFGQARYATFLTRQGRIDEAKALYE |
Ga0209770_101363702 | 3300027769 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGA |
Ga0209770_103162141 | 3300027769 | Freshwater Lake | SMKTILNSIWSFLVAFGEARYAASLARQGRTEEAKAIYNN |
Ga0209500_100666905 | 3300027782 | Freshwater Lake | MKTILNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA |
Ga0209500_100828263 | 3300027782 | Freshwater Lake | MKTILNSIWSFLEAFGQARAAASLARQGKIAESKAIYGS |
Ga0209500_101392573 | 3300027782 | Freshwater Lake | MKTILNSIWSFLEAFAQARAAASLARQGKIAESKAVYGN |
Ga0209500_103151352 | 3300027782 | Freshwater Lake | MKTIVNSIWSVLEAFGQARAAASLARQGRIAEAKAVYK |
Ga0209246_100183403 | 3300027785 | Freshwater Lake | MKTILNSIWSFLETFGQARVAASLARQGRIEESKAVYNGPA |
Ga0209107_100263887 | 3300027797 | Freshwater And Sediment | MKTIVNSIWSFLEAFGQARYAASLARQGRIEESKAVYNGPA |
Ga0209107_105266411 | 3300027797 | Freshwater And Sediment | MKTITNAIWSFLESFGQARAAASLARQGRIEEAKAVYRA |
Ga0209353_100475032 | 3300027798 | Freshwater Lake | MKTIINSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA |
Ga0209353_100738404 | 3300027798 | Freshwater Lake | VNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA |
Ga0209550_1000804116 | 3300027892 | Freshwater Lake | MKTILNTIWSWLEAFGQARYAASLARQGRVEESKAVYNGRA |
Ga0209400_1000145121 | 3300027963 | Freshwater Lake | MKKVLNAIWLFLVAFGEARYAASLARQGRVAEAKAVYGA |
Ga0209400_10097355 | 3300027963 | Freshwater Lake | MKTIINSIWSFLEAFGQARAAASLARQGKIAESKAVYGS |
Ga0209400_10858983 | 3300027963 | Freshwater Lake | MKTVLNSIWSFLEAFGQARYAASLVRQGRITEAKAVYGS |
Ga0209191_100163216 | 3300027969 | Freshwater Lake | MKTIVNSIWSFLEAFGQARAAASLARQGRFEEAKAVYGA |
Ga0209191_10125323 | 3300027969 | Freshwater Lake | MKTILNAIWSFLVAFGEARYAASLARQGKIDKAKAVYGS |
Ga0209191_10154502 | 3300027969 | Freshwater Lake | MKTVLNSIWSVLVSFGEARYAASLARQGRIAEAKAIYNN |
Ga0209191_10212154 | 3300027969 | Freshwater Lake | MKNFINAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA |
Ga0209191_11000522 | 3300027969 | Freshwater Lake | MKTILNSIWSFLEAFGQARTAASLVRQGRIEEAKAVYGS |
Ga0209191_12766381 | 3300027969 | Freshwater Lake | KTILNSIWSFLEAFGQARAAASLARQGKIAESKAIYGS |
Ga0304728_11821262 | 3300028393 | Freshwater Lake | MKSVLNTIWSVLVSFGEARYAASLARQGRVAEAKAVYGA |
Ga0304730_100442010 | 3300028394 | Freshwater Lake | MKTIINSIWSFLEAFGQARAAASLARQGKIAESKAVYGA |
Ga0304730_10246686 | 3300028394 | Freshwater Lake | MKSILNSIWSVLEAFGQARYAASLARQGRTEEAKAVYGA |
Ga0315905_100234207 | 3300032092 | Freshwater | MKTILNYIWTVLEAFGQARYAASLARQGRTEEAKAVYGA |
Ga0315905_109425492 | 3300032092 | Freshwater | LSMKTIVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA |
Ga0334977_0027612_2692_2811 | 3300033978 | Freshwater | MKTILNSIRSFLEAFGQARYAASLARQGRTEEAKAVYGA |
Ga0334992_0001335_12549_12668 | 3300033992 | Freshwater | MKTILNSIWSFLEAFGEARAASILARQGRIEEAKAVYRN |
Ga0334996_0303347_553_672 | 3300033994 | Freshwater | MKTILNSIWSFLEAFGEARYAASLARQGRTEEAKAVYGA |
Ga0335020_0027997_2371_2490 | 3300034082 | Freshwater | MKTIVNSIWSFLEAFAQARAAASLARQGKIAEAKAVYGA |
Ga0335020_0038540_437_568 | 3300034082 | Freshwater | MNSILNSILNSIWSVLESFAQARAAAVLARQGRIEEAKAVYGN |
Ga0335012_0080428_1480_1599 | 3300034093 | Freshwater | MKTITNAIWSVLEAFGQARVAASLARQGKIEEAKAVYRA |
Ga0335029_0300069_49_168 | 3300034102 | Freshwater | MKTILNSIWSFLEAFGQARVAASLARQGRIEEAKAVYRA |
Ga0335029_0666560_263_382 | 3300034102 | Freshwater | MKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYRA |
Ga0335048_0425073_1_105 | 3300034356 | Freshwater | MKTITNAIWSVLEAFGQARVAASLARQGKIEEAKA |
⦗Top⦘ |