NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F009605

Metagenome / Metatranscriptome Family F009605

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009605
Family Type Metagenome / Metatranscriptome
Number of Sequences 315
Average Sequence Length 39 residues
Representative Sequence MKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN
Number of Associated Samples 136
Number of Associated Scaffolds 315

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 91.03 %
% of genes near scaffold ends (potentially truncated) 12.06 %
% of genes from short scaffolds (< 2000 bps) 61.90 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (59.683 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(28.571 % of family members)
Environment Ontology (ENVO) Unclassified
(73.016 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(85.079 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 46.27%    β-sheet: 0.00%    Coil/Unstructured: 53.73%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 315 Family Scaffolds
PF12697Abhydrolase_6 9.52
PF07883Cupin_2 3.17
PF00487FA_desaturase 2.86
PF00565SNase 2.54
PF06094GGACT 1.27
PF06941NT5C 0.95
PF137592OG-FeII_Oxy_5 0.95
PF01223Endonuclease_NS 0.95
PF02777Sod_Fe_C 0.95
PF07819PGAP1 0.95
PF12708Pectate_lyase_3 0.95
PF00534Glycos_transf_1 0.63
PF12695Abhydrolase_5 0.63
PF00155Aminotran_1_2 0.63
PF12705PDDEXK_1 0.63
PF00535Glycos_transf_2 0.63
PF01521Fe-S_biosyn 0.63
PF03477ATP-cone 0.63
PF00268Ribonuc_red_sm 0.63
PF00574CLP_protease 0.63
PF03851UvdE 0.63
PF13772AIG2_2 0.63
PF03401TctC 0.32
PF00550PP-binding 0.32
PF00081Sod_Fe_N 0.32
PF01126Heme_oxygenase 0.32
PF01177Asp_Glu_race 0.32
PF04055Radical_SAM 0.32
PF07691PA14 0.32
PF00383dCMP_cyt_deam_1 0.32
PF01909NTP_transf_2 0.32
PF01471PG_binding_1 0.32
PF06347SH3_4 0.32
PF06821Ser_hydrolase 0.32
PF00004AAA 0.32
PF13394Fer4_14 0.32
PF13673Acetyltransf_10 0.32
PF13884Peptidase_S74 0.32
PF03741TerC 0.32
PF03783CsgG 0.32
PF02678Pirin 0.32
PF16861Carbam_trans_C 0.32
PF10118Metal_hydrol 0.32
PF05996Fe_bilin_red 0.32
PF10263SprT-like 0.32
PF05637Glyco_transf_34 0.32
PF10528GLEYA 0.32
PF030614HBT 0.32

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 315 Family Scaffolds
COG1398Fatty-acid desaturaseLipid transport and metabolism [I] 2.86
COG3239Fatty acid desaturaseLipid transport and metabolism [I] 2.86
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 1.27
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.27
COG0740ATP-dependent protease ClpP, protease subunitPosttranslational modification, protein turnover, chaperones [O] 1.27
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.95
COG1075Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase foldLipid transport and metabolism [I] 0.95
COG1864DNA/RNA endonuclease G, NUC1Nucleotide transport and metabolism [F] 0.95
COG2267Lysophospholipase, alpha-beta hydrolase superfamilyLipid transport and metabolism [I] 0.95
COG45025'(3')-deoxyribonucleotidaseNucleotide transport and metabolism [F] 0.95
COG0208Ribonucleotide reductase beta subunit, ferritin-like domainNucleotide transport and metabolism [F] 0.63
COG0316Fe-S cluster assembly iron-binding protein IscAPosttranslational modification, protein turnover, chaperones [O] 0.63
COG1030Membrane-bound serine protease NfeD, ClpP classPosttranslational modification, protein turnover, chaperones [O] 0.63
COG4294UV DNA damage repair endonucleaseReplication, recombination and repair [L] 0.63
COG4841Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF familyFunction unknown [S] 0.63
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 0.32
COG1462Curli biogenesis system outer membrane secretion channel CsgGCell wall/membrane/envelope biogenesis [M] 0.32
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 0.32
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.32
COG3230Heme oxygenaseInorganic ion transport and metabolism [P] 0.32
COG3545Predicted esterase of the alpha/beta hydrolase foldGeneral function prediction only [R] 0.32
COG5398Heme oxygenaseCoenzyme transport and metabolism [H] 0.32


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.11 %
UnclassifiedrootN/A28.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000756|JGI12421J11937_10038011All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1663Open in IMG/M
3300000756|JGI12421J11937_10147175Not Available586Open in IMG/M
3300000756|JGI12421J11937_10171850Not Available521Open in IMG/M
3300000882|FwDRAFT_10292354Not Available529Open in IMG/M
3300002139|M3t2BS2_1876187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage761Open in IMG/M
3300002142|M2t2FKB2_1050267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage864Open in IMG/M
3300002408|B570J29032_109599896All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage920Open in IMG/M
3300002835|B570J40625_100078030All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4314Open in IMG/M
3300002835|B570J40625_100242345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1891Open in IMG/M
3300002835|B570J40625_100586211All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1024Open in IMG/M
3300002835|B570J40625_100659086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage945Open in IMG/M
3300002835|B570J40625_100912502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage759Open in IMG/M
3300003277|JGI25908J49247_10000491All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12074Open in IMG/M
3300003277|JGI25908J49247_10000658All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10625Open in IMG/M
3300003277|JGI25908J49247_10002037All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6482Open in IMG/M
3300003277|JGI25908J49247_10002163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6279Open in IMG/M
3300003277|JGI25908J49247_10002972All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5413Open in IMG/M
3300003277|JGI25908J49247_10009730Not Available3001Open in IMG/M
3300003277|JGI25908J49247_10011216All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2779Open in IMG/M
3300003277|JGI25908J49247_10015611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2318Open in IMG/M
3300003277|JGI25908J49247_10023487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1817Open in IMG/M
3300003277|JGI25908J49247_10057942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage994Open in IMG/M
3300003277|JGI25908J49247_10086851Not Available765Open in IMG/M
3300003277|JGI25908J49247_10153294Not Available537Open in IMG/M
3300003277|JGI25908J49247_10157981Not Available527Open in IMG/M
3300003388|JGI25910J50241_10002984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6155Open in IMG/M
3300003388|JGI25910J50241_10015670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2687Open in IMG/M
3300003388|JGI25910J50241_10166492All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage567Open in IMG/M
3300003394|JGI25907J50239_1001054All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6610Open in IMG/M
3300003411|JGI25911J50253_10009327All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3717Open in IMG/M
3300003497|JGI25925J51416_10077065Not Available828Open in IMG/M
3300003783|Ga0007850_1000110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8550Open in IMG/M
3300003986|Ga0063233_10093931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage880Open in IMG/M
3300004112|Ga0065166_10230668All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300004124|Ga0066178_10067680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage933Open in IMG/M
3300004763|Ga0007746_1049309All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1777Open in IMG/M
3300004769|Ga0007748_11426944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage670Open in IMG/M
3300004810|Ga0007757_11470727Not Available510Open in IMG/M
3300005415|Ga0007743_1284757Not Available680Open in IMG/M
3300005415|Ga0007743_1305973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage643Open in IMG/M
3300005517|Ga0070374_10011903Not Available4279Open in IMG/M
3300005517|Ga0070374_10013403All Organisms → cellular organisms → Bacteria4062Open in IMG/M
3300005517|Ga0070374_10013623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4033Open in IMG/M
3300005517|Ga0070374_10025772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3014Open in IMG/M
3300005517|Ga0070374_10161052Not Available1163Open in IMG/M
3300005517|Ga0070374_10185352All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1074Open in IMG/M
3300005517|Ga0070374_10699900Not Available500Open in IMG/M
3300005527|Ga0068876_10021630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4065Open in IMG/M
3300005581|Ga0049081_10000329Not Available18375Open in IMG/M
3300005581|Ga0049081_10011243All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3383Open in IMG/M
3300005581|Ga0049081_10051780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1554Open in IMG/M
3300005582|Ga0049080_10019091All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2392Open in IMG/M
3300005582|Ga0049080_10026662Not Available2018Open in IMG/M
3300005582|Ga0049080_10042636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1574Open in IMG/M
3300005582|Ga0049080_10068228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1221Open in IMG/M
3300005582|Ga0049080_10099649Not Available988Open in IMG/M
3300005583|Ga0049085_10149371Not Available789Open in IMG/M
3300005583|Ga0049085_10194376Not Available675Open in IMG/M
3300005584|Ga0049082_10071647Not Available1217Open in IMG/M
3300005662|Ga0078894_10016774Not Available5862Open in IMG/M
3300005662|Ga0078894_10017187All Organisms → cellular organisms → Bacteria5791Open in IMG/M
3300005662|Ga0078894_10028381All Organisms → cellular organisms → Bacteria4594Open in IMG/M
3300005662|Ga0078894_10102754Not Available2525Open in IMG/M
3300005662|Ga0078894_10163968All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2002Open in IMG/M
3300005662|Ga0078894_10263656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1562Open in IMG/M
3300005662|Ga0078894_10276024All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1525Open in IMG/M
3300005662|Ga0078894_10280447All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1512Open in IMG/M
3300005662|Ga0078894_10328676Not Available1386Open in IMG/M
3300005662|Ga0078894_10381364Not Available1275Open in IMG/M
3300005662|Ga0078894_10675602All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage913Open in IMG/M
3300005662|Ga0078894_10684420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage906Open in IMG/M
3300005662|Ga0078894_11149287All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage660Open in IMG/M
3300005941|Ga0070743_10119785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage881Open in IMG/M
3300006484|Ga0070744_10033004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1529Open in IMG/M
3300007545|Ga0102873_1213702All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300007548|Ga0102877_1178751Not Available598Open in IMG/M
3300007551|Ga0102881_1121518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300007559|Ga0102828_1035607Not Available1129Open in IMG/M
3300007597|Ga0102919_1132611All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales784Open in IMG/M
3300007630|Ga0102903_1128346Not Available697Open in IMG/M
3300007642|Ga0102876_1060020All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1053Open in IMG/M
3300008111|Ga0114344_1001562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13521Open in IMG/M
3300008111|Ga0114344_1017914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2886Open in IMG/M
3300008113|Ga0114346_1044394All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2252Open in IMG/M
3300008113|Ga0114346_1281707Not Available589Open in IMG/M
3300008119|Ga0114354_1079999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1335Open in IMG/M
3300008964|Ga0102889_1231482All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales535Open in IMG/M
3300008999|Ga0102816_1184803Not Available650Open in IMG/M
3300009026|Ga0102829_1319771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300009068|Ga0114973_10144892All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1323Open in IMG/M
3300009068|Ga0114973_10353874All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage775Open in IMG/M
3300009068|Ga0114973_10723282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300009151|Ga0114962_10002080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage16995Open in IMG/M
3300009151|Ga0114962_10005618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9795Open in IMG/M
3300009151|Ga0114962_10026067All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4064Open in IMG/M
3300009151|Ga0114962_10096364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1849Open in IMG/M
3300009151|Ga0114962_10105103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1753Open in IMG/M
3300009151|Ga0114962_10561679All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales596Open in IMG/M
3300009151|Ga0114962_10726839Not Available506Open in IMG/M
3300009155|Ga0114968_10000035Not Available122003Open in IMG/M
3300009155|Ga0114968_10025088All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4057Open in IMG/M
3300009155|Ga0114968_10095723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1822Open in IMG/M
3300009158|Ga0114977_10010232Not Available5944Open in IMG/M
3300009158|Ga0114977_10697942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300009159|Ga0114978_10017338All Organisms → cellular organisms → Bacteria → Proteobacteria5380Open in IMG/M
3300009159|Ga0114978_10027222All Organisms → cellular organisms → Bacteria4123Open in IMG/M
3300009159|Ga0114978_10101851All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1896Open in IMG/M
3300009159|Ga0114978_10151515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1493Open in IMG/M
3300009159|Ga0114978_10270648All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1049Open in IMG/M
3300009159|Ga0114978_10277621All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1032Open in IMG/M
3300009159|Ga0114978_10390365All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage835Open in IMG/M
3300009159|Ga0114978_10530510All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300009160|Ga0114981_10131529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1383Open in IMG/M
3300009160|Ga0114981_10437904All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300009164|Ga0114975_10000393Not Available32931Open in IMG/M
3300009164|Ga0114975_10000446All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes31118Open in IMG/M
3300009164|Ga0114975_10000499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage29659Open in IMG/M
3300009164|Ga0114975_10002597Not Available12319Open in IMG/M
3300009164|Ga0114975_10010325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5828Open in IMG/M
3300009164|Ga0114975_10024111All Organisms → cellular organisms → Bacteria3671Open in IMG/M
3300009164|Ga0114975_10037579All Organisms → cellular organisms → Bacteria → Proteobacteria2882Open in IMG/M
3300009164|Ga0114975_10048268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2513Open in IMG/M
3300009164|Ga0114975_10123465All Organisms → Viruses → Predicted Viral1491Open in IMG/M
3300009164|Ga0114975_10174653All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300009164|Ga0114975_10417974All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage730Open in IMG/M
3300009164|Ga0114975_10524071All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales637Open in IMG/M
3300009164|Ga0114975_10573506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300009164|Ga0114975_10747622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage515Open in IMG/M
3300009164|Ga0114975_10765083Not Available508Open in IMG/M
3300009182|Ga0114959_10014264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5298Open in IMG/M
3300009182|Ga0114959_10167108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1158Open in IMG/M
3300009182|Ga0114959_10352937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage726Open in IMG/M
3300009183|Ga0114974_10468599Not Available711Open in IMG/M
3300009187|Ga0114972_10595672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300009419|Ga0114982_1003161All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6863Open in IMG/M
3300009419|Ga0114982_1004396All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5592Open in IMG/M
3300009419|Ga0114982_1033308All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1666Open in IMG/M
3300009419|Ga0114982_1144152Not Available735Open in IMG/M
3300010157|Ga0114964_10078644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1665Open in IMG/M
3300010160|Ga0114967_10182755All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1140Open in IMG/M
3300010334|Ga0136644_10087773All Organisms → Viruses → Predicted Viral1947Open in IMG/M
3300010885|Ga0133913_10192858All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5434Open in IMG/M
3300010885|Ga0133913_10772019Not Available2507Open in IMG/M
3300010885|Ga0133913_10882983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2323Open in IMG/M
3300010885|Ga0133913_12503324All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1257Open in IMG/M
3300010885|Ga0133913_12611178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1226Open in IMG/M
3300010885|Ga0133913_13205796All Organisms → Viruses → Predicted Viral1081Open in IMG/M
3300011010|Ga0139557_1003619All Organisms → Viruses → Predicted Viral3350Open in IMG/M
3300011010|Ga0139557_1010414All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1828Open in IMG/M
3300011011|Ga0139556_1028893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage812Open in IMG/M
3300012352|Ga0157138_1004626All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2325Open in IMG/M
3300012663|Ga0157203_1000207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage19749Open in IMG/M
3300012663|Ga0157203_1002669Not Available3919Open in IMG/M
3300012663|Ga0157203_1006511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2141Open in IMG/M
3300012663|Ga0157203_1010665Not Available1520Open in IMG/M
3300012663|Ga0157203_1011378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1451Open in IMG/M
3300012663|Ga0157203_1014541Not Available1224Open in IMG/M
3300012663|Ga0157203_1018991All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1019Open in IMG/M
3300012663|Ga0157203_1051644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300012665|Ga0157210_1000190All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage30350Open in IMG/M
3300012665|Ga0157210_1000235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage26884Open in IMG/M
3300012665|Ga0157210_1002548All Organisms → cellular organisms → Bacteria4639Open in IMG/M
3300012665|Ga0157210_1005543All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2556Open in IMG/M
3300012665|Ga0157210_1007314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2096Open in IMG/M
3300012665|Ga0157210_1039328All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300012665|Ga0157210_1039928Not Available724Open in IMG/M
3300012667|Ga0157208_10008213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1526Open in IMG/M
3300013004|Ga0164293_10149705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1735Open in IMG/M
3300013004|Ga0164293_10525684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage777Open in IMG/M
3300013005|Ga0164292_10152071Not Available1690Open in IMG/M
3300013006|Ga0164294_10000156Not Available62615Open in IMG/M
3300013285|Ga0136642_1001903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8563Open in IMG/M
3300013285|Ga0136642_1096817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage763Open in IMG/M
3300013285|Ga0136642_1101418All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300013285|Ga0136642_1109131Not Available708Open in IMG/M
3300013285|Ga0136642_1156259Not Available566Open in IMG/M
3300013286|Ga0136641_1000730Not Available13915Open in IMG/M
3300013286|Ga0136641_1007584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3757Open in IMG/M
3300013286|Ga0136641_1033319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1545Open in IMG/M
3300013372|Ga0177922_11320426Not Available592Open in IMG/M
3300017761|Ga0181356_1086492All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium1035Open in IMG/M
3300017778|Ga0181349_1023572All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2500Open in IMG/M
3300017780|Ga0181346_1302970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300017784|Ga0181348_1135021Not Available936Open in IMG/M
3300019784|Ga0181359_1004201All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4546Open in IMG/M
3300019784|Ga0181359_1060584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1449Open in IMG/M
3300020141|Ga0211732_1039183All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage862Open in IMG/M
3300020141|Ga0211732_1043497Not Available1384Open in IMG/M
3300020141|Ga0211732_1067323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1969Open in IMG/M
3300020141|Ga0211732_1104413Not Available3499Open in IMG/M
3300020141|Ga0211732_1143192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage18644Open in IMG/M
3300020141|Ga0211732_1250121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage609Open in IMG/M
3300020151|Ga0211736_10270451Not Available1806Open in IMG/M
3300020151|Ga0211736_10369794All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3615Open in IMG/M
3300020151|Ga0211736_10411071All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1143Open in IMG/M
3300020151|Ga0211736_10951476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2063Open in IMG/M
3300020151|Ga0211736_10986588All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1171Open in IMG/M
3300020159|Ga0211734_10742353All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2820Open in IMG/M
3300020160|Ga0211733_11109289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3040Open in IMG/M
3300020161|Ga0211726_10714979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300020162|Ga0211735_10986525Not Available558Open in IMG/M
3300020205|Ga0211731_10262278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage623Open in IMG/M
3300020205|Ga0211731_10438098Not Available912Open in IMG/M
3300020205|Ga0211731_10822917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1819Open in IMG/M
3300020528|Ga0208224_1007618All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300020528|Ga0208224_1023980Not Available835Open in IMG/M
3300020566|Ga0208222_1052631Not Available716Open in IMG/M
3300020572|Ga0207909_1058959Not Available582Open in IMG/M
3300021141|Ga0214163_1099822All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales673Open in IMG/M
3300021336|Ga0210307_1209669Not Available702Open in IMG/M
3300021519|Ga0194048_10031775All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2217Open in IMG/M
3300021519|Ga0194048_10192790All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage756Open in IMG/M
3300021956|Ga0213922_1110085Not Available549Open in IMG/M
3300021963|Ga0222712_10438677All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage785Open in IMG/M
3300022190|Ga0181354_1080107All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1078Open in IMG/M
3300022407|Ga0181351_1253101Not Available547Open in IMG/M
3300022407|Ga0181351_1272155Not Available514Open in IMG/M
3300022602|Ga0248169_104146Not Available15641Open in IMG/M
3300024346|Ga0244775_10006029Not Available12157Open in IMG/M
3300024346|Ga0244775_10078020All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2834Open in IMG/M
3300024346|Ga0244775_10115623Not Available2275Open in IMG/M
3300024346|Ga0244775_10123448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2193Open in IMG/M
3300024346|Ga0244775_10168980All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1842Open in IMG/M
3300024346|Ga0244775_10403193All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300024346|Ga0244775_10460133Not Available1042Open in IMG/M
3300024346|Ga0244775_10718277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300024346|Ga0244775_11177292All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300024853|Ga0255252_1083315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300025358|Ga0208504_1000034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage38055Open in IMG/M
3300027145|Ga0255114_1067161Not Available622Open in IMG/M
3300027292|Ga0255134_1080467Not Available505Open in IMG/M
3300027418|Ga0208022_1061244Not Available815Open in IMG/M
3300027534|Ga0255125_1068993Not Available734Open in IMG/M
3300027563|Ga0209552_1041942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1317Open in IMG/M
3300027563|Ga0209552_1086546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage851Open in IMG/M
3300027586|Ga0208966_1118206Not Available718Open in IMG/M
3300027586|Ga0208966_1155244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300027600|Ga0255117_1013845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1892Open in IMG/M
3300027608|Ga0208974_1000045All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage55066Open in IMG/M
3300027608|Ga0208974_1000112Not Available35732Open in IMG/M
3300027608|Ga0208974_1001112All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage10634Open in IMG/M
3300027608|Ga0208974_1009610Not Available3173Open in IMG/M
3300027621|Ga0208951_1181010Not Available535Open in IMG/M
3300027631|Ga0208133_1013887All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2159Open in IMG/M
3300027642|Ga0209135_1099390All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage978Open in IMG/M
3300027644|Ga0209356_1145184All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage666Open in IMG/M
3300027679|Ga0209769_1018810Not Available2449Open in IMG/M
3300027679|Ga0209769_1209654Not Available602Open in IMG/M
3300027708|Ga0209188_1021931All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3243Open in IMG/M
3300027708|Ga0209188_1056282All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1721Open in IMG/M
3300027708|Ga0209188_1148848Not Available886Open in IMG/M
3300027708|Ga0209188_1247205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300027710|Ga0209599_10007407All Organisms → cellular organisms → Bacteria → Proteobacteria3576Open in IMG/M
3300027710|Ga0209599_10010962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2768Open in IMG/M
3300027710|Ga0209599_10053883All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1061Open in IMG/M
3300027710|Ga0209599_10120446Not Available693Open in IMG/M
3300027732|Ga0209442_1000022Not Available89871Open in IMG/M
3300027732|Ga0209442_1156249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage875Open in IMG/M
3300027732|Ga0209442_1162242All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage853Open in IMG/M
3300027733|Ga0209297_1097621All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1262Open in IMG/M
3300027734|Ga0209087_1013070All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4196Open in IMG/M
3300027736|Ga0209190_1058766All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1904Open in IMG/M
3300027746|Ga0209597_1000008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage116631Open in IMG/M
3300027749|Ga0209084_1000399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage40377Open in IMG/M
3300027749|Ga0209084_1011102All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5425Open in IMG/M
3300027749|Ga0209084_1102214Not Available1261Open in IMG/M
3300027756|Ga0209444_10173579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage804Open in IMG/M
3300027759|Ga0209296_1000991Not Available23109Open in IMG/M
3300027759|Ga0209296_1007046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7039Open in IMG/M
3300027759|Ga0209296_1007992Not Available6543Open in IMG/M
3300027759|Ga0209296_1016061All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4364Open in IMG/M
3300027759|Ga0209296_1163830All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium986Open in IMG/M
3300027759|Ga0209296_1283846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300027763|Ga0209088_10092783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1395Open in IMG/M
3300027763|Ga0209088_10281583Not Available680Open in IMG/M
3300027763|Ga0209088_10343272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage592Open in IMG/M
3300027769|Ga0209770_10003110Not Available8193Open in IMG/M
3300027769|Ga0209770_10136370All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage995Open in IMG/M
3300027769|Ga0209770_10316214All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300027782|Ga0209500_10066690Not Available1866Open in IMG/M
3300027782|Ga0209500_10082826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1624Open in IMG/M
3300027782|Ga0209500_10139257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1154Open in IMG/M
3300027782|Ga0209500_10315135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage657Open in IMG/M
3300027785|Ga0209246_10018340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2613Open in IMG/M
3300027797|Ga0209107_10026388All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3340Open in IMG/M
3300027797|Ga0209107_10526641All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage521Open in IMG/M
3300027798|Ga0209353_10047503All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1977Open in IMG/M
3300027798|Ga0209353_10073840All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1551Open in IMG/M
3300027892|Ga0209550_10008041All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9749Open in IMG/M
3300027963|Ga0209400_1000145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes62162Open in IMG/M
3300027963|Ga0209400_1009735All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6157Open in IMG/M
3300027963|Ga0209400_1085898All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1503Open in IMG/M
3300027969|Ga0209191_1001632Not Available14679Open in IMG/M
3300027969|Ga0209191_1012532All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4442Open in IMG/M
3300027969|Ga0209191_1015450All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3910Open in IMG/M
3300027969|Ga0209191_1021215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3216Open in IMG/M
3300027969|Ga0209191_1100052All Organisms → Viruses → Predicted Viral1237Open in IMG/M
3300027969|Ga0209191_1276638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage630Open in IMG/M
3300028393|Ga0304728_1182126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage740Open in IMG/M
3300028394|Ga0304730_1004420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9216Open in IMG/M
3300028394|Ga0304730_1024668All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3198Open in IMG/M
3300032092|Ga0315905_10023420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6260Open in IMG/M
3300032092|Ga0315905_10942549All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage733Open in IMG/M
3300033978|Ga0334977_0027612Not Available3223Open in IMG/M
3300033992|Ga0334992_0001335All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage19561Open in IMG/M
3300033994|Ga0334996_0303347Not Available793Open in IMG/M
3300034082|Ga0335020_0027997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3112Open in IMG/M
3300034082|Ga0335020_0038540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2574Open in IMG/M
3300034093|Ga0335012_0080428All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1841Open in IMG/M
3300034102|Ga0335029_0300069Not Available1014Open in IMG/M
3300034102|Ga0335029_0666560All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales570Open in IMG/M
3300034356|Ga0335048_0425073Not Available653Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake28.57%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake23.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.52%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic5.71%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater5.40%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.44%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.81%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine3.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.86%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.54%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment1.59%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.59%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.27%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater0.63%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.63%
Freshwater And MarineEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine0.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.32%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.32%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300000882Freshwater microbial communities from the Columbia RiverEnvironmentalOpen in IMG/M
3300002139M3t2BS2 (117f)EnvironmentalOpen in IMG/M
3300002142M2t3t2 FKB2 (115f)EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003394Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300003497Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DNEnvironmentalOpen in IMG/M
3300003783Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08EnvironmentalOpen in IMG/M
3300003986Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004124Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)EnvironmentalOpen in IMG/M
3300004763Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004810Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005415Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300007545Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3EnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012352Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37EnvironmentalOpen in IMG/M
3300012663Freshwater microbial communities from Indian River, Ontario, Canada - S50EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012667Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013285Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31YEnvironmentalOpen in IMG/M
3300013286Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23YEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020528Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020572Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021141Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnionEnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022602Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024853Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025358Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300027145Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027292Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8dEnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027534Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027600Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027642Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027710Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027746Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034082Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088EnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12421J11937_1003801123300000756Freshwater And SedimentMKTIVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS*
JGI12421J11937_1014717533300000756Freshwater And SedimentMKTILNTVWSVIVAFGEARYAASLARQGRIEESKAVYNGRA*
JGI12421J11937_1017185013300000756Freshwater And SedimentMKTIVNSIWSFLEAFGQARYAASLARQGRIEESKAVYNGPA*
FwDRAFT_1029235433300000882Freshwater And MarineMKTIVNAIWAFLEAFGQARAAASLARQGRIAEAKAIYGA*
M3t2BS2_187618723300002139MarineMKTILNSIWSFLEALGQARYAASLARQGRISEAKAVYK*
M2t2FKB2_105026733300002142MarineMKTILNSIWSFLEALGQARYAASLARQGRISEAKAVY
B570J29032_10959989623300002408FreshwaterMNSILNSILNSIWSVLESFAQARAAAVLARQGRIEEAKAVYGN*
B570J40625_10007803073300002835FreshwaterMKKIVNSIWSFLEALGQARAASILARQGRIEEAKAIYGA*
B570J40625_10024234523300002835FreshwaterMKTILNSIWSFLEAFGEARYAASLARQGRTEEAKAVYGA*
B570J40625_10058621123300002835FreshwaterMKTILNSIWAVLEAFGQARYAASLARQGRIAESKAVYES*
B570J40625_10065908613300002835FreshwaterMKTILNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA*
B570J40625_10091250223300002835FreshwaterMKTILNTIWSFLEAFGQARYAASLARQGRTEEAKAVYGS*
JGI25908J49247_1000049193300003277Freshwater LakeMNSILNSIWSVLEAFGQARAAASLARQGRIDEAKAVYNGQQ*
JGI25908J49247_10000658163300003277Freshwater LakeMKTILNTIWSVLEAFGQARYAASLARQGRVEESKAVYNGRA*
JGI25908J49247_1000203793300003277Freshwater LakeMKTILNSIWSVLESFAQARAAASLARQGRIDEAKAVYTN*
JGI25908J49247_10002163123300003277Freshwater LakeMKKIVNSLWSFLEALGQARAASILARQGRIEEAKAVYNGPA*
JGI25908J49247_1000297233300003277Freshwater LakeMKTILNTIWSVIVAFGEARYAASLARQGRIEESKAVYNGRA*
JGI25908J49247_1000973033300003277Freshwater LakeMKTITNAIWSFLEAFGQARYAASLARQGRIAESKAVYNGPA*
JGI25908J49247_1001121623300003277Freshwater LakeMKTILNSIWSFLEAFGQARVAASLARQGRIEESKAVYNGPA*
JGI25908J49247_1001561153300003277Freshwater LakeMKTIVNTIWLFLEAFGQARAAASLARQGRIAEAKAVYGN*
JGI25908J49247_1002348743300003277Freshwater LakeMKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN*
JGI25908J49247_1005794223300003277Freshwater LakeMKTILNTIWSWLVAFGEARYAASLARQGRVAEAKAVYGS*
JGI25908J49247_1008685133300003277Freshwater LakeMKTIXNSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA*
JGI25908J49247_1015329423300003277Freshwater LakeMKTILNSIWSVLEAFGQARAAASLVRQGRIAEAKAIYGN*
JGI25908J49247_1015798123300003277Freshwater LakeMKTIINSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA*
JGI25910J50241_1000298423300003388Freshwater LakeMKTILNSIWSVLESFGQARAAASLARQGKIAEAKAIYGN*
JGI25910J50241_1001567073300003388Freshwater LakeMKTILNTIWSVLEAFGQARYAASLARQGRVEESKAVYNGRA
JGI25910J50241_1016649223300003388Freshwater LakeMKTIVNSIWSLLEVFGQARYAASLARQGRIAEAKAVYGA*
JGI25907J50239_1001054103300003394Freshwater LakeMKTILNSIWSVLESFGQARAAASLARQGRIDEAKAVYTN*
JGI25911J50253_1000932763300003411Freshwater LakeMKTILNSIWSFLETFGQARVAASLARQGRIEESKAVYNGPA*
JGI25925J51416_1007706533300003497Freshwater LakeMKTITNAIWSFLEAFGQARAAASLARXGRIEEAKAVYTN*
JGI25925J51416_1015857823300003497Freshwater LakeTTLKKGXLXMKTIVNSIWSLLEXFGQARXAAXLARQGRIXEAKAVYGA*
Ga0007850_1000110103300003783FreshwaterMKSILKSIWTVLEAVGQARYAAHLARQGRIADAKAIYGE*
Ga0063233_1009393133300003986Freshwater LakeSMKTITNAIWSFLEAFAQARAAASLARMGDIEGAKAVYK*
Ga0065166_1023066823300004112Freshwater LakeMKTILNSIWSFLVAFGEARYAASLARQGRVEEAKAVYNN*
Ga0066178_1006768013300004124Freshwater LakeIQFSKGTLSMKTILNTIWSWLVAFGEARYAASLARQGRVAEAKAVYGS*
Ga0007746_104930943300004763Freshwater LakeMKTIINSIWSFLEAFGQARYAASLARQGRVEESKAVYNGRA*
Ga0007748_1142694413300004769Freshwater LakeSMKTITNAIWSFLEVFAQARAAASLARMGDIEGAKAAYK*
Ga0007757_1147072723300004810Freshwater LakeMKTILNTIWSWLEAFGQARYAASLARQGRMEESKAVYNGRA*
Ga0007743_128475733300005415Freshwater LakeMNSILNSIWSVLEAFGQARAAASLARQGRIDEAKAVYNGQQ*SSRIGG
Ga0007743_130597333300005415Freshwater LakeMKTIVNSIWSFLESFAQARAAASLARQGRIEEAKAIYGN*
Ga0070374_1001190343300005517Freshwater LakeMKTITNAIWSFLEAFAQARAAASLARMGDIEGAKAVYK*
Ga0070374_1001340333300005517Freshwater LakeMKTILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0070374_1001362333300005517Freshwater LakeMKTITNAIWSFLEVFAQARAAASLARMGDIEGAKAAYK*
Ga0070374_1002577263300005517Freshwater LakeMKTIINTIWSWLEAFGQARYAASLARQGRIEESKAVYNGRA*
Ga0070374_1016105243300005517Freshwater LakeMKNILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0070374_1018535223300005517Freshwater LakeMKTIVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA*
Ga0070374_1069990023300005517Freshwater LakeMKTILNSIWSMLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0068876_1002163073300005527Freshwater LakeMKTITNAIWSFLQAFGQARAAASLARQGRIEEAKAIYGN*
Ga0049081_1000032953300005581Freshwater LenticMKTILNTIWSVIVAFGEARYAASLARQGRVEEAKAVYDGPA*
Ga0049081_1001124343300005581Freshwater LenticMKTILNSIWSVLVAFGEARYAASLARQGKIKESKAVYGA*
Ga0049081_1005178033300005581Freshwater LenticMKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN*
Ga0049080_1001909153300005582Freshwater LenticMKTILNSIWSVLVSFGEARYAASLARQGKIKESKAVYGA*
Ga0049080_1002666263300005582Freshwater LenticMKTIVNTFWSFLEAFGQARAAAILARQGRIEEAKAIYIN*
Ga0049080_1004263623300005582Freshwater LenticMKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGN*
Ga0049080_1006822823300005582Freshwater LenticMKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYRA*
Ga0049080_1009964933300005582Freshwater LenticMKTILNSIWSVLEAFGQARAAASLVRQGRIAEAKAVYGN*
Ga0049085_1014937133300005583Freshwater LenticMKTFTNAIWSFLEAFGQARAAASLARQGRIEEAKAVYNAQA*
Ga0049085_1019437633300005583Freshwater LenticMKTILNSIWSFLEAFGQARVAASLARQGRIEEAKAVYGN*
Ga0049082_1007164743300005584Freshwater LenticMKTIVNAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA*
Ga0078894_10016774103300005662Freshwater LakeMKSFINAIWSFLESVGQARAAASLARLGKIEEAKAIFSK*
Ga0078894_10017187103300005662Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGA*
Ga0078894_1002838163300005662Freshwater LakeMKTIIDAIWSFLEAFGQARAAASLARQGRIDEAKAVYE*
Ga0078894_1010275463300005662Freshwater LakeMKTIANYLWSMLEAFGQARAAASLARMGDIEGAKSVYK*
Ga0078894_1016396843300005662Freshwater LakeMKTFIKSIWSFLEAFAQARAAASLARQGKTAEAKAVYGS*
Ga0078894_1026365643300005662Freshwater LakeMKTILNSIWSFLVAFGEARYAASLARQGRVAEAKAVYGS*
Ga0078894_1027602443300005662Freshwater LakeMKSILNSIWSVLEAFGQARYAASLARQGRTEEAKAVYGA*
Ga0078894_1028044743300005662Freshwater LakeMKTIVNSIWSFLESFAQARAAASLARQGRVEEAKAVYTN*
Ga0078894_1032867623300005662Freshwater LakeMKTILNSIWSFLVAFGEARYAASLARQGRTEEAKAIYNN*
Ga0078894_1038136423300005662Freshwater LakeMKNFIQSIWSFFESFGQARYAAFLARQGRIEEAKAIYSK*
Ga0078894_1067560233300005662Freshwater LakeMKTILNSIWSFLVAFGEARYAASLARQGRVEEAKAVYGA*
Ga0078894_1068442023300005662Freshwater LakeMKTILTSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA*
Ga0078894_1114928713300005662Freshwater LakeISMKNFINSFWSFLEAFGQARYATFLTRQGRIDEAKALYE*
Ga0070743_1011978523300005941EstuarineMKTITNAIWSFLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0070744_1003300443300006484EstuarineMKTIVNSIWSFLEAFAQARAAASLARQGKIAESKAVYK*
Ga0102873_121370213300007545EstuarineLSMKTIVNAIWAFLEAFGQARAAASLARQGRIAEAKAIYGA*
Ga0102877_117875123300007548EstuarineMNSITNAIWSFLEAFGQARAAASLARQGRIAESKAVYNGPA*
Ga0102881_112151823300007551EstuarineKSIWSFLEAFGQARYAASLARQGRTEEAKAVYRA*
Ga0102828_103560713300007559EstuarineMKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYTN*
Ga0102919_113261123300007597EstuarineMKTIINSIWSFLEAFGQARTAASLARQGKIDEAKAVYGN*
Ga0102903_112834633300007630EstuarineMKTIVNSIWSFLEAFGQARTAASLARQGRVAEAKAVYGS*
Ga0102876_106002043300007642EstuarineLSMKTILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0114344_100156263300008111Freshwater, PlanktonMKTITNAIWSFLQALGQARAAASLARQGRIEEAKAIYGN*
Ga0114344_101791423300008111Freshwater, PlanktonMKTITNAIWSFLVAFGEARYAASLARQGRVAEAKDVYKS*
Ga0114346_104439423300008113Freshwater, PlanktonMKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGN*
Ga0114346_128170733300008113Freshwater, PlanktonMKTILNYIWTVLEAFGQARYAASLARQGRTEEAKA
Ga0114354_107999923300008119Freshwater, PlanktonMKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGA*
Ga0102889_123148223300008964EstuarineMKTIINTIWSFLVAFGQARYAASLARQGRIEESKAVYNGQA*
Ga0102816_118480313300008999EstuarineMKTIINSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS*
Ga0102829_131977113300009026EstuarineITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGN*
Ga0114973_1014489233300009068Freshwater LakeMKTILNSIWSFLEAFAQARAAASLARQGKIAESKAVYGN*
Ga0114973_1035387423300009068Freshwater LakeMKKIINSIWSLLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114973_1072328223300009068Freshwater LakeMKTILNSIWSVLEAFGQARYAASLARQGRIAESKAVYGS*
Ga0114962_10002080153300009151Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYK*
Ga0114962_1000561843300009151Freshwater LakeMKTVLNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA*
Ga0114962_1002606733300009151Freshwater LakeMKTIVNAIWSFLESFAQARAAASLARQGRVEEAKAIYGS*
Ga0114962_1009636423300009151Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114962_1010510323300009151Freshwater LakeMKSIINSIWSVLLTFGEARYAASLARQGRVAEAKAVYRN*
Ga0114962_1056167923300009151Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLARQGKIAESKAVYGA*
Ga0114962_1072683923300009151Freshwater LakeMKSVLNTIWSVLVSFGEARHAASLARQGRVAEAKAVYGA*
Ga0114968_1000003543300009155Freshwater LakeMKKVLNAIWLFLVAFGEARYAASLARQGRVAEAKAVYGA*
Ga0114968_1002508863300009155Freshwater LakeMKTIINSIWSFLEAFGQARAAASLARQGKIAESKAVYGS*
Ga0114968_1009572333300009155Freshwater LakeMKTVLNSIWSFLEAFGQARYAASLVRQGRITEAKAVYGS*
Ga0114977_1001023243300009158Freshwater LakeMKTIINSIWSFLEAFGQARAAASLARMGDIEGAKAVYK*
Ga0114977_1069794213300009158Freshwater LakeGKISMKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGA*
Ga0114978_1001733813300009159Freshwater LakeMKTVLNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGS*
Ga0114978_1002722273300009159Freshwater LakeMKTILNSIWSFLESFAQARAAASLARQGRIEEAKAVYTN*
Ga0114978_1010185133300009159Freshwater LakeMKTILNSIWSFLEAFGQARAAASLARQGKIAESKAIYGS*
Ga0114978_1015151543300009159Freshwater LakeMKTIVNSIWSVLEAFGQARAAASLARQGRIAEAKAVYK*
Ga0114978_1027064823300009159Freshwater LakeMKTILNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA*
Ga0114978_1027762123300009159Freshwater LakeMKTFVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS*
Ga0114978_1039036523300009159Freshwater LakeMKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114978_1053051013300009159Freshwater LakeKTITNAIWSFLEAFGQARAAASLARQGKIAESKAVYGS*
Ga0114981_1013152943300009160Freshwater LakeMKTILNTIWSFLEAFGQARYAASLARQGRTEEAKAV
Ga0114981_1043790423300009160Freshwater LakeMKTIVNSIWSFFEAMGQARAAASLARLGDIAGAKAIYK*
Ga0114975_10000393133300009164Freshwater LakeMKTILNSIWSVLESFAQARAAAVLVRQGRIEEAKAVYGA*
Ga0114975_10000446473300009164Freshwater LakeMKTIINSIWSFLEAFGQARAAASLARQGRVAEAKA
Ga0114975_1000049923300009164Freshwater LakeMKTIINSIWSFLEAFGQARAAASLARQGRVAEAKAVYGA*
Ga0114975_10002597163300009164Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLARQGRFEEAKAVYGA*
Ga0114975_1001032553300009164Freshwater LakeMKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGS*
Ga0114975_1002411133300009164Freshwater LakeMKTILNSIWSVLEAFGQARYAASLARQGRVEEAKAIYGS*
Ga0114975_1003757923300009164Freshwater LakeMKTVLNSIWSVLVSFGEARYAASLARQGRIAEAKAIYNN*
Ga0114975_1004826863300009164Freshwater LakeMKNFINAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA*
Ga0114975_1012346533300009164Freshwater LakeMKTILNAIWSFLVAFGEARYAASLARQGKIDKAKAVYGS*
Ga0114975_1017465323300009164Freshwater LakeMKTILNSIWSFLEAFGQARTAASLVRQGRIEEAKAVYGS*
Ga0114975_1041797433300009164Freshwater LakeMKSVLNTIWSFLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114975_1052407123300009164Freshwater LakeMKTILNSIWSFLESFAQARAAASLARQGRIEEAKAVYGS*
Ga0114975_1057350623300009164Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLARQGRVAEAKAVYGS*
Ga0114975_1074762223300009164Freshwater LakeMKTILNSIWSWLEAFGQARAAASLARQGRVAEAKAVYGA*
Ga0114975_1076508313300009164Freshwater LakeMKTIVNSIWSWLEAFGQARAAASLARQGRIAEAKAVYGA*
Ga0114959_1001426473300009182Freshwater LakeMKSIFNSIWSFLEAFGEARYAASLARQGRTAEAKALYGG*
Ga0114959_1016710843300009182Freshwater LakeMKSVLNTIWSVLVSFGEARYAASLARQGRVAEAKAVYGA*
Ga0114959_1035293733300009182Freshwater LakeMKSILNSIWSVLVAFGEARYAASLARQGRVAEAKAVYGN*
Ga0114974_1046859923300009183Freshwater LakeMKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAIYGA*
Ga0114972_1059567213300009187Freshwater LakeILNSIWSFLEAFAQARAAASLARQGKIAESKAVYGN*
Ga0114982_100316133300009419Deep SubsurfaceMKTIANSIWSFLEAFGQARAAAILARQGRVEEAKAIYGS*
Ga0114982_100439683300009419Deep SubsurfaceMKTIVNSIWSFLEAFGQARAAAILARQGKIEEAKAVYGS*
Ga0114982_103330833300009419Deep SubsurfaceMKTFIKSIWSFLEAFAQARAAASLARQGKIDEAKAVYGS*
Ga0114982_114415233300009419Deep SubsurfaceMKTILNTIWSVLVAFGEARYAASLARQGRIDEAKAVYGS*
Ga0114964_1007864433300010157Freshwater LakeMKSVLNTIWSILLSFGEARHAASLARQGRVAEAKAVYGA*
Ga0114967_1018275523300010160Freshwater LakeMKTIINTIWSWLEAFGQARCAASLARQGRIAEAKAVYGA*
Ga0136644_1008777353300010334Freshwater LakeTVPMKSVLNTIWSVLVSFGEAGHAASLARQGRVAEAKAVYGA*
Ga0133913_10192858113300010885Freshwater LakeMKTVVNAIWSFLEAFGQARAAASLARQGKIAESKAVYGS*
Ga0133913_1077201913300010885Freshwater LakeMKTIINSIWSFLEAFGQARAAASLARQGRIEEAKAIYGA*
Ga0133913_1088298353300010885Freshwater LakeMKTVLNSIWSFLVAFGEARYAASLARQGRVAEAKAIYNN*
Ga0133913_1250332423300010885Freshwater LakeMKSIVKSIWSFLETFGQARAAASLARQGRVAEAKAIYGA*
Ga0133913_1261117823300010885Freshwater LakeMKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGA*
Ga0133913_1320579623300010885Freshwater LakeMKTILNSIWSFLEAFGQARAAASLARQGKFNEAKAVYGN*
Ga0139557_100361913300011010FreshwaterMKTILNSIWSVLESFAQARAAASLARQGRIDEAKAVY
Ga0139557_101041423300011010FreshwaterMKTILNTIWSVLVAFGEARYAASLARQGRIEESKAVYNGRA*
Ga0139556_102889313300011011FreshwaterMKTILNSIWSFLEAFGQARAAASLARQGRIEEAKAVYTN*
Ga0157138_100462643300012352FreshwaterMKTIINKLWSILESFGQARYAASLARQGRVDEAKAVYE*
Ga0157203_100020793300012663FreshwaterMKTILNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGN*
Ga0157203_1002669103300012663FreshwaterMKIILNSIWSFLEAFGQARVAASLARQGKIEEAKAMYGA*
Ga0157203_100651143300012663FreshwaterMKTILNSIWSVLESFAQARAAAVLARQGKIEEAKAVYGA*
Ga0157203_101066513300012663FreshwaterMKTILNTIWSVIVAFGEARYAASLARQGRIAEAKAVYGA*
Ga0157203_101137833300012663FreshwaterMKTIVKSIWSFLEAFGQARAAAILARQGRIEEAKAVYTN*
Ga0157203_101454133300012663FreshwaterMKTFLNSIWSVLEAFGQARAAATLARIGDIEGAKAVYK*
Ga0157203_101899133300012663FreshwaterMKTILNSIWSFLVAFGEARYAASLARQGRVAEAKAVYGA*
Ga0157203_105164423300012663FreshwaterMKTFLNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA*
Ga0157210_1000190443300012665FreshwaterMKSILNSIWSVLEAFGQARAAATLARIGDIEGAKAVYK*
Ga0157210_1000235143300012665FreshwaterMKSILNTIWSVLESFGQARYAASLARQGRVDEAKAVYE*
Ga0157210_100254843300012665FreshwaterMKTFLNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGS*
Ga0157210_100554343300012665FreshwaterMKQFFNTIWNVLVAIGEARYAASLARQGRIEEAKAVYGA*
Ga0157210_100731443300012665FreshwaterMKTIANSIWLFLEAFGQARYAASLARQGRTEEAKAVYRS*
Ga0157210_103932823300012665FreshwaterMKTILNYIWTALMAFSEARYAASLARQGRFDEAKAVYE*
Ga0157210_103992823300012665FreshwaterMKQIFNTIWSVLVAFGEARYAASLARQGRVAEAKAVYGS*
Ga0157208_1000821343300012667FreshwaterMKTIVKSIWSFLEAFGQARAAAILARQGRVAEAKAVYGA*
Ga0164293_1014970513300013004FreshwaterMKTIVNSIWLFLEAFGQARDAASLARQGRIEEAKAVYGN*
Ga0164293_1052568413300013004FreshwaterKGNLSMKTILNSIWSFLEAFGQARYAASLARQGRTEEAKAVYGA*
Ga0164292_1015207153300013005FreshwaterMKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGN*
Ga0164294_10000156473300013006FreshwaterMKTIFNSIWSVLEAFAQARAAASLARMGDIEGAKAVYK*
Ga0136642_1001903143300013285FreshwaterMKSITNAIWSFLEAFGQARAAASLARQGRVTEAKALYGR*
Ga0136642_109681723300013285FreshwaterMKTILNSIWSFLEAFGQARAAASLARQGRVAEAKAVYGA*
Ga0136642_110141823300013285FreshwaterMKYILKSIWSVLEAVGEARYAAHLARQGRIADAKAVYGE*
Ga0136642_110913133300013285FreshwaterMKTILNSIWSFLEVFGQARAAASLARQGKIAESKAVYGA*
Ga0136642_115625923300013285FreshwaterMKSIVNSIWSFFEAMGQARAAASLARIGDIAGAKAIYK*
Ga0136641_100073033300013286FreshwaterMKTILNSIWSFLEVFGQARYAASLARQGRTAEAKAVYGK*
Ga0136641_100758483300013286FreshwaterMKTILNSIWLFLETFGQARYAASLARQGRTAEAKAVYGA*
Ga0136641_103331923300013286FreshwaterMKTITSAIWSFLEIFGQARAAASLARQGKIAESKAVYGA*
Ga0177922_1132042633300013372FreshwaterMKTILNSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA*
Ga0181356_108649243300017761Freshwater LakeMKTILNSMWSVLEAFGQARAAASLARMGDIEGAKAVYK
Ga0181349_102357253300017778Freshwater LakeMKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGN
Ga0181346_130297013300017780Freshwater LakeELSKGNISMKTILNSIWSVLESFGQARAAASLARQGKIAEAKAIYGN
Ga0181348_113502143300017784Freshwater LakeMKTILNSIWSFLETFGQARVAASLARQGRIEESKAVYNG
Ga0181359_100420123300019784Freshwater LakeMKTILNSIWSVLEAFGQARAAASLVRQGRIAEAKAIYGN
Ga0181359_106058423300019784Freshwater LakeMKTIVNTIWLFLEAFGQARAAASLARQGRIAEAKAVYGN
Ga0211732_103918323300020141FreshwaterMKTIVKSIWSFLEAFAQARAAASLARQGRVEEAKAVYGA
Ga0211732_104349723300020141FreshwaterMKNFINAIWSFLEAFGQARAAASLARQGRIAEAKSIYGA
Ga0211732_106732333300020141FreshwaterMKTIVNSIWSFLEAFGQARAAASLARQGKIDEAKAVYGN
Ga0211732_110441353300020141FreshwaterMKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGN
Ga0211732_1143192153300020141FreshwaterMKTIINSIWSFLEAFGQARAAASLARQGKTAEAKAIYGA
Ga0211732_125012113300020141FreshwaterMKQVLNTILQFLEAFGQARAAASLARQGRINEAKAVYAK
Ga0211736_1027045133300020151FreshwaterMKQVLNTILQFLEAFGQARAAASLTRQGRIDEAKAIYAK
Ga0211736_1036979473300020151FreshwaterMKTIVNSIWSFLEAFGQVRAAASLARQGRVEEAKAVYIN
Ga0211736_1041107123300020151FreshwaterMKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYGN
Ga0211736_1095147623300020151FreshwaterMKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAIYTN
Ga0211736_1098658843300020151FreshwaterMKTIINSIWSFLVAFGEARYAASLARQGRVEEAKAVYGA
Ga0211734_1074235343300020159FreshwaterMKQVLNTIFQFLEAFGQARAAASLARQGRIDEAKAIYAK
Ga0211733_1110928973300020160FreshwaterMKNIINSIWSFLEAFGQARAASILARQGRIEEAKAIYGN
Ga0211726_1071497913300020161FreshwaterMKNIINSIWSFLEAFGQARAASILARQGKIEEAKAIYGN
Ga0211735_1098652523300020162FreshwaterMKTILNTIWSVIVSFGEARYAASLARQGRVEEAKAVYNGPA
Ga0211731_1026227813300020205FreshwaterMKTIVNSIWSFLEAFAQARAAASLARQGKIEEAKAVYGA
Ga0211731_1032311433300020205FreshwaterLNTILQFFEAMGQARAAASLTRQGRINEAKAIYAK
Ga0211731_1043809833300020205FreshwaterMKTIINSVWSFLEAFGQARAAASLARQGRIEEAKAIYE
Ga0211731_1082291753300020205FreshwaterMKTIVNSIWSLLEAFGQARAAASLARQGKIEEAKAVYKA
Ga0211731_1135126433300020205FreshwaterMKQVLNTILQFFEAMGQARAAASLTRQGRIDEAKAIYAK
Ga0208224_100761813300020528FreshwaterMKTIVNSIWLFLEAFGQARDAASLARQGRIEEAKAVYGN
Ga0208224_102398033300020528FreshwaterMKTITNAIWSFLQAFGQARAAASLARQGRIEEAKAIYGN
Ga0208222_105263123300020566FreshwaterMKTIVNSIWLFLEAFGQARAAASLARQGRIEEAKAVYGN
Ga0207909_105895933300020572FreshwaterMKTILNSIWSVLESFAQARAAAVLARQGRIEEAKAVYGN
Ga0214163_109982223300021141FreshwaterMKTILNSIWSFLEAFGQARYAASLARQGRIAESKAVYES
Ga0210307_120966913300021336EstuarineMKTILNSIWSVLEAFGQARAAASLARQGRIDDAKAVYK
Ga0194048_1003177533300021519Anoxic Zone FreshwaterMKTIINTIWSVIVAFGEARYAASLARQGRVEEAKAVYNGPA
Ga0194048_1019279023300021519Anoxic Zone FreshwaterMKTFVNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS
Ga0213922_111008523300021956FreshwaterMKSILNLIWSVLESFGQARAAAVLARQGRIEEAKAIYGS
Ga0222712_1043867723300021963Estuarine WaterMKSVLNSIWSFLESFAQARAAASLARQGRVEEAKAVYKN
Ga0181354_108010733300022190Freshwater LakeMKTITNAIWSFLEVFAQARAAASLARMGDIEGAKAAYK
Ga0181351_125310123300022407Freshwater LakeMKTILNSIWSVLEAFGEARYAASLARQGRVAEAKAVYGA
Ga0181351_127215523300022407Freshwater LakeMKTITNAIWSFLEAFGQARYAASLARQGRIAESKAVYNGPA
Ga0248169_10414683300022602FreshwaterMKSILNSIWTVLVAVGQARHAAYLARQGRLAEAKAVYGN
Ga0244775_10006029163300024346EstuarineMKTITNAIWSFLEAFGQARAAASLARMGDIEGAKAVYK
Ga0244775_1007802053300024346EstuarineLSMKTIVNSIWSFLEAFAQARAAASLARQGKIAEAKAVYGA
Ga0244775_1011562353300024346EstuarineMKTIVNLIWSWLETFGQARAAASLARQGRIDEAKAVYK
Ga0244775_1012344823300024346EstuarineMNSITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN
Ga0244775_1016898053300024346EstuarineMKTIVNAIWAFLEAFGQARAAASLARQGRIAEAKAIYGA
Ga0244775_1040319323300024346EstuarineMKTIVNSIWSFLEAFGQARAAASLARQGRIEESKAVYNGPA
Ga0244775_1046013343300024346EstuarineMKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYRN
Ga0244775_1071827723300024346EstuarineMKTIINSIRSFLEAFGQARTAASLARQGRIEEAKAVYNAPA
Ga0244775_1117729213300024346EstuarineLNSIWSFLEAFGQARAAASLARQGKTAEAKAVYGS
Ga0255252_108331523300024853FreshwaterGKIPMKTILNTIWSVLEAFGQARYAASLARQGRVEESKAVYNGRA
Ga0208504_1000034133300025358FreshwaterMKSILKSIWTVLEAVGQARYAAHLARQGRIADAKAIYGE
Ga0255114_106716113300027145FreshwaterSMKTILNSIWSMLEAFGQARAAASLARMGDIEGAKAVYK
Ga0255134_108046723300027292FreshwaterMKTILNSIWSVLEAFAQARAAASLARMGDIEGAKAVYK
Ga0208022_106124433300027418EstuarineMKTITNAIWSFLEAFAQARAAASLARMGDIEGAKAVYK
Ga0255125_106899323300027534FreshwaterMKTILNSIWSVLEAFGQARAAASLARIGDIEGAKAVYK
Ga0209552_104194223300027563Freshwater LakeMKTITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN
Ga0209552_108654623300027563Freshwater LakeSMKTIINSIWSFLEAFGQARYAASLARQGRVEESKAVYNGRA
Ga0208966_111820613300027586Freshwater LenticMKTILNTIWSVIVAFGEARYAASLARQGRIEESKAVYNGRAXSSRR
Ga0208966_115524423300027586Freshwater LenticMKTIVNAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA
Ga0255117_101384553300027600FreshwaterMKTIVNSIWSFLEAFGQARAAASLARQGRIAEAKAIYGA
Ga0208974_100004573300027608Freshwater LenticMKKIVNSLWSFLEALGQARAASILARQGRIEEAKAVYNGPA
Ga0208974_1000112653300027608Freshwater LenticMKTILNTIWSVIVAFGEARYAASLARQGRVEEAKAVYDGPA
Ga0208974_1001112173300027608Freshwater LenticMKTILNSIWSVLVAFGEARYAASLARQGKIKESKAVYGA
Ga0208974_100961053300027608Freshwater LenticFSKGKLSMKTILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN
Ga0208951_118101023300027621Freshwater LenticMKTIVNSIWSLLEVFGQARYAASLARQGRIAEAKAVYGA
Ga0208133_101388713300027631EstuarineSMNSITNAIWSFLEAFGQARAAASLARQGRIEEAKAVYTN
Ga0209135_109939023300027642Freshwater LakeMKTIVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA
Ga0209356_114518423300027644Freshwater LakeMKTIVNTIWSVLEAFGQARAAASLARMGDIEGAKAVYK
Ga0209769_101881023300027679Freshwater LakeMKTILNSIWSVLESFGQARAAASLARQGKIAEAKAIYGN
Ga0209769_120965423300027679Freshwater LakeMNSILNSIWSVLEAFGQARAAASLARQGRIDEAKAVYNGQQ
Ga0209188_102193173300027708Freshwater LakeMKSIFNSIWSFLEAFGEARYAASLARQGRTAEAKALYGG
Ga0209188_105628223300027708Freshwater LakeMKSIINSIWSVLLTFGEARYAASLARQGRVAEAKAVYRN
Ga0209188_114884823300027708Freshwater LakeMKSVLNTIWSVLVSFGEARHAASLARQGRVAEAKAVYGA
Ga0209188_124720523300027708Freshwater LakeMKTIVNAIWSFLESFAQARAAASLARQGRVEEAKAIYGS
Ga0209599_1000740783300027710Deep SubsurfaceMKTIVNSIWSFLEAFGQARAAAILARQGKIEEAKAVYGS
Ga0209599_1001096233300027710Deep SubsurfaceMKTIANSIWSFLEAFGQARAAAILARQGRVEEAKAIYGS
Ga0209599_1005388333300027710Deep SubsurfaceMKTIVKSIWSFLEAFAQARAAASLARQGKIDEAKAVYGS
Ga0209599_1012044633300027710Deep SubsurfaceMKTILNTIWSVLVAFGEARYAASLARQGRIDEAKAVYGS
Ga0209442_10000221103300027732Freshwater LakeMKNILNSIWSVLEAFGQARAAASLARMGDIEGAKAVYK
Ga0209442_115624923300027732Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLASQGKIAEAKAVYK
Ga0209442_116224223300027732Freshwater LakeMKTIVNSIWSFLESFAQARAAASLARQGKIAESKAVYK
Ga0209297_109762133300027733Freshwater LakeMKTIINSIWSFLEAFGQARAAASLARMGDIEGAKAVYK
Ga0209087_101307053300027734Freshwater LakeMKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGS
Ga0209190_105876633300027736Freshwater LakeMKTILNSIWSVLEAFGQARYAASLARQGRIAESKAVYGS
Ga0209597_1000008603300027746Freshwater LakeMKTIINTIWSWLEAFGQARCAASLARQGRIAEAKAVYGA
Ga0209084_1000399553300027749Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGA
Ga0209084_1011102103300027749Freshwater LakeMKTVLNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA
Ga0209084_110221423300027749Freshwater LakeMKSVLNTIWSILLSFGEARHAASLARQGRVAEAKAVYGA
Ga0209444_1017357943300027756Freshwater LakeILNSIWSFLEAFGQARAAASLARQGRIAEAKAVYGN
Ga0209296_1000991123300027759Freshwater LakeMKTILNSIWSFLESFAQARAAASLARQGRIEEAKAVYGS
Ga0209296_100704653300027759Freshwater LakeMKTILNSIWSVLESFAQARAAAVLVRQGRIEEAKAVYGA
Ga0209296_100799293300027759Freshwater LakeMKTILNTIWSFLEAFGQARYAASLARQGRTEEAKAVYGS
Ga0209296_101606193300027759Freshwater LakeMKSVLNTIWSFLEAFGQARAAASLARQGRIAEAKAVYGA
Ga0209296_116383013300027759Freshwater LakeMKTILNSIWSVLEAFGQARYAASLARQGRVEEAKAIYGS
Ga0209296_128384623300027759Freshwater LakeMKTIINSIWSFLEAFGQARAAASLARQGRVAEAKAVYGA
Ga0209088_1009278323300027763Freshwater LakeMKTILNSIWSVLEAFGQARAAASLARQGRIAEAKAVYGA
Ga0209088_1028158333300027763Freshwater LakeMKTITNAIWSFLEAFGQARAAASLARQGKIAESKAVYGS
Ga0209088_1034327213300027763Freshwater LakeMKTILNSIWSVLVSFGEARYAASLARQGRIAEAKAVYGA
Ga0209770_10003110113300027769Freshwater LakeMKNFINSFWSFLEAFGQARYATFLTRQGRIDEAKALYE
Ga0209770_1013637023300027769Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYGA
Ga0209770_1031621413300027769Freshwater LakeSMKTILNSIWSFLVAFGEARYAASLARQGRTEEAKAIYNN
Ga0209500_1006669053300027782Freshwater LakeMKTILNSIWSFLEAFGQARVAASLARQGRIKESKAVYGA
Ga0209500_1008282633300027782Freshwater LakeMKTILNSIWSFLEAFGQARAAASLARQGKIAESKAIYGS
Ga0209500_1013925733300027782Freshwater LakeMKTILNSIWSFLEAFAQARAAASLARQGKIAESKAVYGN
Ga0209500_1031513523300027782Freshwater LakeMKTIVNSIWSVLEAFGQARAAASLARQGRIAEAKAVYK
Ga0209246_1001834033300027785Freshwater LakeMKTILNSIWSFLETFGQARVAASLARQGRIEESKAVYNGPA
Ga0209107_1002638873300027797Freshwater And SedimentMKTIVNSIWSFLEAFGQARYAASLARQGRIEESKAVYNGPA
Ga0209107_1052664113300027797Freshwater And SedimentMKTITNAIWSFLESFGQARAAASLARQGRIEEAKAVYRA
Ga0209353_1004750323300027798Freshwater LakeMKTIINSIWSVLEAFGQARVAASLARMGDIEGAKAVYNEPA
Ga0209353_1007384043300027798Freshwater LakeVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA
Ga0209550_10008041163300027892Freshwater LakeMKTILNTIWSWLEAFGQARYAASLARQGRVEESKAVYNGRA
Ga0209400_10001451213300027963Freshwater LakeMKKVLNAIWLFLVAFGEARYAASLARQGRVAEAKAVYGA
Ga0209400_100973553300027963Freshwater LakeMKTIINSIWSFLEAFGQARAAASLARQGKIAESKAVYGS
Ga0209400_108589833300027963Freshwater LakeMKTVLNSIWSFLEAFGQARYAASLVRQGRITEAKAVYGS
Ga0209191_1001632163300027969Freshwater LakeMKTIVNSIWSFLEAFGQARAAASLARQGRFEEAKAVYGA
Ga0209191_101253233300027969Freshwater LakeMKTILNAIWSFLVAFGEARYAASLARQGKIDKAKAVYGS
Ga0209191_101545023300027969Freshwater LakeMKTVLNSIWSVLVSFGEARYAASLARQGRIAEAKAIYNN
Ga0209191_102121543300027969Freshwater LakeMKNFINAIWSFLEAFGQARAAASLARQGRIAEAKAIYGA
Ga0209191_110005223300027969Freshwater LakeMKTILNSIWSFLEAFGQARTAASLVRQGRIEEAKAVYGS
Ga0209191_127663813300027969Freshwater LakeKTILNSIWSFLEAFGQARAAASLARQGKIAESKAIYGS
Ga0304728_118212623300028393Freshwater LakeMKSVLNTIWSVLVSFGEARYAASLARQGRVAEAKAVYGA
Ga0304730_1004420103300028394Freshwater LakeMKTIINSIWSFLEAFGQARAAASLARQGKIAESKAVYGA
Ga0304730_102466863300028394Freshwater LakeMKSILNSIWSVLEAFGQARYAASLARQGRTEEAKAVYGA
Ga0315905_1002342073300032092FreshwaterMKTILNYIWTVLEAFGQARYAASLARQGRTEEAKAVYGA
Ga0315905_1094254923300032092FreshwaterLSMKTIVNSIWSLLEAFGQARAAASLARQGRIEEAKAVYGA
Ga0334977_0027612_2692_28113300033978FreshwaterMKTILNSIRSFLEAFGQARYAASLARQGRTEEAKAVYGA
Ga0334992_0001335_12549_126683300033992FreshwaterMKTILNSIWSFLEAFGEARAASILARQGRIEEAKAVYRN
Ga0334996_0303347_553_6723300033994FreshwaterMKTILNSIWSFLEAFGEARYAASLARQGRTEEAKAVYGA
Ga0335020_0027997_2371_24903300034082FreshwaterMKTIVNSIWSFLEAFAQARAAASLARQGKIAEAKAVYGA
Ga0335020_0038540_437_5683300034082FreshwaterMNSILNSILNSIWSVLESFAQARAAAVLARQGRIEEAKAVYGN
Ga0335012_0080428_1480_15993300034093FreshwaterMKTITNAIWSVLEAFGQARVAASLARQGKIEEAKAVYRA
Ga0335029_0300069_49_1683300034102FreshwaterMKTILNSIWSFLEAFGQARVAASLARQGRIEEAKAVYRA
Ga0335029_0666560_263_3823300034102FreshwaterMKTIVNSIWSFLEAFGQARAAASLARQGRIEEAKAVYRA
Ga0335048_0425073_1_1053300034356FreshwaterMKTITNAIWSVLEAFGQARVAASLARQGKIEEAKA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.