Basic Information | |
---|---|
Family ID | F009539 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 316 |
Average Sequence Length | 38 residues |
Representative Sequence | RSRMRERITVLTFALVVLAAIVGVAFAAGYILGKLLL |
Number of Associated Samples | 230 |
Number of Associated Scaffolds | 315 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 74.05 % |
% of genes near scaffold ends (potentially truncated) | 22.47 % |
% of genes from short scaffolds (< 2000 bps) | 88.61 % |
Associated GOLD sequencing projects | 208 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.203 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.557 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.848 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.291 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 315 Family Scaffolds |
---|---|---|
PF12773 | DZR | 26.03 |
PF00334 | NDK | 12.06 |
PF08245 | Mur_ligase_M | 6.67 |
PF10458 | Val_tRNA-synt_C | 2.54 |
PF08241 | Methyltransf_11 | 1.90 |
PF02545 | Maf | 0.95 |
PF12850 | Metallophos_2 | 0.63 |
PF10555 | MraY_sig1 | 0.32 |
PF04107 | GCS2 | 0.32 |
PF05698 | Trigger_C | 0.32 |
PF06072 | Herpes_US9 | 0.32 |
PF00162 | PGK | 0.32 |
PF12680 | SnoaL_2 | 0.32 |
PF12146 | Hydrolase_4 | 0.32 |
PF00528 | BPD_transp_1 | 0.32 |
PF11902 | DUF3422 | 0.32 |
PF14264 | Glucos_trans_II | 0.32 |
COG ID | Name | Functional Category | % Frequency in 315 Family Scaffolds |
---|---|---|---|
COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 12.06 |
COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.95 |
COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 0.32 |
COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 0.32 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.20 % |
Unclassified | root | N/A | 3.80 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_8864260 | All Organisms → cellular organisms → Bacteria | 1733 | Open in IMG/M |
2088090015|GPICI_8913944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3160 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig808343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1200 | Open in IMG/M |
2170459015|G14TP7Y02JI1TZ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300000953|JGI11615J12901_11734940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
3300000956|JGI10216J12902_101053168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
3300000956|JGI10216J12902_103441227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
3300001431|F14TB_100869012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1050 | Open in IMG/M |
3300001842|RCM30_1086919 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 615 | Open in IMG/M |
3300002077|JGI24744J21845_10075517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 615 | Open in IMG/M |
3300002244|JGI24742J22300_10034492 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300002568|C688J35102_119122801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
3300002568|C688J35102_119463041 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300003990|Ga0055455_10145731 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300003997|Ga0055466_10116885 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300004081|Ga0063454_100187869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1155 | Open in IMG/M |
3300004114|Ga0062593_100625372 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300004114|Ga0062593_100638017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
3300004156|Ga0062589_100969129 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
3300004463|Ga0063356_101280888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1071 | Open in IMG/M |
3300004479|Ga0062595_100676583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
3300004479|Ga0062595_101147752 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300004643|Ga0062591_101020538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300004643|Ga0062591_101554715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 664 | Open in IMG/M |
3300004778|Ga0062383_10175379 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300004780|Ga0062378_10072030 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300004782|Ga0062382_10206325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 861 | Open in IMG/M |
3300005093|Ga0062594_100721427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 904 | Open in IMG/M |
3300005093|Ga0062594_102008672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
3300005093|Ga0062594_102392685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
3300005164|Ga0066815_10004857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1437 | Open in IMG/M |
3300005327|Ga0070658_10504865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1045 | Open in IMG/M |
3300005328|Ga0070676_11362913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300005329|Ga0070683_101859543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
3300005332|Ga0066388_100935419 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300005332|Ga0066388_101645710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1133 | Open in IMG/M |
3300005333|Ga0070677_10093994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1310 | Open in IMG/M |
3300005336|Ga0070680_100908452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
3300005337|Ga0070682_101108826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300005355|Ga0070671_101730715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
3300005356|Ga0070674_100152870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
3300005366|Ga0070659_101350658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
3300005441|Ga0070700_100170045 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300005441|Ga0070700_100607665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 858 | Open in IMG/M |
3300005444|Ga0070694_100470506 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300005455|Ga0070663_100315915 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300005459|Ga0068867_102332922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300005543|Ga0070672_100013574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5760 | Open in IMG/M |
3300005543|Ga0070672_100016142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 5343 | Open in IMG/M |
3300005543|Ga0070672_101662868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
3300005543|Ga0070672_101670495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300005556|Ga0066707_10254285 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300005564|Ga0070664_101443981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
3300005616|Ga0068852_100472534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1245 | Open in IMG/M |
3300005616|Ga0068852_101706936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
3300005617|Ga0068859_100670518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1128 | Open in IMG/M |
3300005718|Ga0068866_10074527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1805 | Open in IMG/M |
3300005718|Ga0068866_10182757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1240 | Open in IMG/M |
3300005718|Ga0068866_11093172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
3300005833|Ga0074472_10775385 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300005840|Ga0068870_10406627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
3300005873|Ga0075287_1017243 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300005874|Ga0075288_1051452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
3300005937|Ga0081455_10039980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4140 | Open in IMG/M |
3300005937|Ga0081455_10709640 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300005937|Ga0081455_10760251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
3300005985|Ga0081539_10000335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 104157 | Open in IMG/M |
3300005985|Ga0081539_10240133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 812 | Open in IMG/M |
3300006047|Ga0075024_100144073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1081 | Open in IMG/M |
3300006059|Ga0075017_100467121 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300006196|Ga0075422_10046805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1556 | Open in IMG/M |
3300006196|Ga0075422_10146043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 942 | Open in IMG/M |
3300006196|Ga0075422_10438504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
3300006358|Ga0068871_100144885 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
3300006580|Ga0074049_13080962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
3300006581|Ga0074048_12495621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
3300006606|Ga0074062_12422940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
3300006844|Ga0075428_101261438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 778 | Open in IMG/M |
3300006844|Ga0075428_101552428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300006845|Ga0075421_100821444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1068 | Open in IMG/M |
3300006847|Ga0075431_101062482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300006871|Ga0075434_102218179 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300006876|Ga0079217_10223424 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300006880|Ga0075429_101124226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
3300006894|Ga0079215_11698361 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300006969|Ga0075419_10272629 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300007004|Ga0079218_10060651 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
3300009012|Ga0066710_104266465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300009079|Ga0102814_10802812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300009094|Ga0111539_10065343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4299 | Open in IMG/M |
3300009094|Ga0111539_10425201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1547 | Open in IMG/M |
3300009094|Ga0111539_11763055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
3300009094|Ga0111539_12608072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
3300009098|Ga0105245_10276386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. | 1640 | Open in IMG/M |
3300009100|Ga0075418_11083818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
3300009100|Ga0075418_12567153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
3300009146|Ga0105091_10353942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 725 | Open in IMG/M |
3300009147|Ga0114129_10955579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
3300009157|Ga0105092_10178154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1185 | Open in IMG/M |
3300009176|Ga0105242_13103042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
3300009455|Ga0114939_10263443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
3300009545|Ga0105237_10955060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
3300009840|Ga0126313_11563335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300009868|Ga0130016_10367850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 969 | Open in IMG/M |
3300009868|Ga0130016_10627692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
3300009870|Ga0131092_10001423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 52444 | Open in IMG/M |
3300009873|Ga0131077_10012340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 16470 | Open in IMG/M |
3300009873|Ga0131077_10036700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7397 | Open in IMG/M |
3300010051|Ga0133939_1131983 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
3300010362|Ga0126377_10144180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2230 | Open in IMG/M |
3300010362|Ga0126377_10524756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1219 | Open in IMG/M |
3300010371|Ga0134125_12739473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300010396|Ga0134126_12046229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300010399|Ga0134127_10699421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
3300011119|Ga0105246_10512838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1020 | Open in IMG/M |
3300012092|Ga0136621_1068233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1455 | Open in IMG/M |
3300012092|Ga0136621_1302858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
3300012093|Ga0136632_10007665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4414 | Open in IMG/M |
3300012212|Ga0150985_104086872 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300012285|Ga0137370_10906215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
3300012500|Ga0157314_1028363 | Not Available | 615 | Open in IMG/M |
3300012514|Ga0157330_1047059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
3300012680|Ga0136612_10062929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1865 | Open in IMG/M |
3300012680|Ga0136612_10308999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
3300012684|Ga0136614_10357077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
3300012684|Ga0136614_11225226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300012885|Ga0157287_1034942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
3300012897|Ga0157285_10374402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
3300012898|Ga0157293_10123351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
3300012902|Ga0157291_10399291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300012903|Ga0157289_10169279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 689 | Open in IMG/M |
3300012904|Ga0157282_10397085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300012908|Ga0157286_10281188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
3300012943|Ga0164241_10031372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4027 | Open in IMG/M |
3300012943|Ga0164241_10108619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1990 | Open in IMG/M |
3300012943|Ga0164241_10322811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
3300012951|Ga0164300_10425355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300012951|Ga0164300_10994656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 539 | Open in IMG/M |
3300012958|Ga0164299_11272742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
3300012961|Ga0164302_10272022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
3300012961|Ga0164302_11658900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300012964|Ga0153916_10018647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5815 | Open in IMG/M |
3300012981|Ga0168316_114281 | Not Available | 1333 | Open in IMG/M |
3300012984|Ga0164309_11203068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
3300013100|Ga0157373_10337490 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300013308|Ga0157375_10721381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1150 | Open in IMG/M |
3300014270|Ga0075325_1006436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1935 | Open in IMG/M |
3300014295|Ga0075305_1117124 | Not Available | 550 | Open in IMG/M |
3300014301|Ga0075323_1077338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
3300014304|Ga0075340_1009185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
3300014307|Ga0075304_1149230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
3300014317|Ga0075343_1150551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
3300014318|Ga0075351_1153969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300014320|Ga0075342_1185390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
3300014323|Ga0075356_1115756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
3300014326|Ga0157380_10433383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1257 | Open in IMG/M |
3300014326|Ga0157380_11566046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
3300015077|Ga0173483_10066424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1422 | Open in IMG/M |
3300015163|Ga0167665_1014083 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
3300015189|Ga0167667_1005309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4108 | Open in IMG/M |
3300015208|Ga0167664_1108780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
3300015371|Ga0132258_10214419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4679 | Open in IMG/M |
3300015371|Ga0132258_10241202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4411 | Open in IMG/M |
3300015371|Ga0132258_11601105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1644 | Open in IMG/M |
3300015371|Ga0132258_11683585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1600 | Open in IMG/M |
3300015372|Ga0132256_101207597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
3300015372|Ga0132256_101290496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
3300015374|Ga0132255_105308681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
3300015374|Ga0132255_105595846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
3300017695|Ga0180121_10167913 | Not Available | 808 | Open in IMG/M |
3300017695|Ga0180121_10205944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300017695|Ga0180121_10245780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
3300017787|Ga0183260_10054717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2957 | Open in IMG/M |
3300017787|Ga0183260_10119189 | All Organisms → cellular organisms → Bacteria | 1899 | Open in IMG/M |
3300017789|Ga0136617_10001574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20235 | Open in IMG/M |
3300017789|Ga0136617_10940564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
3300017792|Ga0163161_10718841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
3300017792|Ga0163161_11747851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300017965|Ga0190266_10022514 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
3300017965|Ga0190266_10150618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
3300017965|Ga0190266_10375463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
3300018465|Ga0190269_10797412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
3300018466|Ga0190268_10024484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2031 | Open in IMG/M |
3300018466|Ga0190268_10262853 | Not Available | 1003 | Open in IMG/M |
3300018469|Ga0190270_10300019 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
3300018469|Ga0190270_11270048 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300018469|Ga0190270_12480137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 581 | Open in IMG/M |
3300018476|Ga0190274_10204633 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
3300018476|Ga0190274_10420997 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300018476|Ga0190274_11534022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 758 | Open in IMG/M |
3300018476|Ga0190274_12968636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300018481|Ga0190271_10015294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5693 | Open in IMG/M |
3300018481|Ga0190271_10951072 | Not Available | 984 | Open in IMG/M |
3300018481|Ga0190271_13527079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300018481|Ga0190271_13810582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
3300018482|Ga0066669_10356246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1218 | Open in IMG/M |
3300019356|Ga0173481_10015277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2248 | Open in IMG/M |
3300019362|Ga0173479_10587795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
3300019487|Ga0187893_10323920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1083 | Open in IMG/M |
3300020081|Ga0206354_10951901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 894 | Open in IMG/M |
3300022204|Ga0224496_10375905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300022213|Ga0224500_10372538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
3300022218|Ga0224502_10337311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300022883|Ga0247786_1025801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1128 | Open in IMG/M |
3300022883|Ga0247786_1037260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
3300022883|Ga0247786_1167531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300022893|Ga0247787_1027498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
3300022894|Ga0247778_1011757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1995 | Open in IMG/M |
3300022901|Ga0247788_1041923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
3300022901|Ga0247788_1060448 | Not Available | 714 | Open in IMG/M |
3300023102|Ga0247754_1140033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
3300025289|Ga0209002_10571604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
3300025289|Ga0209002_10683930 | Not Available | 539 | Open in IMG/M |
3300025537|Ga0210061_1030413 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300025537|Ga0210061_1085570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
3300025559|Ga0210087_1108482 | Not Available | 542 | Open in IMG/M |
3300025567|Ga0210076_1129984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300025791|Ga0210115_1036559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1072 | Open in IMG/M |
3300025901|Ga0207688_10048974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2361 | Open in IMG/M |
3300025907|Ga0207645_10143048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1559 | Open in IMG/M |
3300025912|Ga0207707_10255276 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
3300025912|Ga0207707_10458864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1090 | Open in IMG/M |
3300025914|Ga0207671_10881148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
3300025919|Ga0207657_10619867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
3300025920|Ga0207649_11471820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
3300025923|Ga0207681_10463054 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300025925|Ga0207650_11352914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
3300025927|Ga0207687_11730541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300025932|Ga0207690_10176702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1604 | Open in IMG/M |
3300025933|Ga0207706_10604838 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300025934|Ga0207686_10351368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1110 | Open in IMG/M |
3300025934|Ga0207686_10586333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
3300025937|Ga0207669_11230911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
3300025938|Ga0207704_10288840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1250 | Open in IMG/M |
3300025941|Ga0207711_10695892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
3300025944|Ga0207661_10639030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
3300025972|Ga0207668_11672307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300025986|Ga0207658_11968308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
3300026050|Ga0208293_1000679 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
3300026075|Ga0207708_10512639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1007 | Open in IMG/M |
3300026089|Ga0207648_11707858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
3300026116|Ga0207674_10773672 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
3300026121|Ga0207683_10134939 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
3300026142|Ga0207698_10682730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1020 | Open in IMG/M |
3300027716|Ga0209682_10025225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1425 | Open in IMG/M |
3300027717|Ga0209998_10041169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
3300027735|Ga0209261_10008470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2635 | Open in IMG/M |
3300027843|Ga0209798_10566863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
3300027870|Ga0209023_10199455 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
3300027876|Ga0209974_10370209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300027880|Ga0209481_10159126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1118 | Open in IMG/M |
3300027886|Ga0209486_10297677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 949 | Open in IMG/M |
3300027894|Ga0209068_10064850 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
3300027897|Ga0209254_10002393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17028 | Open in IMG/M |
3300027907|Ga0207428_10706371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300027915|Ga0209069_10331918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
3300028420|Ga0210366_10488168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300028587|Ga0247828_10230732 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300028587|Ga0247828_10353171 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300028587|Ga0247828_11172057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
3300028590|Ga0247823_10859734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300028608|Ga0247819_10202864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
3300028733|Ga0302261_1111959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
3300028782|Ga0307306_10175705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
3300028790|Ga0307283_10170235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300028802|Ga0307503_10483315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
3300028802|Ga0307503_10523344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300029987|Ga0311334_11767194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300030000|Ga0311337_11025236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
3300030114|Ga0311333_10054128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2884 | Open in IMG/M |
3300030294|Ga0311349_10811008 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300030336|Ga0247826_10214563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1327 | Open in IMG/M |
3300030336|Ga0247826_10214563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1327 | Open in IMG/M |
3300030336|Ga0247826_10282678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
3300031198|Ga0307500_10299157 | Not Available | 511 | Open in IMG/M |
3300031226|Ga0307497_10770664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
3300031366|Ga0307506_10138716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
3300031576|Ga0247727_10001556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 54112 | Open in IMG/M |
3300031576|Ga0247727_10044407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5609 | Open in IMG/M |
3300031740|Ga0307468_100481217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
3300031834|Ga0315290_10005769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9016 | Open in IMG/M |
3300031834|Ga0315290_10015074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5885 | Open in IMG/M |
3300031834|Ga0315290_10471854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1097 | Open in IMG/M |
3300031834|Ga0315290_10637702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
3300031834|Ga0315290_11181453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
3300031873|Ga0315297_10083303 | All Organisms → cellular organisms → Bacteria | 2505 | Open in IMG/M |
3300031913|Ga0310891_10358709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300031938|Ga0308175_100363944 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
3300031938|Ga0308175_102734091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
3300031944|Ga0310884_10849201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
3300031949|Ga0214473_11555063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
3300031997|Ga0315278_10049068 | All Organisms → cellular organisms → Bacteria | 4131 | Open in IMG/M |
3300031997|Ga0315278_10093027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3026 | Open in IMG/M |
3300031997|Ga0315278_10484066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
3300031997|Ga0315278_11911038 | Not Available | 557 | Open in IMG/M |
3300032002|Ga0307416_102407632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
3300032003|Ga0310897_10252956 | Not Available | 790 | Open in IMG/M |
3300032012|Ga0310902_11194902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300032143|Ga0315292_11102304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
3300032143|Ga0315292_11423772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
3300032143|Ga0315292_11555429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300032164|Ga0315283_10246115 | All Organisms → cellular organisms → Bacteria | 1933 | Open in IMG/M |
3300032164|Ga0315283_10634591 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300032164|Ga0315283_11525053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300032173|Ga0315268_11198075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
3300032205|Ga0307472_100927734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 809 | Open in IMG/M |
3300032256|Ga0315271_10653903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
3300032275|Ga0315270_10432794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
3300032275|Ga0315270_11225680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300032342|Ga0315286_11433435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
3300032397|Ga0315287_10220819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2218 | Open in IMG/M |
3300032397|Ga0315287_10713983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
3300033412|Ga0310810_10472622 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300033475|Ga0310811_11120370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
3300033551|Ga0247830_10553832 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300033551|Ga0247830_10765351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.56% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.28% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.06% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 4.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.16% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.53% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.22% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.22% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.90% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.58% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.58% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.58% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.27% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.27% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.27% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.27% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.27% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.95% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.95% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.63% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.63% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.63% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.63% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.63% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.63% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.63% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.32% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.32% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.32% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.32% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.32% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.32% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.32% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.32% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.32% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.32% |
Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.32% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.32% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.32% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.32% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.32% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.32% |
Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.32% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009455 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Crystal Spring | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012092 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06) | Environmental | Open in IMG/M |
3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012981 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014295 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014304 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014307 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D1 | Environmental | Open in IMG/M |
3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015163 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout) | Environmental | Open in IMG/M |
3300015189 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine) | Environmental | Open in IMG/M |
3300015208 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026050 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028733 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_4 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_02172050 | 2088090015 | Soil | MRTTARESITVLVFALVVLLAIVGSAFAVGYILGKLLLS |
GPICI_03356470 | 2088090015 | Soil | VAVTRTRDRLAVLGFAAFVVLAIVGAAFAAGYILGKLLL |
KansclcFeb2_04263270 | 2124908045 | Soil | MRTTMRERFVVLVFALAVLLAIVGTAFAAGYILGKLLL |
4PV_00640520 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | ERAPWPVTRARDRLAVLGFAGFVLLAIVGTAFAVGYILGKLLL |
JGI11615J12901_117349402 | 3300000953 | Soil | VTSVRERLTVFTFALVLLAAIVGTAFALGYILGKLLL* |
JGI10216J12902_1010531682 | 3300000956 | Soil | MRERLTVLGFATFVLAAIVGSAFALGYILGKLLL* |
JGI10216J12902_1034412272 | 3300000956 | Soil | ARERFTVLTFALVILVGLVGIAFAAGYILGKLLL* |
F14TB_1008690122 | 3300001431 | Soil | VRERLTVLGFAMFVLLAIVGSAFALGYILGKLLL* |
RCM30_10869191 | 3300001842 | Marine Plankton | VTRLRERVSVLTFAVLFLAAIIGVSFVVGYILGKLLL* |
JGI24744J21845_100755172 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MRERFVVLAFALXVVLAIVGTAFAAGYILGKLLL* |
JGI24742J22300_100344921 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | RTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL* |
C688J35102_1191228011 | 3300002568 | Soil | MKRRSRMRERITVLTFALLVLAAIVGVAFAAGYILGKLLL* |
C688J35102_1194630412 | 3300002568 | Soil | MKRRSRMRERIAVLTFALVVLVAIVGIAFATGYILGKLLL* |
Ga0055455_101457312 | 3300003990 | Natural And Restored Wetlands | MTARRARERLTVLGFAGFVLLAIVGTAFALGYILGKLLL* |
Ga0055466_101168852 | 3300003997 | Natural And Restored Wetlands | VAVTRMRDRMTVFVFAAFVLLVIVGAAFAAGYILGKLLL* |
Ga0063454_1001878692 | 3300004081 | Soil | MKRRSRMRERISVLSFAVFVLVGIVGIAFAAGYILGKLLL* |
Ga0062593_1006253723 | 3300004114 | Soil | MRTTARESITVLVFALVVLLAIVGSAFAVGYILGKLLLS* |
Ga0062593_1006380172 | 3300004114 | Soil | VAVTRMRDRMSVFAFATFVLLVIVGVAFAAGYILGKLLL* |
Ga0062589_1009691292 | 3300004156 | Soil | VAVTRARDRATVLTFAAFVVLAIVGAAFAAGYILGKLLL* |
Ga0063356_1012808882 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VAVTRTRDRLAVLGFAAFVVLAIVGAAFAAGYILGKLLL* |
Ga0062595_1006765831 | 3300004479 | Soil | VRTTARESITVLVFALVVLLAIVGSAFAVGYILGKLLLS* |
Ga0062595_1011477522 | 3300004479 | Soil | VAVTRTRDRLAVLTFAAFVVLAIVGAAFAAGYILGKLLL* |
Ga0062591_1010205382 | 3300004643 | Soil | VAVTRARDRLAVLGFAGFVLLAIVGTAFAVGYILGKLLL* |
Ga0062591_1015547152 | 3300004643 | Soil | MRRRSRMRERLSVLTFALVVLVGIVGLAFAAGYILGKLLL* |
Ga0062383_101753792 | 3300004778 | Wetland Sediment | VRRRSRLRERLTVSAFALALLGAILGLSFAAGYILGKLLL* |
Ga0062378_100720302 | 3300004780 | Wetland Sediment | VRRASRLRERLTVSAFALGLLGAILGLSFAAGYILGKLLL* |
Ga0062382_102063252 | 3300004782 | Wetland Sediment | MSGRSRTRERITVLTFALFVLVGLVGIAFAAGYILGKLLL* |
Ga0062594_1007214272 | 3300005093 | Soil | MAVRSRMRERITVLTFALVVLAVIVGVAFAAGYILGKLLL* |
Ga0062594_1020086722 | 3300005093 | Soil | MSPRSRTRERITVLTFALVVLMGIVGIAFAAGYILGKLLL* |
Ga0062594_1023926852 | 3300005093 | Soil | MRRRSRMRERFSVLTFALVVLVAIVGLAFAAGYILGKLLL* |
Ga0066815_100048574 | 3300005164 | Soil | RGGEMRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0070658_105048652 | 3300005327 | Corn Rhizosphere | VAVTRIRDRMSVFAFATFVLLVIVGAAFAAGYILGKLLL* |
Ga0070676_113629131 | 3300005328 | Miscanthus Rhizosphere | VAVTRMRDRMSVFAFATFVLLVIVGAAFAAGYILGKLLL* |
Ga0070683_1018595432 | 3300005329 | Corn Rhizosphere | RGARAVAVTRARDRAAVLTFAAFVVLAIVGAAFAAGYILGKLLL* |
Ga0066388_1009354193 | 3300005332 | Tropical Forest Soil | VAVTRMRDRMTVLVFAGFVLLVIVGAAFAAGYILGKLLL* |
Ga0066388_1016457102 | 3300005332 | Tropical Forest Soil | VAVIRARDRLAVLTFAALVVLVIVGAAFAAGYILGKLLL* |
Ga0070677_100939941 | 3300005333 | Miscanthus Rhizosphere | PARRPRGGEMRTTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0070680_1009084522 | 3300005336 | Corn Rhizosphere | VTRTTMRERFVVLAFALGVVLAIVGTAFAAGYILGKLLL* |
Ga0070682_1011088262 | 3300005337 | Corn Rhizosphere | MKPRSRMRERIAVLTFALVVLVAIVGVAFAAGYILGKLLL* |
Ga0070671_1017307152 | 3300005355 | Switchgrass Rhizosphere | MRRRSRMRERLSVLTFALVVLLAIVGLAFAAGYILGTLLL* |
Ga0070674_1001528704 | 3300005356 | Miscanthus Rhizosphere | MSPRSRTRERITVLTFALVVLIGIVGIAFAAGYILGKLLL* |
Ga0070659_1013506582 | 3300005366 | Corn Rhizosphere | VAVTRTRDRLAVLGFAGFVLLAIVGTAFAVGYILGKLLL* |
Ga0070700_1001700452 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRTSMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0070700_1006076652 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VTRTTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0070694_1004705061 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EMRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0070663_1003159152 | 3300005455 | Corn Rhizosphere | MKRRSRMRERIAVLTFALVVLVGIVGIAFAAGYILGKLLL* |
Ga0068867_1023329222 | 3300005459 | Miscanthus Rhizosphere | VKGRGRMRERLTVLGFATFVLVTIVGSAFAVGYILGKLLL* |
Ga0070672_1000135745 | 3300005543 | Miscanthus Rhizosphere | MRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0070672_1000161423 | 3300005543 | Miscanthus Rhizosphere | MRERMTVLTFALAVLLVIVGTAFAVGYILGKLLL* |
Ga0070672_1016628682 | 3300005543 | Miscanthus Rhizosphere | MAGRSRMRERITVLTFALVVLAVIVGVAFAAGYILGKLLL* |
Ga0070672_1016704952 | 3300005543 | Miscanthus Rhizosphere | MKRRSRMRERIAVLTFALVVLVAIVGIAFAAGYILGQLLL* |
Ga0066707_102542852 | 3300005556 | Soil | MAHAGERLTVLGFALLLLVAFVGLAFAVGWIIGKLLL* |
Ga0070664_1014439812 | 3300005564 | Corn Rhizosphere | MRTTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0068852_1004725342 | 3300005616 | Corn Rhizosphere | MRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKL |
Ga0068852_1017069362 | 3300005616 | Corn Rhizosphere | VAVTRARDRAAVLTFAAFVVLAIVGAAFAAGYILGKLL |
Ga0068859_1006705182 | 3300005617 | Switchgrass Rhizosphere | MRERFVVLAFALGVVLAIVGTAFAAGYILGKLLL* |
Ga0068866_100745273 | 3300005718 | Miscanthus Rhizosphere | MRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0068866_101827572 | 3300005718 | Miscanthus Rhizosphere | VTRMRERLTVFGFAGFVLLAIVGTAFALGYILGKLLL* |
Ga0068866_110931722 | 3300005718 | Miscanthus Rhizosphere | MRERIAVLTFALVVLVAIVGVAFAAGYILGKLLL* |
Ga0074472_107753851 | 3300005833 | Sediment (Intertidal) | RGARVTRMRERITVVVFALLVLATIVGVSFAAGYILGKLLL* |
Ga0068870_104066272 | 3300005840 | Miscanthus Rhizosphere | VKGRGRMRERLTVLGFATFVLVAIVGSAFVVGYILGKLLL* |
Ga0075287_10172433 | 3300005873 | Rice Paddy Soil | RARERLTVLGFATFVVLTIVGTAFAVGYILGKLLL* |
Ga0075288_10514522 | 3300005874 | Rice Paddy Soil | MRPRRMRERVAVLGFATFVVLAIVGAAFTVGYILGKLLL* |
Ga0081455_100399808 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTRRRDRLAVLGFATFVLLAIVGTAFAAGYILGKLLL* |
Ga0081455_107096402 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VAVTRARDRLTVLGFAAFVVLAIVGAAFAAGYILGKLLL* |
Ga0081455_107602512 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VAVTRVRDRLTVLGFAAFVLVVIVGAAFAAGYILGKLLL* |
Ga0081539_1000033566 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VTRGRERLAVMGFAAFVLLAIVGTAFALGYILGKLLL* |
Ga0081539_102401332 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTRARERLTVVTFAMFVLAAIVGVSFALGYMLGKLLL* |
Ga0075024_1001440732 | 3300006047 | Watersheds | VRKRSRMQERIAVVTFALVIVLALVGIAFAAGYILGKILL* |
Ga0075017_1004671212 | 3300006059 | Watersheds | VSGRSRTRERLSAVAFALAVLAGVVGLAFAAGYILGKLLL* |
Ga0075422_100468053 | 3300006196 | Populus Rhizosphere | MRTSMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0075422_101460432 | 3300006196 | Populus Rhizosphere | VTRMRERLTVLGFAAFVLLAIVGTAFALGYILGKLLL* |
Ga0075422_104385041 | 3300006196 | Populus Rhizosphere | SPGRPREAHMRTTARESITVLVFALVVLLAIVGSAFAVGYILGKLLLS* |
Ga0068871_1001448853 | 3300006358 | Miscanthus Rhizosphere | MRERFVVLAFALAVMLAIVGTAFAAGYILGKLLL* |
Ga0074049_130809621 | 3300006580 | Soil | RRRGERLTVLAFAAVVLLAIVGTAFAVGYILGKLLL* |
Ga0074048_124956212 | 3300006581 | Soil | VKRRRGERLTVLAFAAVVLLAIVGTAFAVGYILGKLLL* |
Ga0074062_124229402 | 3300006606 | Soil | RGGGVRSGMRERMTVLTFALAVLLVIVGTAFAVGYILGKLLL* |
Ga0075428_1012614382 | 3300006844 | Populus Rhizosphere | VTRMRERLTVLGFATFVLLAIVGTAFALGYILGKLLL* |
Ga0075428_1015524282 | 3300006844 | Populus Rhizosphere | VTRLGERLTVLGFAAAVVGTIVALAFAVGYVIGRLLL* |
Ga0075421_1008214443 | 3300006845 | Populus Rhizosphere | VRERLTVLGFAAFVLLAIVGTAFALGYILGKLLL* |
Ga0075431_1010624821 | 3300006847 | Populus Rhizosphere | VAVTRMRDRMSVFAFATFVLLVIVGVAFAAGYILGK |
Ga0075434_1022181792 | 3300006871 | Populus Rhizosphere | VAVTRARDRAAVLTFAAFVVLAIVGAAFAAGYILGKLLL* |
Ga0079217_102234243 | 3300006876 | Agricultural Soil | VTRIRERLTVLGFAAFVLLAIVGTAFAVGYILGKLLL* |
Ga0075429_1011242261 | 3300006880 | Populus Rhizosphere | ALVKGRGRMRERLTVLGFATFVLVAIVGSAFAVGYILGKLLL* |
Ga0079215_116983612 | 3300006894 | Agricultural Soil | VTRMRERLTVLGFAAFVLLAIVGTAFAVGYILGKLLL* |
Ga0075419_102726292 | 3300006969 | Populus Rhizosphere | VAVTRMRGRMSVFAFATFVLLVIVGAAFAAGYILGKLLL* |
Ga0079218_100606514 | 3300007004 | Agricultural Soil | MRERLTVLGFAAFVLLAIVGTAFAVGYILGKLLL* |
Ga0066710_1042664652 | 3300009012 | Grasslands Soil | MAHAGERLTVLGFALLLLIAFVGLAFAVGWIIGKLLL |
Ga0102814_108028122 | 3300009079 | Estuarine | MSGRSRTRERITVLAFALFVLAGLVGIAFAAGYILGKLLL* |
Ga0111539_100653433 | 3300009094 | Populus Rhizosphere | MRERLTVLGFAAFVLLAIVGTAFALGYILGKLLL* |
Ga0111539_104252013 | 3300009094 | Populus Rhizosphere | VAVTRARDRLAVLGFAGFVLLAIVGTAFAVGYILG* |
Ga0111539_117630552 | 3300009094 | Populus Rhizosphere | MRERLSVLGFATFVLVAIVGSAFAVGYILGKLLL* |
Ga0111539_126080722 | 3300009094 | Populus Rhizosphere | MRERLTVFGFAGFVLLAIVGTAFALGYILGKLLL* |
Ga0105245_102763861 | 3300009098 | Miscanthus Rhizosphere | MRERITVLTFALVVLAVIVGVAFAAGYILGKLLL* |
Ga0075418_110838182 | 3300009100 | Populus Rhizosphere | MRERLTVLGFATFVLLAIVGTAFALGYILGKLLL* |
Ga0075418_125671531 | 3300009100 | Populus Rhizosphere | MRERLTVLGFATFVLVAIVGSAFAVGYILGKLLL* |
Ga0105091_103539422 | 3300009146 | Freshwater Sediment | VTRAGERLTVLAFAAVVLLLIVGTAFAVGYILGKLLL* |
Ga0114129_109555792 | 3300009147 | Populus Rhizosphere | VRERLTVLGFAAFVLLAIVGSAFALGYILGKLLL* |
Ga0105092_101781542 | 3300009157 | Freshwater Sediment | VTRAGERLTVLAFAAVVLPLIVGTAFAVGYILGKLLL* |
Ga0105242_131030422 | 3300009176 | Miscanthus Rhizosphere | MRERLSVLTFALVVLVAIVGLAFAAGYILGKLLL* |
Ga0114939_102634432 | 3300009455 | Groundwater | MRERVSVILFALLVLAVILGVSFAVGYILGKLLL* |
Ga0105237_109550602 | 3300009545 | Corn Rhizosphere | MRTTMRERFVVLVFALAVLLAIVGTAFAAGYILGKLLL* |
Ga0126313_115633352 | 3300009840 | Serpentine Soil | MRERIAVLTFALVVLVAIVGIAFAAGYILGKLLL* |
Ga0130016_103678502 | 3300009868 | Wastewater | MKERLSVVTFALFVVAAIVGLSFAAGYILGKLLL* |
Ga0130016_106276922 | 3300009868 | Wastewater | VRTNTRERVVVLVFALAVVAAIVGTAFAAGYILGKLLL* |
Ga0131092_1000142319 | 3300009870 | Activated Sludge | VRKPSLRERLVVLLFALVVVLVIVGTAFAAGYILGKLLL* |
Ga0131077_1001234013 | 3300009873 | Wastewater | MRERLVVFVFALAVLAAIVGTAFAAGYILGKLLL* |
Ga0131077_100367004 | 3300009873 | Wastewater | MRTTMRERFVVLLFALAVVLAIVGTAFAAGYILGRLLL* |
Ga0133939_11319834 | 3300010051 | Industrial Wastewater | MRERVSAVVLALLVLGGIVGLAFAAGYILGKLLL* |
Ga0126377_101441804 | 3300010362 | Tropical Forest Soil | VRERLTVLGFATFVLLAIVGSAFALGYILGKLLL* |
Ga0126377_105247562 | 3300010362 | Tropical Forest Soil | MRERLTVLGFATFVLLAIVGSAFAVGYILGKLLL* |
Ga0134125_127394731 | 3300010371 | Terrestrial Soil | ARAVAVTRARDRAAVLTFAAFVVLAIVGAAFAAGYILGKLLL* |
Ga0134126_120462292 | 3300010396 | Terrestrial Soil | MWERFVVLAFALGVVLAIVGTAFAAGYILGKLLL* |
Ga0134127_106994212 | 3300010399 | Terrestrial Soil | VAVTRMRDRMSVFAFATFVHLVIVGAAFAAGYILGKLLL* |
Ga0105246_105128382 | 3300011119 | Miscanthus Rhizosphere | MRERFSVLTFALVVLVAIVGLAFAAGYILGKLLL* |
Ga0136621_10682332 | 3300012092 | Polar Desert Sand | MSRKLRRTRERLTVLGFAAFLLAGIVGGAFAVGYILGKLLL* |
Ga0136621_13028582 | 3300012092 | Polar Desert Sand | MSRKRRRMRERLTVLGFAAFLLVAIVGGAFAVGYILGKLLL* |
Ga0136632_100076655 | 3300012093 | Polar Desert Sand | MSRKLRRTRERLTVLGFAALLLAGIVGGAFAVGYILGKLLL* |
Ga0150985_1040868722 | 3300012212 | Avena Fatua Rhizosphere | MRERIAVLTFALVVLVAIVGIAFATGYILGKLLL* |
Ga0137370_109062151 | 3300012285 | Vadose Zone Soil | MAHAGERLTVLGFAVVLLVAFVGLAFALGWIIGKLLL* |
Ga0157314_10283631 | 3300012500 | Arabidopsis Rhizosphere | MRDRMSVFAFATFVLLVIVGVAFAAGYILGKLLL* |
Ga0157330_10470592 | 3300012514 | Soil | MRDRMSVFAFATFVLLVIVGAAFAAGYILGKLLL* |
Ga0136612_100629293 | 3300012680 | Polar Desert Sand | VNRRRERLTVLSFALLSLAAIVGTAFALGYILGKFLL* |
Ga0136612_103089992 | 3300012680 | Polar Desert Sand | RPRLRETGSMSRKRRRMRERLTVLGFAAFLLVAIVGGAFAVGYILGKLLL* |
Ga0136614_103570773 | 3300012684 | Polar Desert Sand | MRERLTVLGFATLLLAVIVGGAFAAGYILGKLLL* |
Ga0136614_112252261 | 3300012684 | Polar Desert Sand | TGPMSRKRRRMRERLTVLGFASLLLVAIVGGGFAVGYILGKLLL* |
Ga0157287_10349421 | 3300012885 | Soil | TMRERFVVLAFALGVVLAIVGTAFAAGYILGKLLL* |
Ga0157285_103744022 | 3300012897 | Soil | VAVTRTRDRLAVLGFAGFVLLAIVGTAFVVGYILGKLLL* |
Ga0157293_101233512 | 3300012898 | Soil | TTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0157291_103992911 | 3300012902 | Soil | MRTTMRERFVVLAVALAVVLAIVGTAFAAGYILGKLLL* |
Ga0157289_101692792 | 3300012903 | Soil | MRERLSVLTFALVVLVGIVGLAFAAGYILGKLLL* |
Ga0157282_103970852 | 3300012904 | Soil | MRTTARESITVLVFALVVLLAIVGSAFAVGYILGKLL |
Ga0157286_102811882 | 3300012908 | Soil | MRERIAVLTFALVVLVGIVGIAFAAGYILGKLLL* |
Ga0164241_100313723 | 3300012943 | Soil | VAVTRTRDRLAVLTFAALVVLAIVGAAFAAGYILGKLLL* |
Ga0164241_101086193 | 3300012943 | Soil | MRDRMTVFVFAAFVLLVIVGAAFAAGYILGKLLL* |
Ga0164241_103228112 | 3300012943 | Soil | VAVTRARDRLAVLTFAAFVVLAIVGAAFAVGYILGKLLL* |
Ga0164300_104253551 | 3300012951 | Soil | MRERMTVLTFELAVLLVIVGTAFAVGYILGKLLL* |
Ga0164300_109946562 | 3300012951 | Soil | MRERLTVLTFALVVLGVIVGVAFAAGYILGKLLL* |
Ga0164299_112727421 | 3300012958 | Soil | RTTMRELFVALVFALDVVLAIVGPAFAAGYILGKLLL* |
Ga0164302_102720222 | 3300012961 | Soil | MRTTMRERFVILVFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0164302_116589002 | 3300012961 | Soil | VAVTRTRDRLAVLTFAAFVALAIVGAAFAAGYILGKLLL* |
Ga0153916_100186473 | 3300012964 | Freshwater Wetlands | MRERITVVAFALLVLAAIVGISFAAGYILGKLLL* |
Ga0168316_1142814 | 3300012981 | Weathered Mine Tailings | MRRRSRLRERVTVVAFALFVVAGVVGVAFAAGYILGRLLL* |
Ga0164309_112030682 | 3300012984 | Soil | MKRRSRTRERITVLAFALFVLAAIVGIAFAAGYILGKLLL* |
Ga0157373_103374901 | 3300013100 | Corn Rhizosphere | VTRARDRATVLTFAAFVVLAIVGAAFAAGYILGKLLL* |
Ga0157375_107213813 | 3300013308 | Miscanthus Rhizosphere | MRERIAVLTFALVVLIAIVGIAFAAGYILGKLLL* |
Ga0075325_10064362 | 3300014270 | Natural And Restored Wetlands | VTVARARERLIVLGFATFVLLAIVGTAFALGYILGKLLL* |
Ga0075305_11171242 | 3300014295 | Natural And Restored Wetlands | MRERVSVIAFALVVLAMIIGVSFAAGYILGKLLL* |
Ga0075323_10773382 | 3300014301 | Natural And Restored Wetlands | MRTTARERVTVLTFALLVLLAIVGTAFAVGYILGKLLL* |
Ga0075340_10091853 | 3300014304 | Natural And Restored Wetlands | VRRSGGSLSVLLFALAVLAAIVGISFALGYILGKLLL* |
Ga0075304_11492301 | 3300014307 | Natural And Restored Wetlands | MGERLTALTVAVVLVAVIVGGAFALGYILGKALL* |
Ga0075343_11505512 | 3300014317 | Natural And Restored Wetlands | LRERMTVLGFAALVLLAIVGSAFALGYILGKLLL* |
Ga0075351_11539692 | 3300014318 | Natural And Restored Wetlands | MRERLTVVAFALLVLAAIVGVSFAAGYILGKLLL* |
Ga0075342_11853902 | 3300014320 | Natural And Restored Wetlands | MRERMTVLGFAALVLLAIVGSAFALGYILGKLLL* |
Ga0075356_11157562 | 3300014323 | Natural And Restored Wetlands | MRDRLTAVTFALVVLAGVVGIAFAAGYILGKLLL* |
Ga0157380_104333831 | 3300014326 | Switchgrass Rhizosphere | MRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGK |
Ga0157380_115660462 | 3300014326 | Switchgrass Rhizosphere | SRGGEMRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL* |
Ga0173483_100664243 | 3300015077 | Soil | MRTTMRERFVVLAFALAVVLAILGTAFAAGYILGKLLL* |
Ga0167665_10140832 | 3300015163 | Glacier Forefield Soil | MRERISVLTFALVVLAAIVGVAFAVGYILGKLLL* |
Ga0167667_10053093 | 3300015189 | Glacier Forefield Soil | MKRRSRARERIAVLTFALFVLAAIVGVAFAAGYILGKLLL* |
Ga0167664_11087802 | 3300015208 | Glacier Forefield Soil | MRERLTVLAFAIVVLATIVGTAFACGYILGKLLL* |
Ga0132258_102144197 | 3300015371 | Arabidopsis Rhizosphere | RSRMRERITVLTFALVVLAAIVGVAFAAGYILGKLLL* |
Ga0132258_102412024 | 3300015371 | Arabidopsis Rhizosphere | MSRGSRMRERITVLTFALLVLAAIVSVAFAAGYILGKLLL* |
Ga0132258_116011052 | 3300015371 | Arabidopsis Rhizosphere | MRERITVLTFALVVLAAIVGVAFVAGYILGKLLL* |
Ga0132258_116835852 | 3300015371 | Arabidopsis Rhizosphere | MRERITVLTFALLVVGAIVGVAFAAGYILGKLLL* |
Ga0132256_1012075972 | 3300015372 | Arabidopsis Rhizosphere | MRERITVLTFALIVLAVIVGVAFAAGYILGKLLL* |
Ga0132256_1012904962 | 3300015372 | Arabidopsis Rhizosphere | MRERITVLTFALVVLAAIVGVAFAAGYILGKLLL* |
Ga0132255_1053086812 | 3300015374 | Arabidopsis Rhizosphere | RMRERLTAVGFATFVLLAIVGTAFALGYILGKLLL* |
Ga0132255_1055958462 | 3300015374 | Arabidopsis Rhizosphere | VRTTFRERVTVLTFALAVLLAIVGTAFAVGHILGKLLL* |
Ga0180121_101679132 | 3300017695 | Polar Desert Sand | VSRKLRRTRERLTVLGFAAFLLAGIVGGAFAVGYILGKLLL |
Ga0180121_102059442 | 3300017695 | Polar Desert Sand | VNRRRERLTVLSFALLALAAIVGTAFALGYILGKFLL |
Ga0180121_102457801 | 3300017695 | Polar Desert Sand | RRPGRGAAMSRSGGRMRERLTVLGFATLLLAVIVGGAFAAGYILGKLLL |
Ga0183260_100547174 | 3300017787 | Polar Desert Sand | MSRKLRRTRERLTVLGFAAFLLAGIVGGAFAVGYILGKLLL |
Ga0183260_101191892 | 3300017787 | Polar Desert Sand | MSRKRRRMRERLTVLGFAAFLLVAIVGGAFAVGYILGKLLL |
Ga0136617_1000157424 | 3300017789 | Polar Desert Sand | VTRARERLTVLSFAVVSLAAIVGTAFALGYILGKLLL |
Ga0136617_109405642 | 3300017789 | Polar Desert Sand | MSRKRGRMRERLTVLGFATFLLAAIVGGAFVAGYILGKLLL |
Ga0163161_107188412 | 3300017792 | Switchgrass Rhizosphere | MKRRSRMRERIAVLTFALVVLIAIVGIAFAAGYILGKLLL |
Ga0163161_117478512 | 3300017792 | Switchgrass Rhizosphere | VKRRSRTRERIAVLTFALVVLVAIVGIAFAAGYILGKLLL |
Ga0190266_100225144 | 3300017965 | Soil | VKGRRRMRERLTVLGFATFVLIAIVGSAFAVGYILGKLLL |
Ga0190266_101506182 | 3300017965 | Soil | VTRMRDRLTVFGFATFVLLAIVGSAFALGYILGKLLL |
Ga0190266_103754632 | 3300017965 | Soil | MKRRSRMRERIAVLTFALVVLVAIVGIAFAAGYILGKLLL |
Ga0190269_107974122 | 3300018465 | Soil | VKGRGRMRERLTVLGFATFVLVAIVGSAFAVGYILGKLLL |
Ga0190268_100244842 | 3300018466 | Soil | VKGRGRMRERLTVLGFATFVLVAIVGSAFVVGYILGKLLL |
Ga0190268_102628532 | 3300018466 | Soil | VTRMRDRLTVFGFATFLLLAIVGSAFALGYILGKLLL |
Ga0190270_103000193 | 3300018469 | Soil | VKGRGRMRERLTVLGFATFVLVAIVGSAFAVGYILGKL |
Ga0190270_112700483 | 3300018469 | Soil | RMRERLTVLGFATFVLVAIVGSAFAVGYILGKLLL |
Ga0190270_124801372 | 3300018469 | Soil | VTRMRERLTVFGFAAFVLLAIVGSAFALGYILGKLLL |
Ga0190274_102046334 | 3300018476 | Soil | VKRGRMRERLTVLGFATLVLVAIVGSAFAVGYILGKLLL |
Ga0190274_104209974 | 3300018476 | Soil | VVTRMRERLTVFGFAAFVLLAIVGSAFALGYILGKLLL |
Ga0190274_115340222 | 3300018476 | Soil | VKRRSRTRERIAVLTFALFVLAAIVGIAFAAGYILGKLLL |
Ga0190274_129686362 | 3300018476 | Soil | MKRRSRMRERIGVLTFALVVLIAIVGIAFATGYILGKLLL |
Ga0190271_100152944 | 3300018481 | Soil | MKSRMRERLTVLGFATFVLVAIVGSAFGLGYILGKLLL |
Ga0190271_109510722 | 3300018481 | Soil | VKRRGRMRERLTVLGFATFVLVAIVGSAFAVGYILGKLLL |
Ga0190271_135270791 | 3300018481 | Soil | RRSRTRERIAVLTFALFVLAAIVGIAFAAGYILGKLLL |
Ga0190271_138105822 | 3300018481 | Soil | VKTRGRMRERLTVLGFATFVLVAIVGSAFAVGYILGKLLL |
Ga0066669_103562463 | 3300018482 | Grasslands Soil | MAHAGERLTVLGFALLLLVAFVGLAFAVGWIIGKLLL |
Ga0173481_100152772 | 3300019356 | Soil | MRTTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL |
Ga0173479_105877952 | 3300019362 | Soil | MRRRSRMRERLSVLTFALVVLVAIVGLAFAAGYILGKLLL |
Ga0187893_103239202 | 3300019487 | Microbial Mat On Rocks | VSSRAGERLTVLAFALCVLVALVGTAFALGYILGKLLL |
Ga0206354_109519011 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL |
Ga0224496_103759052 | 3300022204 | Sediment | MRRSGGGVSVLLFALAMIAVIVGVAFAAGYILGKLLL |
Ga0224500_103725382 | 3300022213 | Sediment | VVSRMLERASVIAFALLVLAVLLGVAFAAGYILGKLLL |
Ga0224502_103373112 | 3300022218 | Sediment | MRRRRGGLGVLLFALCVLAVIVGVSFALGYILGKLLL |
Ga0247786_10258013 | 3300022883 | Soil | VAVTRTRDRLAVLGFAGFVLLAIVGTAFAVGYILGKLLL |
Ga0247786_10372602 | 3300022883 | Soil | VAVTRARDRATVLTFAAFVVLAIVGAAFAAGYILGKLLL |
Ga0247786_11675311 | 3300022883 | Soil | RRPRGGEMRTTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL |
Ga0247787_10274982 | 3300022893 | Soil | VAVTRMRDRMSVFAFATFVLLVIVGAAFAAGYILGKLLL |
Ga0247778_10117571 | 3300022894 | Plant Litter | RSRMRERIAVLTFALVVLVAIVGIAFAAGYILGKLLL |
Ga0247788_10419232 | 3300022901 | Soil | VAVTRTRDRLAVLGFAGFVLLAIVGTAFVVGYILGKLLL |
Ga0247788_10604481 | 3300022901 | Soil | MRTTARESITVLVFALVVLLAIVGSAFAVGYILGKL |
Ga0247754_11400332 | 3300023102 | Soil | VTRMRERLTVFGFAAFVLLGIVGSAFALGYILGKLLL |
Ga0209002_105716042 | 3300025289 | Soil | VARLGERLSVVALAALVLVAIVGSAFALGYIVGKLLL |
Ga0209002_106839302 | 3300025289 | Soil | MTRVTRIRERLTVVAFALAVLGALAGIAFAFGYIL |
Ga0210061_10304132 | 3300025537 | Natural And Restored Wetlands | VAVTRMRDRMTVFVFAAFVLLVIVGAAFAAGYILGKLLL |
Ga0210061_10855702 | 3300025537 | Natural And Restored Wetlands | MTARRARERLTVLGFAGFVLLAIVGTAFALGYILGKLLL |
Ga0210087_11084822 | 3300025559 | Natural And Restored Wetlands | MRTTARDRVTVLTFALVVLVAIVGTAFAVGYILGKLLL |
Ga0210076_11299842 | 3300025567 | Natural And Restored Wetlands | VTRMRDRMTVFVFAAFVLLVIVGAAFAAGYILGKLLL |
Ga0210115_10365592 | 3300025791 | Natural And Restored Wetlands | VTGMRERVTVLGFAALLLLAIVGSAFALGYILGKLLL |
Ga0207688_100489745 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVTRMRDRMSVFAFATFVLLVIVGVAFAAGYILGKLLL |
Ga0207645_101430482 | 3300025907 | Miscanthus Rhizosphere | MRTSMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL |
Ga0207707_102552762 | 3300025912 | Corn Rhizosphere | MTRTSMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL |
Ga0207707_104588642 | 3300025912 | Corn Rhizosphere | VAVTRARDRAAVLTFAAFVVLAIVGAAFAAGYILGKLLL |
Ga0207671_108811481 | 3300025914 | Corn Rhizosphere | TRMRDRMSVFAFATFVLLVIVGAAFAAGYILGKLLL |
Ga0207657_106198672 | 3300025919 | Corn Rhizosphere | MAGRSRMRERITVLTFALVVLAVIVGVAFAAGYILGKLLL |
Ga0207649_114718201 | 3300025920 | Corn Rhizosphere | PRGGEMRTTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL |
Ga0207681_104630541 | 3300025923 | Switchgrass Rhizosphere | ARAVAVTRMRDRMSVFAFATFVLLVIVGAAFAAGYILGKLLL |
Ga0207650_113529142 | 3300025925 | Switchgrass Rhizosphere | TRARDRAAVLTFAAFVVLAIVGAAFAAGYILGKLLL |
Ga0207687_117305411 | 3300025927 | Miscanthus Rhizosphere | VAVTRTRDRLAVLTFAAFVVLAIVGAAFAAGYILGKLLL |
Ga0207690_101767023 | 3300025932 | Corn Rhizosphere | VRTTARESITVLVFALVVLLAIVGSAFAVGYILGKLLLS |
Ga0207706_106048383 | 3300025933 | Corn Rhizosphere | LPARRPRGGEMRTTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL |
Ga0207686_103513681 | 3300025934 | Miscanthus Rhizosphere | MAGRSRMRERITVLTFALVVLAVIVGVAFAAGYILGKL |
Ga0207686_105863332 | 3300025934 | Miscanthus Rhizosphere | MKPRSRMRERIAVLTFALVVLVAIVGVAFAAGYILGKLLL |
Ga0207669_112309112 | 3300025937 | Miscanthus Rhizosphere | MKRRSRMRERIDVLTFALVVLVAIVGIAFAAGYILGKLLL |
Ga0207704_102888402 | 3300025938 | Miscanthus Rhizosphere | MRTTMRERFVILVFALAVVLAIVGTAFAAGYILGKLLL |
Ga0207711_106958922 | 3300025941 | Switchgrass Rhizosphere | MAVRSRMRERITVLTFALVVLAVIVGVAFAAGYILGKLLL |
Ga0207661_106390303 | 3300025944 | Corn Rhizosphere | MKRRSRMRERIAVLTFALVVLVGIVGIAFAAGYILGKLLL |
Ga0207668_116723071 | 3300025972 | Switchgrass Rhizosphere | VKGPGRMRERLTVLGFATFVLVAIVGSAFAVGYILGKLLL |
Ga0207658_119683082 | 3300025986 | Switchgrass Rhizosphere | RRAMKPRSRMRERIAVLTFALVVLVAIVGVAFAAGYILGKLLL |
Ga0208293_10006792 | 3300026050 | Natural And Restored Wetlands | VRRSGGSLSVLLFALAVLAAIVGISFALGYILGKLLL |
Ga0207708_105126392 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVTRTRDRLAVLTFAAFVVLAIVGAAFAAGYILGRLLL |
Ga0207648_117078582 | 3300026089 | Miscanthus Rhizosphere | VTRMRERLTVFGFAGFVLLAIVGIAFAVGYILGKLLL |
Ga0207674_107736723 | 3300026116 | Corn Rhizosphere | AVAVTRTRDRLAVLGFAGFVLLAIVGTAFAVGYILGKLLL |
Ga0207683_101349394 | 3300026121 | Miscanthus Rhizosphere | MRRHSRMRERLSVLTFALVVLVAIVGLAFAAGYILGKLLL |
Ga0207698_106827303 | 3300026142 | Corn Rhizosphere | ARDGIALPARQPRGGEMRTTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL |
Ga0209682_100252252 | 3300027716 | Wetland Sediment | MTRMRERITVVAFALLVLATIVGVSFAAGYILGKLLL |
Ga0209998_100411693 | 3300027717 | Arabidopsis Thaliana Rhizosphere | VAVTRARDRLAVLGFAGFVLLAIVGTAFAVGYILGKLLL |
Ga0209261_100084702 | 3300027735 | Wetland Sediment | VRRASRLRERLTVSAFALGLLGAILGLSFAAGYILGKLLL |
Ga0209798_105668632 | 3300027843 | Wetland Sediment | VRRRSRLRERLTVSAFALALLGAILGLSFAAGYILGKLLL |
Ga0209023_101994552 | 3300027870 | Freshwater And Sediment | MRGRSRVRERISVLTFALVILVTIVGVSFAVGYILGKLLL |
Ga0209974_103702091 | 3300027876 | Arabidopsis Thaliana Rhizosphere | KGPGRMRERLTVLGFATFVLVAIVGSAFAVGYILGKLLLS |
Ga0209481_101591262 | 3300027880 | Populus Rhizosphere | VAVTRMRGRMSVFAFATFVLLVIVGAAFAAGYILGKLLL |
Ga0209486_102976771 | 3300027886 | Agricultural Soil | VTRMRERLTVLGFAAFVLLAIVGTAFAVGYILGKLLL |
Ga0209068_100648502 | 3300027894 | Watersheds | MRKRSRMQERIAVVTFALCIVAALVGIAFAAGYILGKILL |
Ga0209254_1000239318 | 3300027897 | Freshwater Lake Sediment | VSGRSRTRERIAVLAFALFVLAGLVGIAFAAGYILGKLLL |
Ga0207428_107063712 | 3300027907 | Populus Rhizosphere | VTRMRERLTVLGFATFVLLAIVGTAFALGYILGKLLL |
Ga0209069_103319182 | 3300027915 | Watersheds | VRKRSRMQERIAVVTFALVIVLALVGIAFAAGYILGKILL |
Ga0210366_104881682 | 3300028420 | Estuarine | MTRMTERLAVVAFAIAMLAAIVGLAFALGYILGKALL |
Ga0247828_102307321 | 3300028587 | Soil | AVTRARDRLAVLGLAAFVLLAIVGTAFAVGYILGKLLL |
Ga0247828_103531713 | 3300028587 | Soil | VKARGRMRERLTVLGFATFVLVAIVGSAFAVGYILGKLLL |
Ga0247828_111720571 | 3300028587 | Soil | VAVTRARDRLAVLGLAAFVLLAIVGTAFAVGYILGKLLL |
Ga0247823_108597342 | 3300028590 | Soil | RSRGGEMRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL |
Ga0247819_102028641 | 3300028608 | Soil | ALPARRPRGGEMRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL |
Ga0302261_11119592 | 3300028733 | Fen | MKRRSRTRERIAVLTFALVVLTAIVGIAFAAGYILGKLLL |
Ga0307306_101757052 | 3300028782 | Soil | PMKRRSRMRERIAVLTFALVVLVAIVGMAFAAGYILGKLLL |
Ga0307283_101702352 | 3300028790 | Soil | RRSRMRERIAVLTFALVVLVAIVGMAFAAGYILGKLLL |
Ga0307503_104833152 | 3300028802 | Soil | VKRRSRTRERIAVLTFALFVLAGIVGIAFAAGYILGKLLL |
Ga0307503_105233442 | 3300028802 | Soil | MKRRSRMRERIAVLTFALVVLVAIVGVAFAAGYILGKLLL |
Ga0311334_117671942 | 3300029987 | Fen | MKKHSRMRERISVLMFAVIVLVTIVGAAFAVGYILGKLIL |
Ga0311337_110252362 | 3300030000 | Fen | MRRRSRTRERIAVLTFALVVLTAIVGIAFAAGYILGKLLL |
Ga0311333_100541284 | 3300030114 | Fen | VKRRSRTRERITVLTFALVVVFAIVGIAFAAGYILGKLLL |
Ga0311349_108110081 | 3300030294 | Fen | SGRSRMRERLTALTFALVVLAAVVGIAFAAGYILGKLLL |
Ga0247826_102145632 | 3300030336 | Soil | MSPRSRTRERITVLTFALVVLMGIVGIAFAAGYILGKLLL |
Ga0247826_102145634 | 3300030336 | Soil | MSRGSRMRERITVLTFALIVLAAIVGVAFAAGYILGKLLL |
Ga0247826_102826783 | 3300030336 | Soil | VTRMRERLTVFGFAGFVLLAIVGTAFALGYILGKLLL |
Ga0307500_102991572 | 3300031198 | Soil | MMAGRSRMRERITVLTFALLVLAAIVGVAFAAGYILGKLLL |
Ga0307497_107706641 | 3300031226 | Soil | GRGGGVRRSRMRERLTAVTVAIVVVLALVGIAFAAGYILGKLLL |
Ga0307506_101387162 | 3300031366 | Soil | MKRRSRTRERITVLTFAIVVLVAIVGIAFAAGYILGKLLL |
Ga0247727_1000155611 | 3300031576 | Biofilm | MTRLTRVRERLTVVGFALAVVAAIAGIAFAVGYILGKVLI |
Ga0247727_100444075 | 3300031576 | Biofilm | MTRVTRIRERLTVVAFALAVLAALAGIAFAVGYILGKVLI |
Ga0307468_1004812172 | 3300031740 | Hardwood Forest Soil | MAARSRMRERITVLTFALVVLAAIVGVAFAAGYILGKLLL |
Ga0315290_100057692 | 3300031834 | Sediment | MTRMRERITVVLFALLVLAALVGTAFAAGYILGRLLL |
Ga0315290_100150745 | 3300031834 | Sediment | VSGHSRTRERITVLTFAIVVLVGLVGIAFAAGYILGKLLL |
Ga0315290_104718542 | 3300031834 | Sediment | VTGRSRARERVTVLAFAIFVLVALVGLAFAAGYILGKLLL |
Ga0315290_106377022 | 3300031834 | Sediment | MTGRSRMRERISVLTFALVVLVTIVGVAFAVGYILGKLLL |
Ga0315290_111814531 | 3300031834 | Sediment | DPVSGRSRTRERITVLTFAIVILVGLVGIAFAAGYILGKLLL |
Ga0315297_100833032 | 3300031873 | Sediment | VSRRSRMRERISVLAFALIVLVTIVGAAFAVGYILGKLIL |
Ga0310891_103587091 | 3300031913 | Soil | LPARRSRGGEMRTTMRERFVVLVFALAVVLAIVGTAFAAGYILGKLLL |
Ga0308175_1003639442 | 3300031938 | Soil | MRTTMGERFVVLAFALAVVLAIVGTAFAAGYILGKLLL |
Ga0308175_1027340912 | 3300031938 | Soil | VAVTRMRDRMTVFAFAAFVLLAIVGAAFAAGYILGKLLL |
Ga0310884_108492012 | 3300031944 | Soil | VTRMRERLTVFGFAGFVLLAIVGIAFVLGYILGKLLL |
Ga0214473_115550632 | 3300031949 | Soil | HGRNGAAMARVTRVRERLTVVAFALAVVAAIAGIAFAVGYILGKVLI |
Ga0315278_100490684 | 3300031997 | Sediment | MSGRSRTRERITVLAFAIVVLVGLVGIAFAAGYILGKLLL |
Ga0315278_100930273 | 3300031997 | Sediment | VSRRSRMRERISVLAFALIVLVTIVGAAFALGYILGKLIL |
Ga0315278_104840663 | 3300031997 | Sediment | MRTRSRMRERLSVLTLALVILAVIVGVAFAAGYILGKLLL |
Ga0315278_119110381 | 3300031997 | Sediment | MTGRSRMRERIGVLTFALVVLVTIVGVAFAVGYILGKLLL |
Ga0307416_1024076322 | 3300032002 | Rhizosphere | VTRMRERVTVLGFATFLLLAIVGSAFALGYNLGKLLL |
Ga0310897_102529562 | 3300032003 | Soil | VKRMRERLTVFGFAGFVLLAIVGTAFALGYILGKLLL |
Ga0310902_111949021 | 3300032012 | Soil | TRMRDRMSVFAFATFVLLVIVGVAFAAGYILGKLLL |
Ga0315292_111023042 | 3300032143 | Sediment | VTGRSRTRERITVLTFAIVVLVGLVGIAFAAGYILGKLLL |
Ga0315292_114237721 | 3300032143 | Sediment | HAVSGHSRTRERITVLTFAIVVLVGLVGIAFAAGYILGKLLL |
Ga0315292_115554292 | 3300032143 | Sediment | VSGRSRTRERITVLTFAIVILVGLVGIAFAAGYILGKLLL |
Ga0315283_102461153 | 3300032164 | Sediment | VTGRSRARERITVLAFAVFVLVGLVGIAFAAGYILGKLLL |
Ga0315283_106345911 | 3300032164 | Sediment | MRKRSRMRERLSVLTFALVILAVIVGVAFAVGYILGKLLL |
Ga0315283_115250532 | 3300032164 | Sediment | MAGRSRMRERISVLTFALVVLVTIVGVAFAVGYILGKLLL |
Ga0315268_111980752 | 3300032173 | Sediment | MSGRSRTRERITVLTFAIVVLVGLVGIAFAAGYILGKLLL |
Ga0307472_1009277342 | 3300032205 | Hardwood Forest Soil | LSRGSRMRERITVLTFALLVLAAIVGVAFAAGYILGKLLL |
Ga0315271_106539031 | 3300032256 | Sediment | MRGRSRMRERISVVTFALVVVAVLVSAAFALGYILGKILL |
Ga0315270_104327942 | 3300032275 | Sediment | MKSPSRMRERVTAVTFALIVLAVIVGVAFAAGYILGKALL |
Ga0315270_112256802 | 3300032275 | Sediment | MKSPSRMRERVTAVTFALIVVAIIVGVAFAAGYILGKALL |
Ga0315286_114334351 | 3300032342 | Sediment | MTGRSRMRERISVLTFALAVLVTIVGVAFAVGYILGKLLL |
Ga0315287_102208193 | 3300032397 | Sediment | MTGRSRMRERISVLTFALVVLFTIVGVAFAVGYILGKLLL |
Ga0315287_107139832 | 3300032397 | Sediment | MSGRSRTRERITVLAFALFVLAGLVGIAFAAGYILGKLLL |
Ga0310810_104726224 | 3300033412 | Soil | AVAVTRARDRLAVLGFAGFVLLAIVGTAFAVGYILGKLLL |
Ga0310811_111203702 | 3300033475 | Soil | MKTTMRERFVVLAFALAVVLAIVGTAFAAGYILGKLLL |
Ga0247830_105538321 | 3300033551 | Soil | GRGRMRERLTVLGFATFVLVAIVGSAFAVGYILGKLLL |
Ga0247830_107653512 | 3300033551 | Soil | GRAVTRMRERLTVFGFAAFVLLAIVGSAFALGYILGKLLL |
⦗Top⦘ |