


| Basic Information | |
|---|---|
| Family ID | F008617 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 330 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MINRINNAICLLIVAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 330 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 36.17 % |
| % of genes near scaffold ends (potentially truncated) | 20.00 % |
| % of genes from short scaffolds (< 2000 bps) | 64.85 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.576 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (31.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.515 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (49.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 36.62% β-sheet: 0.00% Coil/Unstructured: 63.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 330 Family Scaffolds |
|---|---|---|
| PF12684 | DUF3799 | 6.67 |
| PF11753 | DUF3310 | 5.45 |
| PF12728 | HTH_17 | 4.85 |
| PF03330 | DPBB_1 | 3.33 |
| PF04851 | ResIII | 2.73 |
| PF08291 | Peptidase_M15_3 | 1.82 |
| PF08774 | VRR_NUC | 1.21 |
| PF00271 | Helicase_C | 0.91 |
| PF14279 | HNH_5 | 0.91 |
| PF04545 | Sigma70_r4 | 0.91 |
| PF01555 | N6_N4_Mtase | 0.61 |
| PF13264 | DUF4055 | 0.61 |
| PF13884 | Peptidase_S74 | 0.61 |
| PF03837 | RecT | 0.61 |
| PF13936 | HTH_38 | 0.61 |
| PF09250 | Prim-Pol | 0.61 |
| PF01844 | HNH | 0.61 |
| PF13730 | HTH_36 | 0.61 |
| PF05939 | Phage_min_tail | 0.30 |
| PF13392 | HNH_3 | 0.30 |
| PF05100 | Phage_tail_L | 0.30 |
| PF01402 | RHH_1 | 0.30 |
| PF13604 | AAA_30 | 0.30 |
| PF03237 | Terminase_6N | 0.30 |
| PF10571 | UPF0547 | 0.30 |
| PF06339 | Ectoine_synth | 0.30 |
| PF00436 | SSB | 0.30 |
| PF12851 | Tet_JBP | 0.30 |
| PF00692 | dUTPase | 0.30 |
| PF05876 | GpA_ATPase | 0.30 |
| PF00176 | SNF2-rel_dom | 0.30 |
| PF04093 | MreD | 0.30 |
| PF05118 | Asp_Arg_Hydrox | 0.30 |
| COG ID | Name | Functional Category | % Frequency in 330 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.61 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.61 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.61 |
| COG3723 | Recombinational DNA repair protein RecT | Replication, recombination and repair [L] | 0.61 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.30 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.30 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 0.30 |
| COG2891 | Cell shape-determining protein MreD | Cell wall/membrane/envelope biogenesis [M] | 0.30 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.30 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.30 |
| COG4672 | Phage tail protein | Mobilome: prophages, transposons [X] | 0.30 |
| COG4718 | Phage tail protein | Mobilome: prophages, transposons [X] | 0.30 |
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 0.30 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.42 % |
| Unclassified | root | N/A | 47.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000401|BB_Man_B_Liq_inBBDRAFT_1000148 | Not Available | 12340 | Open in IMG/M |
| 3300000756|JGI12421J11937_10016945 | Not Available | 2728 | Open in IMG/M |
| 3300001838|RCM33_1016059 | Not Available | 560 | Open in IMG/M |
| 3300001847|RCM41_1057048 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300001847|RCM41_1058151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1914 | Open in IMG/M |
| 3300001848|RCM47_1000535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2713 | Open in IMG/M |
| 3300002835|B570J40625_100024823 | All Organisms → cellular organisms → Bacteria | 9829 | Open in IMG/M |
| 3300002835|B570J40625_100032127 | Not Available | 8191 | Open in IMG/M |
| 3300002835|B570J40625_100080370 | Not Available | 4219 | Open in IMG/M |
| 3300002835|B570J40625_100752411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 864 | Open in IMG/M |
| 3300002835|B570J40625_101213177 | Not Available | 631 | Open in IMG/M |
| 3300002835|B570J40625_101344561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 592 | Open in IMG/M |
| 3300003430|JGI25921J50272_10051179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 940 | Open in IMG/M |
| 3300004240|Ga0007787_10013030 | Not Available | 3361 | Open in IMG/M |
| 3300005525|Ga0068877_10395329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 781 | Open in IMG/M |
| 3300005527|Ga0068876_10003866 | Not Available | 10631 | Open in IMG/M |
| 3300005662|Ga0078894_10060981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 3229 | Open in IMG/M |
| 3300005739|Ga0076948_1019098 | All Organisms → cellular organisms → Bacteria | 30623 | Open in IMG/M |
| 3300005739|Ga0076948_1104953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4114 | Open in IMG/M |
| 3300005758|Ga0078117_1007709 | Not Available | 5561 | Open in IMG/M |
| 3300005805|Ga0079957_1022273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4385 | Open in IMG/M |
| 3300005805|Ga0079957_1111591 | Not Available | 1465 | Open in IMG/M |
| 3300005805|Ga0079957_1273605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 772 | Open in IMG/M |
| 3300005940|Ga0073913_10003841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1987 | Open in IMG/M |
| 3300005992|Ga0073924_1067033 | Not Available | 533 | Open in IMG/M |
| 3300006026|Ga0075478_10000627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12682 | Open in IMG/M |
| 3300006026|Ga0075478_10045349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1448 | Open in IMG/M |
| 3300006026|Ga0075478_10164832 | Not Available | 687 | Open in IMG/M |
| 3300006030|Ga0075470_10000499 | Not Available | 12666 | Open in IMG/M |
| 3300006637|Ga0075461_10233581 | Not Available | 543 | Open in IMG/M |
| 3300006802|Ga0070749_10003376 | All Organisms → cellular organisms → Bacteria | 10700 | Open in IMG/M |
| 3300006802|Ga0070749_10006902 | Not Available | 7425 | Open in IMG/M |
| 3300006802|Ga0070749_10036686 | Not Available | 3028 | Open in IMG/M |
| 3300006802|Ga0070749_10056881 | Not Available | 2367 | Open in IMG/M |
| 3300006802|Ga0070749_10063917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Cyanophage KBS-S-2A | 2217 | Open in IMG/M |
| 3300006802|Ga0070749_10123766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 1518 | Open in IMG/M |
| 3300006802|Ga0070749_10267859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 964 | Open in IMG/M |
| 3300006802|Ga0070749_10322048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 863 | Open in IMG/M |
| 3300006802|Ga0070749_10329688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 851 | Open in IMG/M |
| 3300006802|Ga0070749_10376559 | Not Available | 786 | Open in IMG/M |
| 3300006802|Ga0070749_10719410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 533 | Open in IMG/M |
| 3300006810|Ga0070754_10033254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 2857 | Open in IMG/M |
| 3300006810|Ga0070754_10113820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1324 | Open in IMG/M |
| 3300006810|Ga0070754_10251961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300006810|Ga0070754_10437384 | Not Available | 569 | Open in IMG/M |
| 3300006810|Ga0070754_10532666 | Not Available | 503 | Open in IMG/M |
| 3300006874|Ga0075475_10291637 | Not Available | 675 | Open in IMG/M |
| 3300006916|Ga0070750_10115136 | Not Available | 1237 | Open in IMG/M |
| 3300006919|Ga0070746_10054058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2086 | Open in IMG/M |
| 3300006919|Ga0070746_10162820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1080 | Open in IMG/M |
| 3300007214|Ga0103959_1124515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2008 | Open in IMG/M |
| 3300007345|Ga0070752_1315202 | Not Available | 593 | Open in IMG/M |
| 3300007538|Ga0099851_1016075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 3038 | Open in IMG/M |
| 3300007538|Ga0099851_1077022 | All Organisms → Viruses | 1287 | Open in IMG/M |
| 3300007538|Ga0099851_1107494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 1060 | Open in IMG/M |
| 3300007538|Ga0099851_1120765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 990 | Open in IMG/M |
| 3300007538|Ga0099851_1129097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 951 | Open in IMG/M |
| 3300007538|Ga0099851_1158241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 840 | Open in IMG/M |
| 3300007538|Ga0099851_1230865 | Not Available | 666 | Open in IMG/M |
| 3300007538|Ga0099851_1240368 | Not Available | 650 | Open in IMG/M |
| 3300007538|Ga0099851_1349067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 517 | Open in IMG/M |
| 3300007539|Ga0099849_1065849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paucimonas → Paucimonas lemoignei | 1485 | Open in IMG/M |
| 3300007541|Ga0099848_1010618 | Not Available | 4063 | Open in IMG/M |
| 3300007541|Ga0099848_1046596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1758 | Open in IMG/M |
| 3300007541|Ga0099848_1051552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1656 | Open in IMG/M |
| 3300007541|Ga0099848_1056269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1574 | Open in IMG/M |
| 3300007541|Ga0099848_1066685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1423 | Open in IMG/M |
| 3300007541|Ga0099848_1077949 | Not Available | 1296 | Open in IMG/M |
| 3300007541|Ga0099848_1100473 | Not Available | 1110 | Open in IMG/M |
| 3300007541|Ga0099848_1105962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1074 | Open in IMG/M |
| 3300007541|Ga0099848_1203065 | Not Available | 710 | Open in IMG/M |
| 3300007541|Ga0099848_1214444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 686 | Open in IMG/M |
| 3300007541|Ga0099848_1220473 | Not Available | 673 | Open in IMG/M |
| 3300007541|Ga0099848_1275767 | Not Available | 582 | Open in IMG/M |
| 3300007542|Ga0099846_1090215 | Not Available | 1135 | Open in IMG/M |
| 3300007542|Ga0099846_1100875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1062 | Open in IMG/M |
| 3300007542|Ga0099846_1193153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 720 | Open in IMG/M |
| 3300007542|Ga0099846_1208287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 688 | Open in IMG/M |
| 3300007639|Ga0102865_1003821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3957 | Open in IMG/M |
| 3300007640|Ga0070751_1004048 | Not Available | 8090 | Open in IMG/M |
| 3300007735|Ga0104988_10540 | Not Available | 17275 | Open in IMG/M |
| 3300007960|Ga0099850_1074315 | Not Available | 1423 | Open in IMG/M |
| 3300007960|Ga0099850_1094914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
| 3300007960|Ga0099850_1375237 | All Organisms → Viruses | 530 | Open in IMG/M |
| 3300007960|Ga0099850_1404741 | Not Available | 505 | Open in IMG/M |
| 3300007974|Ga0105747_1331817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 519 | Open in IMG/M |
| 3300008266|Ga0114363_1002709 | Not Available | 9769 | Open in IMG/M |
| 3300008266|Ga0114363_1006899 | Not Available | 5640 | Open in IMG/M |
| 3300008267|Ga0114364_1000195 | Not Available | 36140 | Open in IMG/M |
| 3300008448|Ga0114876_1077627 | Not Available | 1390 | Open in IMG/M |
| 3300009085|Ga0105103_10483994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 693 | Open in IMG/M |
| 3300009169|Ga0105097_10112949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1488 | Open in IMG/M |
| 3300009233|Ga0103856_10090178 | Not Available | 576 | Open in IMG/M |
| 3300009239|Ga0103858_10154474 | Not Available | 593 | Open in IMG/M |
| 3300009474|Ga0127390_1004559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4383 | Open in IMG/M |
| 3300010318|Ga0136656_1290603 | Not Available | 532 | Open in IMG/M |
| 3300010354|Ga0129333_10000578 | Not Available | 30578 | Open in IMG/M |
| 3300010354|Ga0129333_10002698 | Not Available | 16563 | Open in IMG/M |
| 3300010354|Ga0129333_10003800 | Not Available | 14167 | Open in IMG/M |
| 3300010354|Ga0129333_10006089 | Not Available | 11395 | Open in IMG/M |
| 3300010354|Ga0129333_10015251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7301 | Open in IMG/M |
| 3300010354|Ga0129333_10093039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 2787 | Open in IMG/M |
| 3300010354|Ga0129333_10099275 | All Organisms → Viruses → Predicted Viral | 2690 | Open in IMG/M |
| 3300010354|Ga0129333_10121075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2410 | Open in IMG/M |
| 3300010354|Ga0129333_10142103 | Not Available | 2205 | Open in IMG/M |
| 3300010354|Ga0129333_10147358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2161 | Open in IMG/M |
| 3300010354|Ga0129333_10191165 | Not Available | 1864 | Open in IMG/M |
| 3300010354|Ga0129333_10226008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1696 | Open in IMG/M |
| 3300010354|Ga0129333_10236272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1652 | Open in IMG/M |
| 3300010354|Ga0129333_10415273 | All Organisms → Viruses | 1189 | Open in IMG/M |
| 3300010354|Ga0129333_10748498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 837 | Open in IMG/M |
| 3300010354|Ga0129333_10751792 | Not Available | 835 | Open in IMG/M |
| 3300010354|Ga0129333_10807356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 799 | Open in IMG/M |
| 3300010354|Ga0129333_10968380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 717 | Open in IMG/M |
| 3300010354|Ga0129333_11019251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 695 | Open in IMG/M |
| 3300010354|Ga0129333_11099246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 664 | Open in IMG/M |
| 3300010354|Ga0129333_11245832 | Not Available | 616 | Open in IMG/M |
| 3300010354|Ga0129333_11355600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 586 | Open in IMG/M |
| 3300010354|Ga0129333_11386093 | Not Available | 579 | Open in IMG/M |
| 3300010354|Ga0129333_11464705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 560 | Open in IMG/M |
| 3300010354|Ga0129333_11632601 | Not Available | 526 | Open in IMG/M |
| 3300010370|Ga0129336_10010969 | All Organisms → cellular organisms → Bacteria | 5547 | Open in IMG/M |
| 3300010370|Ga0129336_10147168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1362 | Open in IMG/M |
| 3300010370|Ga0129336_10424798 | Not Available | 723 | Open in IMG/M |
| 3300010370|Ga0129336_10528174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 634 | Open in IMG/M |
| 3300010370|Ga0129336_10664909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 553 | Open in IMG/M |
| 3300010389|Ga0136549_10001211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19264 | Open in IMG/M |
| 3300010389|Ga0136549_10115700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → unclassified Coriobacteriales → Coriobacteriales bacterium OH1046 | 1242 | Open in IMG/M |
| 3300010389|Ga0136549_10118825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → unclassified Coriobacteriales → Coriobacteriales bacterium OH1046 | 1221 | Open in IMG/M |
| 3300013004|Ga0164293_10612896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 706 | Open in IMG/M |
| 3300013087|Ga0163212_1019986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2432 | Open in IMG/M |
| 3300013087|Ga0163212_1170338 | Not Available | 685 | Open in IMG/M |
| 3300013087|Ga0163212_1270554 | Not Available | 526 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10151648 | Not Available | 1530 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10355391 | Not Available | 843 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10073368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 3069 | Open in IMG/M |
| 3300013372|Ga0177922_10025201 | Not Available | 556 | Open in IMG/M |
| 3300013372|Ga0177922_10837466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1055 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10497976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 682 | Open in IMG/M |
| 3300017707|Ga0181363_1022324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 1234 | Open in IMG/M |
| 3300017785|Ga0181355_1155290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 922 | Open in IMG/M |
| 3300017785|Ga0181355_1207259 | Not Available | 768 | Open in IMG/M |
| 3300019784|Ga0181359_1020087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 2523 | Open in IMG/M |
| 3300019784|Ga0181359_1032453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2018 | Open in IMG/M |
| 3300019784|Ga0181359_1065089 | All Organisms → Viruses → Predicted Viral | 1389 | Open in IMG/M |
| 3300020074|Ga0194113_10150553 | Not Available | 1934 | Open in IMG/M |
| 3300020074|Ga0194113_10277768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1284 | Open in IMG/M |
| 3300020074|Ga0194113_10627721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 754 | Open in IMG/M |
| 3300020083|Ga0194111_10474960 | Not Available | 809 | Open in IMG/M |
| 3300020084|Ga0194110_10075813 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2879 | Open in IMG/M |
| 3300020109|Ga0194112_10312867 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300020109|Ga0194112_10393917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1005 | Open in IMG/M |
| 3300020172|Ga0211729_10691586 | Not Available | 704 | Open in IMG/M |
| 3300020172|Ga0211729_11348137 | Not Available | 9064 | Open in IMG/M |
| 3300020179|Ga0194134_10005222 | Not Available | 12450 | Open in IMG/M |
| 3300020179|Ga0194134_10032710 | Not Available | 3135 | Open in IMG/M |
| 3300020179|Ga0194134_10202516 | Not Available | 851 | Open in IMG/M |
| 3300020183|Ga0194115_10001276 | Not Available | 32549 | Open in IMG/M |
| 3300020183|Ga0194115_10004667 | Not Available | 14592 | Open in IMG/M |
| 3300020183|Ga0194115_10021484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4984 | Open in IMG/M |
| 3300020183|Ga0194115_10195246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 1004 | Open in IMG/M |
| 3300020183|Ga0194115_10274705 | Not Available | 783 | Open in IMG/M |
| 3300020190|Ga0194118_10241170 | Not Available | 1000 | Open in IMG/M |
| 3300020190|Ga0194118_10310769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 837 | Open in IMG/M |
| 3300020190|Ga0194118_10586629 | Not Available | 512 | Open in IMG/M |
| 3300020196|Ga0194124_10098452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1670 | Open in IMG/M |
| 3300020204|Ga0194116_10497958 | Not Available | 574 | Open in IMG/M |
| 3300020220|Ga0194119_10374452 | Not Available | 930 | Open in IMG/M |
| 3300020494|Ga0208326_100001 | Not Available | 38982 | Open in IMG/M |
| 3300020498|Ga0208050_1000465 | Not Available | 6531 | Open in IMG/M |
| 3300020498|Ga0208050_1000767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 4799 | Open in IMG/M |
| 3300020518|Ga0208721_1001074 | All Organisms → Viruses | 4903 | Open in IMG/M |
| 3300020518|Ga0208721_1003462 | Not Available | 2419 | Open in IMG/M |
| 3300020566|Ga0208222_1083251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 532 | Open in IMG/M |
| 3300021092|Ga0194122_10188533 | Not Available | 1091 | Open in IMG/M |
| 3300021323|Ga0210295_1009282 | Not Available | 1584 | Open in IMG/M |
| 3300021376|Ga0194130_10035842 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3770 | Open in IMG/M |
| 3300021960|Ga0222715_10143997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1485 | Open in IMG/M |
| 3300021961|Ga0222714_10002580 | Not Available | 19033 | Open in IMG/M |
| 3300021961|Ga0222714_10004573 | Not Available | 13462 | Open in IMG/M |
| 3300021961|Ga0222714_10025046 | Not Available | 4560 | Open in IMG/M |
| 3300021961|Ga0222714_10053950 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
| 3300021961|Ga0222714_10083311 | All Organisms → Viruses → Predicted Viral | 2077 | Open in IMG/M |
| 3300021961|Ga0222714_10083733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2070 | Open in IMG/M |
| 3300021961|Ga0222714_10137747 | Not Available | 1483 | Open in IMG/M |
| 3300021961|Ga0222714_10283243 | Not Available | 916 | Open in IMG/M |
| 3300021961|Ga0222714_10421548 | Not Available | 700 | Open in IMG/M |
| 3300021962|Ga0222713_10004224 | Not Available | 14487 | Open in IMG/M |
| 3300021962|Ga0222713_10058336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2913 | Open in IMG/M |
| 3300021962|Ga0222713_10139234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1689 | Open in IMG/M |
| 3300021962|Ga0222713_10306237 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300021962|Ga0222713_10328565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 964 | Open in IMG/M |
| 3300021962|Ga0222713_10783290 | Not Available | 534 | Open in IMG/M |
| 3300021963|Ga0222712_10003389 | Not Available | 17403 | Open in IMG/M |
| 3300021963|Ga0222712_10005929 | Not Available | 12202 | Open in IMG/M |
| 3300021963|Ga0222712_10097729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2061 | Open in IMG/M |
| 3300022063|Ga0212029_1065669 | Not Available | 532 | Open in IMG/M |
| 3300022069|Ga0212026_1067047 | Not Available | 545 | Open in IMG/M |
| 3300022176|Ga0212031_1004457 | All Organisms → Viruses | 1716 | Open in IMG/M |
| 3300022176|Ga0212031_1026422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 927 | Open in IMG/M |
| 3300022176|Ga0212031_1063888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 624 | Open in IMG/M |
| 3300022176|Ga0212031_1075587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 573 | Open in IMG/M |
| 3300022179|Ga0181353_1042669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1197 | Open in IMG/M |
| 3300022179|Ga0181353_1113905 | Not Available | 653 | Open in IMG/M |
| 3300022179|Ga0181353_1121822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 623 | Open in IMG/M |
| 3300022198|Ga0196905_1000303 | Not Available | 19988 | Open in IMG/M |
| 3300022198|Ga0196905_1000752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 12940 | Open in IMG/M |
| 3300022198|Ga0196905_1002314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7145 | Open in IMG/M |
| 3300022198|Ga0196905_1003858 | All Organisms → Viruses | 5421 | Open in IMG/M |
| 3300022198|Ga0196905_1008656 | Not Available | 3439 | Open in IMG/M |
| 3300022198|Ga0196905_1030430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1623 | Open in IMG/M |
| 3300022198|Ga0196905_1039575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → unclassified Coriobacteriales → Coriobacteriales bacterium OH1046 | 1380 | Open in IMG/M |
| 3300022198|Ga0196905_1062346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1039 | Open in IMG/M |
| 3300022198|Ga0196905_1067810 | Not Available | 987 | Open in IMG/M |
| 3300022198|Ga0196905_1153063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 593 | Open in IMG/M |
| 3300022198|Ga0196905_1168986 | Not Available | 557 | Open in IMG/M |
| 3300022200|Ga0196901_1003622 | Not Available | 7139 | Open in IMG/M |
| 3300022200|Ga0196901_1244156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 559 | Open in IMG/M |
| 3300022200|Ga0196901_1245787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 557 | Open in IMG/M |
| 3300022200|Ga0196901_1283203 | Not Available | 504 | Open in IMG/M |
| 3300022407|Ga0181351_1053654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1676 | Open in IMG/M |
| 3300022407|Ga0181351_1067869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1451 | Open in IMG/M |
| 3300022748|Ga0228702_1042692 | Not Available | 1271 | Open in IMG/M |
| 3300022752|Ga0214917_10083846 | Not Available | 1933 | Open in IMG/M |
| 3300022752|Ga0214917_10280733 | Not Available | 754 | Open in IMG/M |
| 3300022752|Ga0214917_10454692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 509 | Open in IMG/M |
| 3300024289|Ga0255147_1000068 | Not Available | 46250 | Open in IMG/M |
| 3300024289|Ga0255147_1000546 | All Organisms → cellular organisms → Bacteria | 10408 | Open in IMG/M |
| 3300024289|Ga0255147_1001491 | Not Available | 5829 | Open in IMG/M |
| 3300024289|Ga0255147_1002081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 4881 | Open in IMG/M |
| 3300024289|Ga0255147_1060163 | Not Available | 727 | Open in IMG/M |
| 3300024346|Ga0244775_10809695 | Not Available | 749 | Open in IMG/M |
| 3300024502|Ga0255181_1070253 | Not Available | 574 | Open in IMG/M |
| 3300024507|Ga0255176_1019080 | Not Available | 1380 | Open in IMG/M |
| 3300024565|Ga0255273_1099149 | Not Available | 667 | Open in IMG/M |
| 3300025283|Ga0208048_1036108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1298 | Open in IMG/M |
| 3300025283|Ga0208048_1071404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii | 780 | Open in IMG/M |
| 3300025610|Ga0208149_1002053 | Not Available | 7213 | Open in IMG/M |
| 3300025610|Ga0208149_1045122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1157 | Open in IMG/M |
| 3300025646|Ga0208161_1029279 | Not Available | 1958 | Open in IMG/M |
| 3300025646|Ga0208161_1052639 | Not Available | 1292 | Open in IMG/M |
| 3300025646|Ga0208161_1087552 | Not Available | 886 | Open in IMG/M |
| 3300025646|Ga0208161_1140096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 616 | Open in IMG/M |
| 3300025646|Ga0208161_1166569 | Not Available | 534 | Open in IMG/M |
| 3300025647|Ga0208160_1031040 | All Organisms → Viruses | 1619 | Open in IMG/M |
| 3300025647|Ga0208160_1136785 | Not Available | 605 | Open in IMG/M |
| 3300025653|Ga0208428_1001324 | All Organisms → Viruses | 10454 | Open in IMG/M |
| 3300025655|Ga0208795_1099617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 780 | Open in IMG/M |
| 3300025671|Ga0208898_1021130 | Not Available | 2870 | Open in IMG/M |
| 3300025674|Ga0208162_1032600 | All Organisms → Viruses | 1890 | Open in IMG/M |
| 3300025687|Ga0208019_1088951 | Not Available | 970 | Open in IMG/M |
| 3300025687|Ga0208019_1158469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 631 | Open in IMG/M |
| 3300025769|Ga0208767_1166708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 781 | Open in IMG/M |
| 3300025769|Ga0208767_1177830 | Not Available | 741 | Open in IMG/M |
| 3300025818|Ga0208542_1111098 | Not Available | 778 | Open in IMG/M |
| 3300025853|Ga0208645_1252020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 587 | Open in IMG/M |
| 3300025889|Ga0208644_1001632 | Not Available | 18564 | Open in IMG/M |
| 3300025889|Ga0208644_1001749 | Not Available | 17907 | Open in IMG/M |
| 3300025889|Ga0208644_1009880 | Not Available | 6603 | Open in IMG/M |
| 3300025889|Ga0208644_1026035 | Not Available | 3591 | Open in IMG/M |
| 3300025889|Ga0208644_1114383 | Not Available | 1300 | Open in IMG/M |
| 3300025889|Ga0208644_1171795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. HF4 | 971 | Open in IMG/M |
| 3300025889|Ga0208644_1308572 | Not Available | 625 | Open in IMG/M |
| 3300026457|Ga0255160_1033807 | Not Available | 887 | Open in IMG/M |
| 3300026459|Ga0255170_1065637 | Not Available | 617 | Open in IMG/M |
| 3300026478|Ga0255156_1027818 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300027127|Ga0255071_1062217 | Not Available | 533 | Open in IMG/M |
| 3300027135|Ga0255073_1008973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1896 | Open in IMG/M |
| 3300027135|Ga0255073_1043652 | Not Available | 745 | Open in IMG/M |
| 3300027140|Ga0255080_1007996 | All Organisms → Viruses | 1909 | Open in IMG/M |
| 3300027467|Ga0255154_1010539 | All Organisms → Viruses → Predicted Viral | 2196 | Open in IMG/M |
| 3300027486|Ga0255086_1000086 | Not Available | 31208 | Open in IMG/M |
| 3300027601|Ga0255079_1002844 | Not Available | 4549 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1038724 | Not Available | 2956 | Open in IMG/M |
| 3300027797|Ga0209107_10001864 | Not Available | 11766 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10173046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS2 | 741 | Open in IMG/M |
| 3300027917|Ga0209536_100824036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1149 | Open in IMG/M |
| 3300029930|Ga0119944_1000051 | All Organisms → Viruses | 17256 | Open in IMG/M |
| 3300029930|Ga0119944_1000202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10453 | Open in IMG/M |
| 3300029930|Ga0119944_1000244 | Not Available | 9587 | Open in IMG/M |
| 3300029930|Ga0119944_1000507 | All Organisms → Viruses | 6942 | Open in IMG/M |
| 3300029930|Ga0119944_1002928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2901 | Open in IMG/M |
| 3300029930|Ga0119944_1007365 | Not Available | 1723 | Open in IMG/M |
| 3300029930|Ga0119944_1025450 | Not Available | 784 | Open in IMG/M |
| 3300031539|Ga0307380_10645955 | Not Available | 902 | Open in IMG/M |
| 3300031539|Ga0307380_11428830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 520 | Open in IMG/M |
| 3300031565|Ga0307379_11200833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 629 | Open in IMG/M |
| 3300031758|Ga0315907_10028691 | Not Available | 5050 | Open in IMG/M |
| 3300031758|Ga0315907_10175239 | Not Available | 1808 | Open in IMG/M |
| 3300031758|Ga0315907_10291522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1342 | Open in IMG/M |
| 3300031857|Ga0315909_10039330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 4490 | Open in IMG/M |
| 3300031857|Ga0315909_10290712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 | 1228 | Open in IMG/M |
| 3300031857|Ga0315909_10292879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1222 | Open in IMG/M |
| 3300031857|Ga0315909_10452265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 902 | Open in IMG/M |
| 3300031951|Ga0315904_10611333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 935 | Open in IMG/M |
| 3300032093|Ga0315902_10567259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 964 | Open in IMG/M |
| 3300032116|Ga0315903_11024331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 575 | Open in IMG/M |
| 3300033416|Ga0316622_101011109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 970 | Open in IMG/M |
| 3300033482|Ga0316627_100090553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2055 | Open in IMG/M |
| 3300033557|Ga0316617_102709928 | Not Available | 516 | Open in IMG/M |
| 3300033816|Ga0334980_0070984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1461 | Open in IMG/M |
| 3300033979|Ga0334978_0049173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 2188 | Open in IMG/M |
| 3300033979|Ga0334978_0296322 | Not Available | 775 | Open in IMG/M |
| 3300033981|Ga0334982_0052448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2249 | Open in IMG/M |
| 3300033981|Ga0334982_0336032 | Not Available | 701 | Open in IMG/M |
| 3300033994|Ga0334996_0001512 | Not Available | 15669 | Open in IMG/M |
| 3300033996|Ga0334979_0521241 | Not Available | 641 | Open in IMG/M |
| 3300034012|Ga0334986_0002420 | Not Available | 15244 | Open in IMG/M |
| 3300034012|Ga0334986_0006270 | All Organisms → Viruses | 8915 | Open in IMG/M |
| 3300034012|Ga0334986_0114270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1599 | Open in IMG/M |
| 3300034021|Ga0335004_0000327 | Not Available | 38509 | Open in IMG/M |
| 3300034061|Ga0334987_0001427 | Not Available | 22814 | Open in IMG/M |
| 3300034062|Ga0334995_0309933 | Not Available | 1030 | Open in IMG/M |
| 3300034062|Ga0334995_0531244 | Not Available | 700 | Open in IMG/M |
| 3300034072|Ga0310127_099264 | Not Available | 1259 | Open in IMG/M |
| 3300034072|Ga0310127_105421 | All Organisms → Viruses | 1203 | Open in IMG/M |
| 3300034073|Ga0310130_0001976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10158 | Open in IMG/M |
| 3300034073|Ga0310130_0026889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 | 1794 | Open in IMG/M |
| 3300034092|Ga0335010_0582873 | Not Available | 571 | Open in IMG/M |
| 3300034101|Ga0335027_0024275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 5114 | Open in IMG/M |
| 3300034102|Ga0335029_0596415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 620 | Open in IMG/M |
| 3300034104|Ga0335031_0000181 | Not Available | 52994 | Open in IMG/M |
| 3300034106|Ga0335036_0002478 | Not Available | 16076 | Open in IMG/M |
| 3300034106|Ga0335036_0335657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 992 | Open in IMG/M |
| 3300034106|Ga0335036_0835248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 529 | Open in IMG/M |
| 3300034118|Ga0335053_0250070 | Not Available | 1137 | Open in IMG/M |
| 3300034120|Ga0335056_0000103 | Not Available | 54283 | Open in IMG/M |
| 3300034283|Ga0335007_0000292 | Not Available | 37343 | Open in IMG/M |
| 3300034355|Ga0335039_0396103 | Not Available | 710 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 31.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.82% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 9.39% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.58% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.76% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.73% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 2.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.52% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.21% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.21% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.91% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.91% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.91% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.91% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.61% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.61% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.61% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.61% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.61% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.30% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.30% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.30% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.30% |
| Bioluminescent Bay | Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay | 0.30% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.30% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000401 | Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B Liquid | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
| 3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
| 3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300005992 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_14-Oct-14 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020494 | Freshwater microbial communities from Lake Mendota, WI - 25SEP2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020518 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021323 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300026459 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
| 3300027486 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BB_Man_B_Liq_inBBDRAFT_10001487 | 3300000401 | Bioluminescent Bay | MIDRINNLACLVIAAAVFAMIGIESGAHHQPTHSGTQQVVRK* |
| JGI12421J11937_100169456 | 3300000756 | Freshwater And Sediment | VINRINNAICFLVVAAVFAMIGLEAGNQPGMTHSGTQLEVRR* |
| RCM33_10160592 | 3300001838 | Marine Plankton | MIDRINNAICLLIVAAXXXXXXXEAGNQPGTTHSGNQAYVEVSK* |
| RCM41_10570481 | 3300001847 | Marine Plankton | RINNAICLLIAAAVFAMIGIEYGNQAGATHSGTQVEVRK* |
| RCM41_10581516 | 3300001847 | Marine Plankton | RINNAICLLVVAAVFAMIGIEYGNQAGATHSGTQAYVEVRK* |
| RCM47_10005359 | 3300001848 | Marine Plankton | MTDRINNAICLLVAAAVFAMIGIEYGNQAGATHSGTQAYVEVRK* |
| B570J40625_1000248239 | 3300002835 | Freshwater | MINRINNAICLLVVAAVFAMIGIETGNQAGATHSGTQSYIEVRK* |
| B570J40625_10003212710 | 3300002835 | Freshwater | MINHINNAICCLIAATVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| B570J40625_1000803702 | 3300002835 | Freshwater | MINRINNAICLVVVAAVVAMIGIEAANQPGMTHSGTQLEIRR* |
| B570J40625_1007524113 | 3300002835 | Freshwater | MINRINNAICLLIAAAVFAMIGIESGAHHQPTHSGTQQVVRHD* |
| B570J40625_1012131771 | 3300002835 | Freshwater | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGNQAYVEVRK* |
| B570J40625_1013445612 | 3300002835 | Freshwater | MINRINNAICLLVVTAVFAMIGIEAGSQSSATHSGNQAYVEVRK* |
| JGI25921J50272_100511794 | 3300003430 | Freshwater Lake | MINRINNTICFLIAAAVFAMIGLDASNQPGMTHSGTQLEVRK* |
| Ga0007787_100130309 | 3300004240 | Freshwater Lake | MINHINNAICCLIAAAVFAMIGIEGAAHHGSTHSGTQVEVRK* |
| Ga0068877_103953292 | 3300005525 | Freshwater Lake | MINRINNVICLLVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK* |
| Ga0068876_100038669 | 3300005527 | Freshwater Lake | MNAINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0078894_100609813 | 3300005662 | Freshwater Lake | MINHINNAICCLIAASVFAMIGIESGAHHQPTHSGTQQVVRHD* |
| Ga0076948_10190981 | 3300005739 | Lake Water | ARIMINRLNNAICFLIVAAVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0076948_110495314 | 3300005739 | Lake Water | MINRINNAICFLIVVAVFAMIGIEAGNQPGMTHSGTQLEVRK* |
| Ga0078117_100770911 | 3300005758 | Lake Water | MINRINNAICLLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0079957_102227313 | 3300005805 | Lake | MINRINNTICFLICAAVFAMIGLEAGNQPGMTHSGTQQVVEVRK* |
| Ga0079957_11115914 | 3300005805 | Lake | MIDRINNAICLLIAASVFAMIGVEGGAHHQPTHSGTQQMARHD* |
| Ga0079957_12736052 | 3300005805 | Lake | MNRINNAICLLVAAAVFAMIGVESGAHHSPTHSGTQQVVRHD* |
| Ga0073913_100038415 | 3300005940 | Sand | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYVEVRK* |
| Ga0073924_10670332 | 3300005992 | Sand | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK* |
| Ga0075478_1000062723 | 3300006026 | Aqueous | MIDRINNAICLLIAAAAFAAIGIEAGAHHQFTHSGTQEYVRY* |
| Ga0075478_100453496 | 3300006026 | Aqueous | MNRINNAICFLIVAAVFAMIGLEAGNHTSATHSGTQQVVLK* |
| Ga0075478_101648323 | 3300006026 | Aqueous | MINRINNAICLLIAAAAFAAIGIEAGAHHQSTHSGTQ |
| Ga0075470_1000049910 | 3300006030 | Aqueous | MINHINNAICCLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0075461_102335813 | 3300006637 | Aqueous | IMINRINNAICLLIAAAVFAMIGLDAGNQPGMTHSGTQQLVRHD* |
| Ga0070749_1000337612 | 3300006802 | Aqueous | MINRINNAICLLIAAAVFAMIGLDAGNQPGMTHSGTQQLVRHD* |
| Ga0070749_100069028 | 3300006802 | Aqueous | MNRLNNAICLLIVAAVFAMIGIESGNQSGTTHSGTQQLVEVRK* |
| Ga0070749_100366865 | 3300006802 | Aqueous | MIDRINNAICLLVAAAVFAMIGIDATAHHGTTHTGTQQVVRHD* |
| Ga0070749_100568815 | 3300006802 | Aqueous | MINRINNAICFLIVAAVFAMIGIESGNQAGATHSGTQQVVRHD* |
| Ga0070749_100639176 | 3300006802 | Aqueous | MINAINNAICCLIAASVFAMIGIEGAAHHGSTHSGTQVEVRR* |
| Ga0070749_101237662 | 3300006802 | Aqueous | MLNRINNAIYFLVVAAVFAMIGIESGAHHKPTHSGTQQVVRK* |
| Ga0070749_102678592 | 3300006802 | Aqueous | MNRINNAICLLVAATVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0070749_103220483 | 3300006802 | Aqueous | MVNRINNAICLLIAAAVFAMIGVESGAHHKPTHSGTQQVVRHD* |
| Ga0070749_103296881 | 3300006802 | Aqueous | RKDHTMIDRINNAICLLVAAAVFAMIGIDATAHHGTTHSGTQQVVRHD* |
| Ga0070749_103765592 | 3300006802 | Aqueous | VNRINNAICFLIVAAVFAMIGIESGAHQGYTHSGTQLVVRHD* |
| Ga0070749_107194102 | 3300006802 | Aqueous | MINRINNAICLLIVAAVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0070754_100332543 | 3300006810 | Aqueous | MINRINNAICLLIAAAAFAAIGIEAGAHHQSTHSGTQEYVRY* |
| Ga0070754_101138201 | 3300006810 | Aqueous | MLNHINNAICLLIAAAVFAMIGVESGAHHNPTHSGTQQVVRK* |
| Ga0070754_102519612 | 3300006810 | Aqueous | MLNHINNAICLLTAAAVFAMIGIESGAHHKPTHSGTQQVVRK* |
| Ga0070754_104373843 | 3300006810 | Aqueous | MLNKINNAICFLIAAAAFAAIGLDWSAHHGSTHSGSQEVVRHD* |
| Ga0070754_105326661 | 3300006810 | Aqueous | INNAICFLIVAAVFAMIGLEAGNHTSATHSGTQQVVLK* |
| Ga0075475_102916372 | 3300006874 | Aqueous | MIDRINNAICLLVAAAVFAMIGIDATAHHGTTHSGTQQVVRK* |
| Ga0070750_101151364 | 3300006916 | Aqueous | MIDRINNTICFLVAAAAFAMIGLEAGNHTSATHSGTQHVVEVRK* |
| Ga0070746_100540585 | 3300006919 | Aqueous | MNTLNNAICLLFAAAAFAMIGIEAGNQASVTHSGTQEVVRHD* |
| Ga0070746_101628204 | 3300006919 | Aqueous | MNRINNAIAFLIVAAVFAMIGIESGAHHAPTHSGTQQVVRHD* |
| Ga0103959_11245152 | 3300007214 | Freshwater Lake | MINRLNNAICFLIVAAVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0070752_13152021 | 3300007345 | Aqueous | MLNRINNAICFLVVAAVFAMIGIESGAHHKPTHSGTQQVVRK* |
| Ga0099851_10160756 | 3300007538 | Aqueous | MNRINNAICFLIVAAVFAMIGIESGNQAGAIHSGTQQVVRHD* |
| Ga0099851_10770224 | 3300007538 | Aqueous | AMLNRINNAICFLVVAAVFAMIGIESGAHHKPTHSGTQQVVRHD* |
| Ga0099851_11074942 | 3300007538 | Aqueous | MLNRINNAICLLIAAAVFAMIGVESGAHHKPTHSGTQQVVRK* |
| Ga0099851_11207653 | 3300007538 | Aqueous | MNRINNAICFLIVAAVFAMIGIESGAHHAPTHSGTQQVVRHD* |
| Ga0099851_11290974 | 3300007538 | Aqueous | MINRINNAICLLVVTAVFAMIGIEAGNQAGATHSGTQSYIEVRK* |
| Ga0099851_11582412 | 3300007538 | Aqueous | MNRINNAICFVIVAAVFAMIGIESAAHHAPTHSGTQQVVRK* |
| Ga0099851_12308652 | 3300007538 | Aqueous | MNAINNAICFVIVAAVFAMIGIEAVNHTSATHSGTQPVVEVRK* |
| Ga0099851_12403682 | 3300007538 | Aqueous | MLNRINNAICFLVAAAAFAMIGLEAGNHTSATHSGTQQVVEVRK* |
| Ga0099851_13490672 | 3300007538 | Aqueous | MINRINNAICFLIVAAVFAMIGIESAAHHAPTHSGTQQVVRHD* |
| Ga0099849_10658493 | 3300007539 | Aqueous | MLNHINNAICLLIAAAVFAMIGIESGAHHKPTHSGTQQVVRHD* |
| Ga0099848_10106188 | 3300007541 | Aqueous | MNRINNAICLLVAATVFAMIGIEAGNQASVTHSGTQEVIRHD* |
| Ga0099848_10465964 | 3300007541 | Aqueous | MINRINNAICCLIVAAVFAMIGIESGNQAGATHSGTQSYVEVRHD* |
| Ga0099848_10515522 | 3300007541 | Aqueous | MINRINNAICILVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK* |
| Ga0099848_10562696 | 3300007541 | Aqueous | MINHISNICAAIIAAWAFAAIGIEAGAHHQPTHSGTQQ |
| Ga0099848_10666855 | 3300007541 | Aqueous | MINHINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0099848_10779491 | 3300007541 | Aqueous | MLNHINNAICLLIAAAVFAMIGVESGAHHKPTHSGTQQVV |
| Ga0099848_11004733 | 3300007541 | Aqueous | MNRINNAICFVIVAAVFAMIGIEAGNHTSATHSGTQHVVEVRK* |
| Ga0099848_11059621 | 3300007541 | Aqueous | SHTMIDRINNAICFLVAAAAFAMIGLEAGNHTSATHSGTQHVVEVRK* |
| Ga0099848_12030652 | 3300007541 | Aqueous | MINRINNAICLLIVAAVFAMIGIESGTQPGMTHSGTQQVVRHD* |
| Ga0099848_12144441 | 3300007541 | Aqueous | LRSSVPSTYLITAMINRINNAICLLVVTAVFAMIGIEAGNQAGATHSGTQSYIEVRK* |
| Ga0099848_12204732 | 3300007541 | Aqueous | MLNHINNAICLLIAAAVFAMIGIESGAHHKPTHSGTQQVVRK* |
| Ga0099848_12757672 | 3300007541 | Aqueous | MINRINNAICFLVAAAAFAIIGLEAGNHTSATHSGTQQVVEVRHD* |
| Ga0099846_10615105 | 3300007542 | Aqueous | MNTLNNAICLLFAAAAFAMIGIEAGNQASVTHSGTQE |
| Ga0099846_10902151 | 3300007542 | Aqueous | MINRINNAICFLIVAALFAMIGIESGNQAGAIHSGTQQVVRHD* |
| Ga0099846_11008752 | 3300007542 | Aqueous | MINRINNAICILVVAAVFAMIGIEAGNQAGATHSGTQSYIKVRK* |
| Ga0099846_11931532 | 3300007542 | Aqueous | MLNRINNAICFLVVAAVFAMIGIESGAHHKPTHSGTQQVVRHD* |
| Ga0099846_12082874 | 3300007542 | Aqueous | SKIMNRINNAICLLFATAAFAMIGLEAAGHHGSTHSGTQELRR* |
| Ga0102865_10038211 | 3300007639 | Estuarine | CLLVVAAVFAMIGIEAGNQAGATHSGNQAYVEVRK* |
| Ga0070751_100404812 | 3300007640 | Aqueous | MNRINNAICFLIVAAVFAKIGLEAGNHTSATHSGTQQVVLK* |
| Ga0104988_1054014 | 3300007735 | Freshwater | MNRINDFLCFMVVAAVFAMIGIEAGNQPGMTHSGTQLEVRKQ* |
| Ga0099850_10743156 | 3300007960 | Aqueous | MNRINNAICFLIVAAVFAMIGIESGAHQGYTHSGTQQVVRHD* |
| Ga0099850_10949142 | 3300007960 | Aqueous | MINHISNICAAIIAAWAFAAIGIEAGAHHQPTHSGTQQVVRK* |
| Ga0099850_13752373 | 3300007960 | Aqueous | HPTHGAMADRITNILCTVIVAAVFAMIGIESSAHHKPTHSGTQEYVRH* |
| Ga0099850_14047411 | 3300007960 | Aqueous | NAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0105747_13318171 | 3300007974 | Estuary Water | MINRINNVICLLVVAAVFAMIGIETGNQAGATHSGNQAYVEVRK* |
| Ga0114363_100270914 | 3300008266 | Freshwater, Plankton | MINQINNAICFLIVAAVFAMIGIEAGNQPGMTHSGTQLEVRK* |
| Ga0114363_100689917 | 3300008266 | Freshwater, Plankton | MNRINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRK* |
| Ga0114364_100019515 | 3300008267 | Freshwater, Plankton | MMNRINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRK* |
| Ga0114876_10776272 | 3300008448 | Freshwater Lake | MINRINNAICFLVVAAVFAMIGIEAGNQAGATHSGTQSFVEVRK* |
| Ga0105103_104839941 | 3300009085 | Freshwater Sediment | NAICCLIAASVFAMIGIESGAHHQPTHSGTQQVVRHD* |
| Ga0105097_101129492 | 3300009169 | Freshwater Sediment | MINHINNAICCLIAASVFAMIGIESGAHHSSTHSGTQQVVRHD* |
| Ga0103856_100901783 | 3300009233 | River Water | MINRLNNALCLLVVAAVFAMIGLDAGNQRGMTHSGTQPYVQVVR* |
| Ga0103858_101544743 | 3300009239 | River Water | MINRLNNALCLLVVAAVFAMIGLDAGNQRGMTHSGTQPYA* |
| Ga0127390_10045599 | 3300009474 | Meromictic Pond | MNRINNAICFLVAAAAFAMIGLDAGNHTSATHSGTQQVVEVRK* |
| Ga0136656_12906031 | 3300010318 | Freshwater To Marine Saline Gradient | MLNRINNALCFLVVAVVFAMIGIESGAHHKPTHSGTQQV |
| Ga0129333_1000057826 | 3300010354 | Freshwater To Marine Saline Gradient | MINHVNNAICCLIVATVFAMIGIEAGNQPVVTHSGTQHYYRP* |
| Ga0129333_1000269827 | 3300010354 | Freshwater To Marine Saline Gradient | MINRINNAICLLVVTAVFAMIGLEYGNQAGATHTGTQSYVEVRK* |
| Ga0129333_1000380018 | 3300010354 | Freshwater To Marine Saline Gradient | MINHINNAICCLIAASVFAMIGIESGAHHAPTHSGTQQVVRHD* |
| Ga0129333_100060899 | 3300010354 | Freshwater To Marine Saline Gradient | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQPLVEVRK* |
| Ga0129333_100152516 | 3300010354 | Freshwater To Marine Saline Gradient | MINRINNAICCLIVAAVFAMIGIESGTHAGATHSGTQQLIRK* |
| Ga0129333_100930396 | 3300010354 | Freshwater To Marine Saline Gradient | MINRLNNAICLLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0129333_1009927510 | 3300010354 | Freshwater To Marine Saline Gradient | MINRINNAICLLVVTAVFAMIGIEAGNQAGATHSGNQAYVEVRK* |
| Ga0129333_101210754 | 3300010354 | Freshwater To Marine Saline Gradient | MTNRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYVEVRK* |
| Ga0129333_101421032 | 3300010354 | Freshwater To Marine Saline Gradient | MINRINNAICLLIVAAVFAMIGIESGAHHGTSHSGTQQVVRHD* |
| Ga0129333_101473589 | 3300010354 | Freshwater To Marine Saline Gradient | MINHINNAICCLIAASVFAMIGVESGAHHGPTHSGTQQVVRHD* |
| Ga0129333_101911655 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKTMNRINNAICLLFATAAFAMIGLEAAGHHGSTHSGTQELRR* |
| Ga0129333_102260086 | 3300010354 | Freshwater To Marine Saline Gradient | MITRINNAICCLIVAAVFAMIGIESGNHAGATHSGTQSYIEVRK* |
| Ga0129333_102362726 | 3300010354 | Freshwater To Marine Saline Gradient | MNRINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0129333_104152734 | 3300010354 | Freshwater To Marine Saline Gradient | MLNRINNAICLLIAAAVFAMIGVESGAHHKPTHSGTQQVVRHD* |
| Ga0129333_107484981 | 3300010354 | Freshwater To Marine Saline Gradient | SDPSTYHFNPMINRINNAICLLVVAAVFAMIGIETGNQAGATHSGTQSYIEVRK* |
| Ga0129333_107517922 | 3300010354 | Freshwater To Marine Saline Gradient | MHGHPVTTMINRINNAICLLVVAAVFAMIGIEAGNQPGMTHSGTQQEVRK* |
| Ga0129333_108073563 | 3300010354 | Freshwater To Marine Saline Gradient | VIMINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK* |
| Ga0129333_109683802 | 3300010354 | Freshwater To Marine Saline Gradient | MPSKTMNRINNAICLLFATAAFAMIGLEAAGHHGSTHSGTQELRR* |
| Ga0129333_110192512 | 3300010354 | Freshwater To Marine Saline Gradient | MINRINNAICLLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0129333_110992461 | 3300010354 | Freshwater To Marine Saline Gradient | AICCLIAASVFAMIGIESGAHHQPTHSGTQQVVRP* |
| Ga0129333_112458323 | 3300010354 | Freshwater To Marine Saline Gradient | MPTKTMNHINNAICLLFATAAFAMIGLEAAGHHGSTHSGTQEVRQ* |
| Ga0129333_113556002 | 3300010354 | Freshwater To Marine Saline Gradient | MINHINNAICCLIAASVFAMIGVESGAHHSPTHSGTQQVVRHD* |
| Ga0129333_113860933 | 3300010354 | Freshwater To Marine Saline Gradient | MINRINNAICLLVVTAVFAMIGIEAGNQAGATHSG |
| Ga0129333_114647051 | 3300010354 | Freshwater To Marine Saline Gradient | MINRINNAICILVVAAVFAMIGIEAGNQAGATHSGTQSYVEVRK* |
| Ga0129333_116326012 | 3300010354 | Freshwater To Marine Saline Gradient | MINRINNAICILVVTAVFAMIGIEAGNQAGATHSGTQSYIKVRK* |
| Ga0129336_100109691 | 3300010370 | Freshwater To Marine Saline Gradient | LLVVAAVFAMIGLEASGHHGSTHSGAQSYVEVRK* |
| Ga0129336_101471687 | 3300010370 | Freshwater To Marine Saline Gradient | LNAINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0129336_104247982 | 3300010370 | Freshwater To Marine Saline Gradient | MHGHPVTTMITRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYVEVRK* |
| Ga0129336_105281744 | 3300010370 | Freshwater To Marine Saline Gradient | YHFNPMINRINNAICILVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK* |
| Ga0129336_106649091 | 3300010370 | Freshwater To Marine Saline Gradient | YHFNPMINRINNAICILVVAAVFAMIGIEAGNQAGATHSGTQSYIKVRK* |
| Ga0136549_100012118 | 3300010389 | Marine Methane Seep Sediment | MVNRINNAICLLIATAVFAMIGIESGAHHQSTHSGTQQVVRHD* |
| Ga0136549_101157003 | 3300010389 | Marine Methane Seep Sediment | MINRINNAICFLVAAAAFAMIGIESVAHHSPTHSGTQQVVRHD* |
| Ga0136549_101188252 | 3300010389 | Marine Methane Seep Sediment | MNRINNAICFLIVAAVFAMIGIESAAHHAPTHSGTQQVVRHD* |
| Ga0164293_106128962 | 3300013004 | Freshwater | MNVINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD* |
| Ga0163212_10199861 | 3300013087 | Freshwater | MTDRINNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQQVVEVRR* |
| Ga0163212_11703382 | 3300013087 | Freshwater | MPTKTMNRINNAICCLIAAASFAMIGIEASSHHVPTHSGTQEIYR* |
| Ga0163212_12705543 | 3300013087 | Freshwater | MIDKLNNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQQVVEVRK* |
| (restricted) Ga0172367_101516487 | 3300013126 | Freshwater | MTDRINNAICLLVVAAVFAMIGLEAGNQPGMTHSGTQPVVEVRK* |
| (restricted) Ga0172367_103553914 | 3300013126 | Freshwater | MTDRINNAICCIIVAAVFAMIGLEAGNQPGMTYSGTQPVVEVRK* |
| (restricted) Ga0172372_100733688 | 3300013132 | Freshwater | MTDQINNAICCIIVAAVFAMIGLEAGNQPGMTYSGTQPVVEVRK* |
| Ga0177922_100252012 | 3300013372 | Freshwater | MINRINNTICFLVVAAVFAMIGIEAGSQPGMTHSGTQIEIRK* |
| Ga0177922_108374662 | 3300013372 | Freshwater | MINHINNAICCLIAAAVFAMIGIESGAHHQPTHSGTQQVVRHD* |
| (restricted) Ga0172376_104979762 | 3300014720 | Freshwater | MTDRINNAICLLVVAAVFAMIGLEAGNQPGMTYSGTQPVVEVRK* |
| Ga0181363_10223242 | 3300017707 | Freshwater Lake | MINRINNAIWLLVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK |
| Ga0181355_11552903 | 3300017785 | Freshwater Lake | MINRINNAICLLVVTAVFAMIGIEAGNQAGATHSGNQAYVEVRK |
| Ga0181355_12072592 | 3300017785 | Freshwater Lake | MNAINNGICCLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0181359_10200873 | 3300019784 | Freshwater Lake | MINHINNAICCLIAASVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0181359_10324536 | 3300019784 | Freshwater Lake | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQPLVEVRK |
| Ga0181359_10650891 | 3300019784 | Freshwater Lake | PLPRPCGARIMINHINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0194113_101505533 | 3300020074 | Freshwater Lake | MTDRINNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQPVVEVRK |
| Ga0194113_102777684 | 3300020074 | Freshwater Lake | MTDRINNAICCIIVAAVFAMIGLEAGNQPGMTHSGTQQVVEVRK |
| Ga0194113_106277214 | 3300020074 | Freshwater Lake | MTDRINNAICCIIVAAVFAMIGLEAGNQPGMTYSGTQPVMEVRK |
| Ga0194111_104749601 | 3300020083 | Freshwater Lake | MTDRINNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQ |
| Ga0194110_100758134 | 3300020084 | Freshwater Lake | MPTKTMNCINNAICCLIAATSFAMIGIEASSHHVPTHSGTQEIHR |
| Ga0194112_103128676 | 3300020109 | Freshwater Lake | SPPAMTDRINNAICCIIVAAVFAMIGLEAGNQPGMTHSGTQQVVEVRK |
| Ga0194112_103939171 | 3300020109 | Freshwater Lake | AICCIIVAAVFAMIGLEAGNQPGMTHSGTQQVVEVRK |
| Ga0211729_106915863 | 3300020172 | Freshwater | MINHINNGICCLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0211729_1134813711 | 3300020172 | Freshwater | MINRINNAICFLVVAAVFAMIGIEAGNQPGMTHSGTQQLVEVRK |
| Ga0194134_100052228 | 3300020179 | Freshwater Lake | MSNNVMNQINNAICCMIMAATFAMIGIEASIHSIPTHSGTQEIHK |
| Ga0194134_100327105 | 3300020179 | Freshwater Lake | MTDRINNAICLLIVAAVFAMIGLEAGNQSGMTHSGTQQVVEVRK |
| Ga0194134_102025164 | 3300020179 | Freshwater Lake | MTDRINNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQQVVEVRK |
| Ga0194115_1000127635 | 3300020183 | Freshwater Lake | MTDRINNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQQMVEVRK |
| Ga0194115_1000466713 | 3300020183 | Freshwater Lake | MNRINNAICLLIAAATFTMIGVEACQFHGSTHSGTQEVQR |
| Ga0194115_1002148415 | 3300020183 | Freshwater Lake | MTDRINNAICLLVVAAVFAMIGLEAGNQPGMTHSGTQPVVEVRK |
| Ga0194115_101952463 | 3300020183 | Freshwater Lake | MTDRINNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQQVVEVKK |
| Ga0194115_102747052 | 3300020183 | Freshwater Lake | MPTKTMNRINNAICCLIVGATFAMIGIEASNHHVLTHSGTQGVHR |
| Ga0194118_102411703 | 3300020190 | Freshwater Lake | MPTKTMNRINNAICCLIAAASFAMIGIEASSHHVSTHSGTQEIHR |
| Ga0194118_103107694 | 3300020190 | Freshwater Lake | KSPPAMTDRINNAICCIIVAAVFAMIGLEAGNQPGMTHSGTQPVVEVRK |
| Ga0194118_105866292 | 3300020190 | Freshwater Lake | MTDRINNAICLLVVAAVFAMIGLEAGNQPGMTHSGTQQVVEVRK |
| Ga0194124_100984528 | 3300020196 | Freshwater Lake | NQLGKSPPAMTDRINNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQQMVEVRK |
| Ga0194116_104979583 | 3300020204 | Freshwater Lake | MTDRINNAICCIIVAAVFAMIGLEAGNQPGMTYSGTQPVVEVRK |
| Ga0194119_103744521 | 3300020220 | Freshwater Lake | RINNAICLLIAAATFTMIGVEACQFHGSTHSGTQEVQR |
| Ga0208326_10000118 | 3300020494 | Freshwater | MINHINNAICCLIAATVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0208050_10004655 | 3300020498 | Freshwater | MINRINNAICLLVVAAVFAMIGIETGNQAGATHSGTQSYIEVRK |
| Ga0208050_10007676 | 3300020498 | Freshwater | MINRINNAICLVVVAAVVAMIGIEAANQPGMTHSGTQLEIRR |
| Ga0208721_100107416 | 3300020518 | Freshwater | MINRINNAICFLVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK |
| Ga0208721_10034627 | 3300020518 | Freshwater | MINRINNAICLLVVTAVFAMIGIEAGSQSSATHSGNQAYVEVRK |
| Ga0208222_10832512 | 3300020566 | Freshwater | MINRINNAICLLIAAAVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0194122_101885331 | 3300021092 | Freshwater Lake | MNRINNAICLLIAAATFTMIGVEACQFHGSTHSGTQEV |
| Ga0210295_10092824 | 3300021323 | Estuarine | MINHINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0194130_100358427 | 3300021376 | Freshwater Lake | MPTKTMNCINNAICCLIAATSFAVIGIEASSHHVPTHSGTQEIHR |
| Ga0222715_101439972 | 3300021960 | Estuarine Water | MINRINNAICVLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0222714_1000258015 | 3300021961 | Estuarine Water | MLNKINNAICLLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0222714_100045732 | 3300021961 | Estuarine Water | MINHINNAICCLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0222714_1002504610 | 3300021961 | Estuarine Water | MINRINNAICLLIAAAVFAMIGIESGAHHAPTHSGTQQVVRHD |
| Ga0222714_100539508 | 3300021961 | Estuarine Water | MINRINNAICLLIAAAVFAMIGIESGAHYSPTHSGTQQVVRK |
| Ga0222714_100833119 | 3300021961 | Estuarine Water | MIDRINNTICLLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0222714_100837337 | 3300021961 | Estuarine Water | MTNRINNSICLLVVAAVFAMIGIEAGDQAGATHSGTQSYIEVRK |
| Ga0222714_101377475 | 3300021961 | Estuarine Water | MINRINNAICFLIVAAVFAMIGIEAGNQPGMTHSGTQLEVRK |
| Ga0222714_102832433 | 3300021961 | Estuarine Water | MMNRINNAICLLITAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0222714_104215482 | 3300021961 | Estuarine Water | MLNRINNAICVLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0222713_1000422422 | 3300021962 | Estuarine Water | MINRINNAICLLIAAAVFAMIGIESGAHHNPTHSGTQQVVRHD |
| Ga0222713_100583361 | 3300021962 | Estuarine Water | INNTICLLVVAAVFAMIGIEAGNQAGATHSGNQAYVEVRK |
| Ga0222713_101392342 | 3300021962 | Estuarine Water | MIDRINNAICLVIVAAVFAMIGLEAGNQPGMTHSGTQAVEVRQ |
| Ga0222713_103062374 | 3300021962 | Estuarine Water | RRPSQFVPLSRPSGARIMINRINNAICLLIAAAVFAMIGIESGAHHAPTHSGTQQVVRHD |
| Ga0222713_103285651 | 3300021962 | Estuarine Water | MINRINNTICLLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0222713_107832903 | 3300021962 | Estuarine Water | CLLVVAAVFAMIGIEAGNQSSATHSGNQAYVEVRK |
| Ga0222712_1000338915 | 3300021963 | Estuarine Water | MINRINNAICLLITAAVFAMIGIESGAHHSTTHSGTQQVVRHD |
| Ga0222712_100059296 | 3300021963 | Estuarine Water | MINRINNAICLLIVAAVFAMIGIESGAHHSFTHSGTQQVVRHD |
| Ga0222712_100977294 | 3300021963 | Estuarine Water | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK |
| Ga0212029_10656693 | 3300022063 | Aqueous | MNRINNAICFLIVAAVFAMIGIESGNQAGATHSGTQQVVRHD |
| Ga0212026_10670472 | 3300022069 | Aqueous | MNRINNAICFLIVAAVFAMIGLEAGNHTSATHSGTQQVVLK |
| Ga0212031_10044571 | 3300022176 | Aqueous | GAMLNRINNAICLLIAAAVFAMIGVESGAHHKPTHSGTQQVVRK |
| Ga0212031_10264224 | 3300022176 | Aqueous | MLNHINNAICLLIAAAVFAMIGVESGAHHKPTHSGTQQVVRK |
| Ga0212031_10638882 | 3300022176 | Aqueous | MINRINNAICILVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK |
| Ga0212031_10755873 | 3300022176 | Aqueous | MNRINNAICFLIVAAVFAMIGIESGAHHAPTHSGTQQVVRHD |
| Ga0181353_10426693 | 3300022179 | Freshwater Lake | MINHINNAICCLITASVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0181353_11139052 | 3300022179 | Freshwater Lake | MINHINNAICCLIAAAVFAMIGIEGAAHHGSTHSGTQVEVRK |
| Ga0181353_11218222 | 3300022179 | Freshwater Lake | MINRINNAICLLIAAAVFAMIGIESGAHHQPTHSGTQQMVRHD |
| Ga0196905_100030319 | 3300022198 | Aqueous | MNRINNAICFLIVAAVFAMIGIESGNQAGAIHSGTQQVVRHD |
| Ga0196905_100075221 | 3300022198 | Aqueous | MLNRINNAICLLIAAAVFAMIGVESGAHHKPTHSGTQQVVRK |
| Ga0196905_10023148 | 3300022198 | Aqueous | MNRINNAICLLVAATVFAMIGIEAGNQASVTHSGTQEVIRHD |
| Ga0196905_10038581 | 3300022198 | Aqueous | LMNTLNNAICLLFAAAAFAMIGIEAGNQASVTHSGTQEVVRHD |
| Ga0196905_10086568 | 3300022198 | Aqueous | MNRINNAICFVIVAAVFAMIGIEAGNHTSATHSGTQHVVEVRK |
| Ga0196905_10304302 | 3300022198 | Aqueous | MINHISNICAAIIAAWAFAAIGIEAGAHHQPTHSGTQQVVRK |
| Ga0196905_10395753 | 3300022198 | Aqueous | MIDRINNAICLLIAASVFAMIGVEGGAHHQPTHSGTQQMARHD |
| Ga0196905_10623461 | 3300022198 | Aqueous | NAICFLIVAAVFAMIGIESAAHHAPTHSGTQLVVRHD |
| Ga0196905_10678102 | 3300022198 | Aqueous | MINRINNAICFLVAAAAFAMIGLEAGNHTSVTHSGTQHVVEVRK |
| Ga0196905_11530634 | 3300022198 | Aqueous | NHINNAICLLFATAAFAMIGLEAAGHHGSTHSGTQEVRQ |
| Ga0196905_11689862 | 3300022198 | Aqueous | MLNHINNAICLLIAAAVFAMIGIESGAHHKPTHSGTQQVVRK |
| Ga0196901_100362220 | 3300022200 | Aqueous | MNTLNNAICLLFAAAAFAMIGIEAGNQASVTHSGTQEVVRHD |
| Ga0196901_12441563 | 3300022200 | Aqueous | IMNRINNAICFVIVAAVFAMIGIESAAHHAPTHSGTQQVVRK |
| Ga0196901_12457873 | 3300022200 | Aqueous | SDPSTYHFNPMINRINNAICLLVVAAVFAMIGIETGNQAGATHSGTQSYIEVRK |
| Ga0196901_12832031 | 3300022200 | Aqueous | MIDRINNAICFLVAAAAFAMIGLEAGNHTSVTHSGTQHVVEVRK |
| Ga0181351_10536543 | 3300022407 | Freshwater Lake | MIDRINNAICLLIVAAVFAMIGIEAGNQAGATHSGNQAYVEVRK |
| Ga0181351_10678694 | 3300022407 | Freshwater Lake | MNVINNAICCLIAASVFAMIGIESGAHHSPTHSGAQQVVRHD |
| Ga0228702_10426923 | 3300022748 | Freshwater | MERINNAICLLVAAAVFAMIGIEAGNQPGMTHSGTQQEVRK |
| Ga0214917_100838466 | 3300022752 | Freshwater | MERINNAICLLVVTAVFAMIGIEAGNQPGMTHSGTQQLVEVRR |
| Ga0214917_102807333 | 3300022752 | Freshwater | MTNRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYVEVRK |
| Ga0214917_104546922 | 3300022752 | Freshwater | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYVEVRK |
| Ga0255147_100006853 | 3300024289 | Freshwater | MINRINNAICLLIAAAVFAMIGIESGAHHSSTHSGTQQVVRK |
| Ga0255147_10005464 | 3300024289 | Freshwater | MMNRINNAICLLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0255147_100149111 | 3300024289 | Freshwater | MNRLNNAICLLIVAAVFAMIGIESGNQSGATHSGNQQLVEVRK |
| Ga0255147_10020816 | 3300024289 | Freshwater | MINRLNNAICLLIVAAVFAMIGIESGNQSGTTHSGTQQLVEVRK |
| Ga0255147_10601633 | 3300024289 | Freshwater | MINHINNAICCLIVAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0244775_108096954 | 3300024346 | Estuarine | NNAIAFLIVAAVFAMIGIESGNQAGATHSGTQQVVRK |
| Ga0255181_10702533 | 3300024502 | Freshwater | SGACLMINRINNAICLLIAAAVFAMIGIESGAHHSSTHSGTQQVVRK |
| Ga0255176_10190801 | 3300024507 | Freshwater | MINRINNAICLLIAAAVFAMIGIESGAHHSSTHSGTQQ |
| Ga0255273_10991493 | 3300024565 | Freshwater | MINRLNNAICLLIVAAVFSMIGIESGNQSGTTHSGTQQLVEVRK |
| Ga0208048_10361084 | 3300025283 | Freshwater | MPTKTMNRINNAICCLIAAASFAMIGIEASSHHVPTHSGTQEIYR |
| Ga0208048_10714043 | 3300025283 | Freshwater | MTDQINNAICCIIVAAVFAMIGLEAGNQPGMTHSGTQPVVEVRK |
| Ga0208149_100205310 | 3300025610 | Aqueous | MIDRINNAICLLIAAAAFAAIGIEAGAHHQFTHSGTQEYVRY |
| Ga0208149_10451221 | 3300025610 | Aqueous | AICFLIVAAVFAMIGLEAGNHTSATHSGTQQVVLK |
| Ga0208161_10292797 | 3300025646 | Aqueous | MINRINNAICILVVAAVFAMIGIEAGNQAGATHSGTQSYVEVRK |
| Ga0208161_10526391 | 3300025646 | Aqueous | MLNHINNAICLLIAAAVFAMIGVESGAHHKPTHSGTQQ |
| Ga0208161_10875521 | 3300025646 | Aqueous | MIDRINNAICFLVAAAAFAMIGLEAGNHTSATHSGTQQVVEVRK |
| Ga0208161_11400963 | 3300025646 | Aqueous | MINRINNAICLLIVAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0208161_11665692 | 3300025646 | Aqueous | MLNRINNAICFLVVAAVFAMIGIESGAHHKPTHSGTQQVVRK |
| Ga0208160_10310403 | 3300025647 | Aqueous | MLNRINNAICFLVVAAVFAMIGIESGAHHKPTHSGTQQVVRHD |
| Ga0208160_11367851 | 3300025647 | Aqueous | MNRINNAICFVIVAAVFAMIGIEAGNHTSATHSGTQHVVE |
| Ga0208428_100132421 | 3300025653 | Aqueous | MINRINNAICLLIAAAAFAAIGIEAGAHHQSTHSGTQEYVRY |
| Ga0208795_10996173 | 3300025655 | Aqueous | MNRINNAICFVIVAAVFAMIGIESAAHHAPTHSGTQQVVRK |
| Ga0208898_10211305 | 3300025671 | Aqueous | MIDRINNAICLLVAAAVFAMIGIDATAHHGTTHSGTQQVVRK |
| Ga0208162_10326005 | 3300025674 | Aqueous | MLNHINNAICLLIAAAVFAMIGIESGAHHKPTHSGTQQVVRHD |
| Ga0208019_10889515 | 3300025687 | Aqueous | MNRINNAICFLIVAAVFAMIGIESAAHQGYTHSGTQQVVRHD |
| Ga0208019_11584693 | 3300025687 | Aqueous | NAICFVIVAAVFAMIGIESAAHHAPTHSGTQQVVRK |
| Ga0208767_11667084 | 3300025769 | Aqueous | MNRINNAIAFLIVAAVFAMIGIESGAHHAPTHSGTQQVVRHD |
| Ga0208767_11778302 | 3300025769 | Aqueous | MIDRINNTICFLVAAAAFAMIGLEAGNHTSATHSGTQHVVEVRK |
| Ga0208542_11110983 | 3300025818 | Aqueous | VNRINNAICFLIVAAVFAMIGIESGAHQGYTHSGTQLVVRHD |
| Ga0208645_12520201 | 3300025853 | Aqueous | NHINNAICLLIAAAVFAMIGVESGAHHNPTHSGTQQVVRK |
| Ga0208644_100163228 | 3300025889 | Aqueous | MNRINNAICFLIVAAVFAMIGIESGAHQGYTHSGTQQVVRHD |
| Ga0208644_100174916 | 3300025889 | Aqueous | MIDRINNAICLLVAAAVFAMIGIDATAHHGTTHTGTQQVVRHD |
| Ga0208644_10098808 | 3300025889 | Aqueous | MINRINNAICLLIAAAVFAMIGLDAGNQPGMTHSGTQQLVRHD |
| Ga0208644_10260359 | 3300025889 | Aqueous | MINRINNAICFLIVAAVFAMIGIESGNQAGATHSGTQQVVRHD |
| Ga0208644_11143835 | 3300025889 | Aqueous | MNRLNNAICLLIVAAVFAMIGIESGNQSGTTHSGTQQLVEVRK |
| Ga0208644_11717953 | 3300025889 | Aqueous | MVNRINNAICLLIAAAVFAMIGVESGAHHKPTHSGTQQVVRHD |
| Ga0208644_13085722 | 3300025889 | Aqueous | MLNRINNAIYFLVVAAVFAMIGIESGAHHKPTHSGTQQMVRHD |
| Ga0255160_10338074 | 3300026457 | Freshwater | GLSPSLHQAMINHINNAICCLIVAAVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0255170_10656373 | 3300026459 | Freshwater | QPIPLSRPSGACLMINRINNAICLLIAAAVFAMIGIESGAHHSSTHSGTQQVVRK |
| Ga0255156_10278181 | 3300026478 | Freshwater | INNAICCLIVAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0255071_10622173 | 3300027127 | Freshwater | MINRINNAICLLVVAAVFAMIGIEAGSQSSATHSGNQAYVEVRK |
| Ga0255073_10089731 | 3300027135 | Freshwater | MINRINNAICLLVVAAVFAMIGIEAGSQSSATHSGNQAYVE |
| Ga0255073_10436521 | 3300027135 | Freshwater | MINRINNAICLLVVAAVFAMIGIEAGSQSSATHSGNQA |
| Ga0255080_10079961 | 3300027140 | Freshwater | VIMINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK |
| Ga0255154_10105396 | 3300027467 | Freshwater | MINHINNAICCLIVAAVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0255086_100008645 | 3300027486 | Freshwater | MINHINNAICCLIAASVFAMIGIESGAHHAPTHSGTQQVVRHD |
| Ga0255079_100284412 | 3300027601 | Freshwater | MINRINNAICLLVVAAVFAMIGIEAGSQSSATHSGNQAYVEVRQ |
| (restricted) Ga0247836_10387249 | 3300027728 | Freshwater | MINSINNIICFLIAAAVFAMIGLDASTQPGMTYSGTQLEVRK |
| Ga0209107_1000186410 | 3300027797 | Freshwater And Sediment | VINRINNAICFLVVAAVFAMIGLEAGNQPGMTHSGTQLEVRR |
| (restricted) Ga0233416_101730462 | 3300027799 | Sediment | MMNRINNAICLLIVTAVFAMIGLEAGNHPGMTHSGTQQVVRHD |
| Ga0209536_1008240362 | 3300027917 | Marine Sediment | MNRINNAICFLVAAAAFAMIGLEAGNHTSATHSGTQQVVLK |
| Ga0119944_100005125 | 3300029930 | Aquatic | VINRINNAICFLIAAAAFAMIGLEASGHHGMTHSGTQVEVRR |
| Ga0119944_10002022 | 3300029930 | Aquatic | MNRINDFLCFIIVAAVFAMIGIEAGNQPGMTHSGTQLEVRK |
| Ga0119944_100024414 | 3300029930 | Aquatic | MINRINNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQQVVEVRHD |
| Ga0119944_100050720 | 3300029930 | Aquatic | MINRINNTICFLICAAVFAMIGLEAGNQPGMTHSGTQQGVEVRK |
| Ga0119944_100292811 | 3300029930 | Aquatic | MIDRINNAICLVIVAAVFAMIGLEATAHHGATHSGTQSVVEVRR |
| Ga0119944_10073653 | 3300029930 | Aquatic | MNTINNIICGLIAAATFAMIGIEGAAHHGSTHSGTQVEVRQ |
| Ga0119944_10254501 | 3300029930 | Aquatic | MINRINNAICLLIVAAVFAMIGLEAGNQPGMTHSGTQLEVRK |
| Ga0307380_106459551 | 3300031539 | Soil | MLNRLNNAICFLMAAAAFAMIGIESGAHHSPTHSGAQQVVRHD |
| Ga0307380_114288302 | 3300031539 | Soil | MNRINNAICFLVAAAAFAMIGLESGAHHTPTHSGAQQVVRHD |
| Ga0307379_112008333 | 3300031565 | Soil | MLNRLNNAICVLIAAAVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0315907_1002869110 | 3300031758 | Freshwater | MINQINNAICFLIVAAVFAMIGIEAGNQPGMTHSGTQLEVRK |
| Ga0315907_101752395 | 3300031758 | Freshwater | MADRITNILCTVIVAAVFAMIGIESSAHHKPTHSGTQEYVRH |
| Ga0315907_102915221 | 3300031758 | Freshwater | MINHINNAICCLITASVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0315909_1003933016 | 3300031857 | Freshwater | MINLINNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRHD |
| Ga0315909_102907122 | 3300031857 | Freshwater | MINHINNAICCLIAAAVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0315909_102928795 | 3300031857 | Freshwater | INNAICCLIAASVFAMIGIESGAHHQPTHSGTQQMVRHD |
| Ga0315909_104522653 | 3300031857 | Freshwater | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGNQAYVEVRK |
| Ga0315904_106113333 | 3300031951 | Freshwater | MINRINNAICFLVVAAVFAMIGIEAGNQAGATHSGTQPYIEVRK |
| Ga0315902_105672591 | 3300032093 | Freshwater | RPQGARIMINHINNAICCLIAASVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0315903_110243311 | 3300032116 | Freshwater | PSTYHFNPMINRINNAICLLIVAAVFAMIGIETGNQAGATHSGAQSYIEVRK |
| Ga0316622_1010111093 | 3300033416 | Soil | MINRINNAICLLIAATVFAMIGIESGAHHQPTHSGTQQVVWHD |
| Ga0316627_1000905534 | 3300033482 | Soil | MNRINNAICLLIAAAVFAMIGIESGAHHSPTHSGTQPYSRHQ |
| Ga0316617_1027099281 | 3300033557 | Soil | MINHINNAICCLIAAAVFAMIGIESGAHHSTTHSGTQQVVRHD |
| Ga0334980_0070984_476_592 | 3300033816 | Freshwater | MSNTICFLIAAAVFAMIGLDASNQPGMTHSGTQLEVRK |
| Ga0334978_0049173_1020_1148 | 3300033979 | Freshwater | MINRINNAICLVVIAAVVAMIGIEAANQPGMTHSGTQLEIRR |
| Ga0334978_0296322_231_362 | 3300033979 | Freshwater | MNRINNTICFLMATAVFAMIGIESANQSAPTHSGSQQLVEVRK |
| Ga0334982_0052448_1552_1686 | 3300033981 | Freshwater | MINRINNAICILVVAAVFAMIGIEAGNQAGATHSGTQPLVEVRK |
| Ga0334982_0336032_581_700 | 3300033981 | Freshwater | MINHINNAICCLIAAAVFAMIGIESGAHHQPTHSGTQQVV |
| Ga0334996_0001512_14349_14477 | 3300033994 | Freshwater | MNAINNAICCLIAASVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0334979_0521241_8_136 | 3300033996 | Freshwater | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQVEVRK |
| Ga0334986_0002420_8566_8697 | 3300034012 | Freshwater | MINYINNAICCLIAASVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0334986_0006270_2134_2265 | 3300034012 | Freshwater | MINHINNAICLLIAAAVFAMIGIESGAHHQPTHSGTQQVVRHD |
| Ga0334986_0114270_360_488 | 3300034012 | Freshwater | MINRINNAICFLVVAAVFAMIGIEAGSQPGMTHSGTQIEIRK |
| Ga0335004_0000327_9924_10058 | 3300034021 | Freshwater | MINRINNAICLLVVAAVFAMIGLEASGHHGSTHSGNQAYVEVRK |
| Ga0334987_0001427_11375_11506 | 3300034061 | Freshwater | MINHINNAICCLIAASVFAMIGIESGAHHQPTHSGTQQMVRHD |
| Ga0334995_0309933_309_443 | 3300034062 | Freshwater | MINRINNAICLLIVAAVFAMIGIESGNQTSTTYSGTQQLVEVRK |
| Ga0334995_0531244_582_698 | 3300034062 | Freshwater | INNAICLVVVAAVVAMIGIEAANQPGMTHSGTQLEIRR |
| Ga0310127_099264_328_462 | 3300034072 | Fracking Water | MITRINNAICLLVVAAVFAMIGIEAGSQSSATHSGNQAYVEVRK |
| Ga0310127_105421_227_355 | 3300034072 | Fracking Water | MLNRINNAICLLIAAAVFAMIGVDSGAHHKPTHSGTQQVVRK |
| Ga0310130_0001976_752_880 | 3300034073 | Fracking Water | MIDRINNAICCLIVAAVFAMIGVESGAHHSPTHSGTQQMVRK |
| Ga0310130_0026889_905_1081 | 3300034073 | Fracking Water | VSPPGLFSTYPITTMITRINNTICLLVVAAVFAMIGIEAGNQAGATHSGTQPLVEVRK |
| Ga0335010_0582873_153_287 | 3300034092 | Freshwater | MINRINNAICLLIVAAVVAMIGIESGNQTSTTYSGTQQLVEVRK |
| Ga0335027_0024275_463_597 | 3300034101 | Freshwater | MINRINNAICLLMVTAVFAMIGIEAGNHTAPTHSGTQAVSYRHR |
| Ga0335029_0596415_336_464 | 3300034102 | Freshwater | MINRINNAICLLIAAAVFAMIGIESGAHHQPTHSGTQQVVHK |
| Ga0335031_0000181_35602_35730 | 3300034104 | Freshwater | VIDRINNAICLLIAASVFAMIGVEAGNQPTVTHSGTQQEVRR |
| Ga0335036_0002478_9088_9216 | 3300034106 | Freshwater | VINRINNAICFLVVAAVFAMIGLEAGNQFGMTHSGTQLEVRR |
| Ga0335036_0335657_557_691 | 3300034106 | Freshwater | MINRINSAICLLVVAAVFAMIGIEAGNQAGATHSGTQSYIEVRK |
| Ga0335036_0835248_91_225 | 3300034106 | Freshwater | MINRINNAICLLVVAAVFAMIGIEAGNQAGATHSGTQPLVEVRQ |
| Ga0335053_0250070_1_117 | 3300034118 | Freshwater | MITRINNAICLLVVAAVFAMIGIEAGNQASATHSGTQSY |
| Ga0335056_0000103_49177_49305 | 3300034120 | Freshwater | VIDRINNAICLLIAASVFAMIGVEGGAHHSPTHSGTQQVVRK |
| Ga0335007_0000292_23820_23948 | 3300034283 | Freshwater | MINRLNNAICCLIAASVFAMIGIESGAHHSPTHSGTQQVVRK |
| Ga0335039_0396103_3_119 | 3300034355 | Freshwater | MINRINNAICLLVVTAVFAMIGIEAGNQAGATHSGTQSY |
| ⦗Top⦘ |