Basic Information | |
---|---|
Family ID | F008363 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 334 |
Average Sequence Length | 47 residues |
Representative Sequence | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDR |
Number of Associated Samples | 227 |
Number of Associated Scaffolds | 333 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 90.72 % |
% of genes near scaffold ends (potentially truncated) | 20.36 % |
% of genes from short scaffolds (< 2000 bps) | 93.41 % |
Associated GOLD sequencing projects | 211 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (59.880 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland (7.784 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.162 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.713 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 333 Family Scaffolds |
---|---|---|
PF00202 | Aminotran_3 | 14.11 |
PF01593 | Amino_oxidase | 4.20 |
PF00490 | ALAD | 1.50 |
PF10094 | DUF2332 | 0.90 |
PF12681 | Glyoxalase_2 | 0.90 |
PF03401 | TctC | 0.30 |
PF09957 | VapB_antitoxin | 0.30 |
PF00033 | Cytochrome_B | 0.30 |
PF00188 | CAP | 0.30 |
PF13561 | adh_short_C2 | 0.30 |
PF00034 | Cytochrom_C | 0.30 |
PF10722 | YbjN | 0.30 |
PF13439 | Glyco_transf_4 | 0.30 |
PF02602 | HEM4 | 0.30 |
PF00903 | Glyoxalase | 0.30 |
PF00486 | Trans_reg_C | 0.30 |
PF01494 | FAD_binding_3 | 0.30 |
PF02826 | 2-Hacid_dh_C | 0.30 |
PF02668 | TauD | 0.30 |
PF00355 | Rieske | 0.30 |
PF06971 | Put_DNA-bind_N | 0.30 |
PF13358 | DDE_3 | 0.30 |
PF13683 | rve_3 | 0.30 |
PF01872 | RibD_C | 0.30 |
PF12697 | Abhydrolase_6 | 0.30 |
PF00329 | Complex1_30kDa | 0.30 |
PF03900 | Porphobil_deamC | 0.30 |
PF01266 | DAO | 0.30 |
PF13442 | Cytochrome_CBB3 | 0.30 |
PF01047 | MarR | 0.30 |
PF07396 | Porin_O_P | 0.30 |
COG ID | Name | Functional Category | % Frequency in 333 Family Scaffolds |
---|---|---|---|
COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 1.50 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.60 |
COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 0.30 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.30 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.30 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.30 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.30 |
COG3262 | Ni,Fe-hydrogenase III component G | Energy production and conversion [C] | 0.30 |
COG3746 | Phosphate-selective porin | Inorganic ion transport and metabolism [P] | 0.30 |
COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 0.30 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.30 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.30 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.30 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.30 |
COG0852 | NADH:ubiquinone oxidoreductase 27 kD subunit (chain C) | Energy production and conversion [C] | 0.30 |
COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.30 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 59.88 % |
All Organisms | root | All Organisms | 40.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459012|GOYVCMS01DUXBG | Not Available | 522 | Open in IMG/M |
2170459017|G14TP7Y02GPYRO | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 675 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105339949 | Not Available | 582 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105477323 | Not Available | 774 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105481987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300001213|JGIcombinedJ13530_103112919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 585 | Open in IMG/M |
3300001538|A10PFW1_10742360 | Not Available | 1355 | Open in IMG/M |
3300002568|C688J35102_118148087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
3300002568|C688J35102_119505356 | Not Available | 708 | Open in IMG/M |
3300002568|C688J35102_120278818 | Not Available | 964 | Open in IMG/M |
3300002568|C688J35102_120876389 | All Organisms → cellular organisms → Bacteria | 1959 | Open in IMG/M |
3300003321|soilH1_10378355 | Not Available | 1371 | Open in IMG/M |
3300003465|P52013CM_1047532 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300003987|Ga0055471_10174674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
3300003992|Ga0055470_10177701 | Not Available | 571 | Open in IMG/M |
3300004081|Ga0063454_101429998 | Not Available | 587 | Open in IMG/M |
3300004081|Ga0063454_101664620 | Not Available | 553 | Open in IMG/M |
3300004114|Ga0062593_100258855 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
3300004114|Ga0062593_100334709 | Not Available | 1313 | Open in IMG/M |
3300004114|Ga0062593_100933729 | Not Available | 881 | Open in IMG/M |
3300004114|Ga0062593_103179903 | Not Available | 526 | Open in IMG/M |
3300004156|Ga0062589_100671840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 914 | Open in IMG/M |
3300004157|Ga0062590_101131524 | Not Available | 757 | Open in IMG/M |
3300004463|Ga0063356_100481280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1633 | Open in IMG/M |
3300004463|Ga0063356_100856583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1277 | Open in IMG/M |
3300004479|Ga0062595_100242531 | Not Available | 1160 | Open in IMG/M |
3300004479|Ga0062595_101534285 | Not Available | 616 | Open in IMG/M |
3300004479|Ga0062595_101813413 | Not Available | 580 | Open in IMG/M |
3300004480|Ga0062592_100418606 | Not Available | 1073 | Open in IMG/M |
3300004643|Ga0062591_100282902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1292 | Open in IMG/M |
3300004643|Ga0062591_100288912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1282 | Open in IMG/M |
3300004643|Ga0062591_100930383 | Not Available | 819 | Open in IMG/M |
3300004643|Ga0062591_102049057 | Not Available | 591 | Open in IMG/M |
3300004803|Ga0058862_12237534 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300005167|Ga0066672_10411039 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR23 | 885 | Open in IMG/M |
3300005175|Ga0066673_10518064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
3300005176|Ga0066679_10869300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 570 | Open in IMG/M |
3300005179|Ga0066684_10257311 | Not Available | 1148 | Open in IMG/M |
3300005187|Ga0066675_11389110 | Not Available | 515 | Open in IMG/M |
3300005328|Ga0070676_11493917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
3300005329|Ga0070683_102350215 | Not Available | 511 | Open in IMG/M |
3300005330|Ga0070690_100438425 | Not Available | 966 | Open in IMG/M |
3300005332|Ga0066388_101604627 | Not Available | 1145 | Open in IMG/M |
3300005332|Ga0066388_101854448 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300005332|Ga0066388_102314917 | Not Available | 972 | Open in IMG/M |
3300005332|Ga0066388_103416710 | Not Available | 811 | Open in IMG/M |
3300005332|Ga0066388_106531206 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005335|Ga0070666_10355951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1048 | Open in IMG/M |
3300005341|Ga0070691_10867285 | Not Available | 554 | Open in IMG/M |
3300005341|Ga0070691_10868615 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300005344|Ga0070661_100786853 | Not Available | 780 | Open in IMG/M |
3300005356|Ga0070674_102142246 | Not Available | 510 | Open in IMG/M |
3300005406|Ga0070703_10568585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300005435|Ga0070714_102138558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
3300005437|Ga0070710_11236570 | Not Available | 553 | Open in IMG/M |
3300005438|Ga0070701_11202801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
3300005440|Ga0070705_100837237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
3300005458|Ga0070681_10828872 | Not Available | 842 | Open in IMG/M |
3300005458|Ga0070681_11043078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
3300005530|Ga0070679_101622565 | Not Available | 594 | Open in IMG/M |
3300005533|Ga0070734_10606428 | Not Available | 623 | Open in IMG/M |
3300005538|Ga0070731_10704991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300005547|Ga0070693_100992829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300005547|Ga0070693_101387153 | Not Available | 546 | Open in IMG/M |
3300005549|Ga0070704_101326809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 659 | Open in IMG/M |
3300005713|Ga0066905_100484009 | Not Available | 1025 | Open in IMG/M |
3300005719|Ga0068861_100299052 | Not Available | 1393 | Open in IMG/M |
3300005764|Ga0066903_100271792 | Not Available | 2645 | Open in IMG/M |
3300005764|Ga0066903_100632755 | Not Available | 1865 | Open in IMG/M |
3300005764|Ga0066903_101091874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1470 | Open in IMG/M |
3300005764|Ga0066903_101777107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1177 | Open in IMG/M |
3300005764|Ga0066903_101887466 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300005764|Ga0066903_102147773 | Not Available | 1076 | Open in IMG/M |
3300005764|Ga0066903_102501896 | Not Available | 1000 | Open in IMG/M |
3300005764|Ga0066903_102952252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 922 | Open in IMG/M |
3300005841|Ga0068863_101303054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
3300005874|Ga0075288_1066012 | Not Available | 577 | Open in IMG/M |
3300006034|Ga0066656_10762693 | Not Available | 620 | Open in IMG/M |
3300006046|Ga0066652_101825227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 548 | Open in IMG/M |
3300006047|Ga0075024_100127616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1140 | Open in IMG/M |
3300006047|Ga0075024_100419088 | Not Available | 685 | Open in IMG/M |
3300006047|Ga0075024_100462786 | Not Available | 658 | Open in IMG/M |
3300006057|Ga0075026_100581009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 656 | Open in IMG/M |
3300006057|Ga0075026_100645063 | Not Available | 627 | Open in IMG/M |
3300006057|Ga0075026_100869536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
3300006059|Ga0075017_100006526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales | 7384 | Open in IMG/M |
3300006059|Ga0075017_100386313 | Not Available | 1048 | Open in IMG/M |
3300006059|Ga0075017_101065145 | Not Available | 631 | Open in IMG/M |
3300006354|Ga0075021_10111410 | Not Available | 1632 | Open in IMG/M |
3300006354|Ga0075021_10504622 | Not Available | 766 | Open in IMG/M |
3300006354|Ga0075021_10940743 | Not Available | 562 | Open in IMG/M |
3300006641|Ga0075471_10005437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8158 | Open in IMG/M |
3300006641|Ga0075471_10027682 | All Organisms → cellular organisms → Bacteria | 3293 | Open in IMG/M |
3300006641|Ga0075471_10151863 | Not Available | 1224 | Open in IMG/M |
3300006800|Ga0066660_10338060 | Not Available | 1217 | Open in IMG/M |
3300006804|Ga0079221_11011340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300006804|Ga0079221_11260620 | Not Available | 578 | Open in IMG/M |
3300006806|Ga0079220_11080372 | Not Available | 647 | Open in IMG/M |
3300006806|Ga0079220_11254601 | Not Available | 617 | Open in IMG/M |
3300006854|Ga0075425_100998893 | Not Available | 955 | Open in IMG/M |
3300006865|Ga0073934_10012911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9759 | Open in IMG/M |
3300006865|Ga0073934_10246409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1176 | Open in IMG/M |
3300006865|Ga0073934_10415116 | Not Available | 824 | Open in IMG/M |
3300006871|Ga0075434_101850968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
3300006876|Ga0079217_10231199 | Not Available | 971 | Open in IMG/M |
3300007076|Ga0075435_100732001 | Not Available | 860 | Open in IMG/M |
3300009012|Ga0066710_102239982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 796 | Open in IMG/M |
3300009093|Ga0105240_11824133 | Not Available | 634 | Open in IMG/M |
3300009094|Ga0111539_10515136 | Not Available | 1393 | Open in IMG/M |
3300009098|Ga0105245_10614729 | Not Available | 1114 | Open in IMG/M |
3300009098|Ga0105245_10728395 | Not Available | 1026 | Open in IMG/M |
3300009137|Ga0066709_100057613 | Not Available | 4449 | Open in IMG/M |
3300009147|Ga0114129_10523143 | Not Available | 1546 | Open in IMG/M |
3300009148|Ga0105243_11387868 | Not Available | 723 | Open in IMG/M |
3300009156|Ga0111538_10963392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1080 | Open in IMG/M |
3300009176|Ga0105242_10255926 | Not Available | 1579 | Open in IMG/M |
3300009176|Ga0105242_12159074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
3300009700|Ga0116217_10633263 | Not Available | 664 | Open in IMG/M |
3300010046|Ga0126384_12366081 | Not Available | 514 | Open in IMG/M |
3300010326|Ga0134065_10451431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
3300010359|Ga0126376_12556945 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR23 | 559 | Open in IMG/M |
3300010362|Ga0126377_10214092 | Not Available | 1855 | Open in IMG/M |
3300010362|Ga0126377_12879752 | Not Available | 555 | Open in IMG/M |
3300010366|Ga0126379_12463154 | Not Available | 619 | Open in IMG/M |
3300010366|Ga0126379_12899642 | Not Available | 574 | Open in IMG/M |
3300010366|Ga0126379_13148466 | Not Available | 552 | Open in IMG/M |
3300010366|Ga0126379_13440923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 530 | Open in IMG/M |
3300010375|Ga0105239_13109695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300010376|Ga0126381_100311613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2160 | Open in IMG/M |
3300010379|Ga0136449_100018605 | Not Available | 17966 | Open in IMG/M |
3300010396|Ga0134126_10486312 | Not Available | 1424 | Open in IMG/M |
3300010397|Ga0134124_12721462 | Not Available | 538 | Open in IMG/M |
3300010398|Ga0126383_12394936 | Not Available | 613 | Open in IMG/M |
3300010399|Ga0134127_11596065 | Not Available | 726 | Open in IMG/M |
3300012200|Ga0137382_10971487 | Not Available | 610 | Open in IMG/M |
3300012208|Ga0137376_10631415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 926 | Open in IMG/M |
3300012208|Ga0137376_11576674 | Not Available | 548 | Open in IMG/M |
3300012212|Ga0150985_104768704 | Not Available | 1496 | Open in IMG/M |
3300012212|Ga0150985_107219213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1892 | Open in IMG/M |
3300012212|Ga0150985_107310356 | Not Available | 553 | Open in IMG/M |
3300012212|Ga0150985_110904074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 1058 | Open in IMG/M |
3300012212|Ga0150985_114615165 | Not Available | 817 | Open in IMG/M |
3300012212|Ga0150985_119920424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
3300012362|Ga0137361_11348176 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 637 | Open in IMG/M |
3300012469|Ga0150984_106625594 | Not Available | 806 | Open in IMG/M |
3300012469|Ga0150984_110509224 | Not Available | 976 | Open in IMG/M |
3300012469|Ga0150984_117202318 | Not Available | 556 | Open in IMG/M |
3300012469|Ga0150984_118787307 | Not Available | 612 | Open in IMG/M |
3300012469|Ga0150984_119741589 | Not Available | 552 | Open in IMG/M |
3300012532|Ga0137373_10749790 | Not Available | 724 | Open in IMG/M |
3300012582|Ga0137358_10957286 | Not Available | 557 | Open in IMG/M |
3300012679|Ga0136616_10354264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
3300012683|Ga0137398_10267471 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300012683|Ga0137398_10922483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
3300012917|Ga0137395_10783847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 690 | Open in IMG/M |
3300012924|Ga0137413_10709901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 764 | Open in IMG/M |
3300012924|Ga0137413_11618693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 530 | Open in IMG/M |
3300012930|Ga0137407_10037511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 3840 | Open in IMG/M |
3300012931|Ga0153915_10236228 | Not Available | 2019 | Open in IMG/M |
3300012958|Ga0164299_10687047 | Not Available | 714 | Open in IMG/M |
3300012960|Ga0164301_10458756 | Not Available | 908 | Open in IMG/M |
3300012960|Ga0164301_11516497 | Not Available | 553 | Open in IMG/M |
3300012984|Ga0164309_10917184 | Not Available | 715 | Open in IMG/M |
3300012984|Ga0164309_11524673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300013104|Ga0157370_11588861 | Not Available | 588 | Open in IMG/M |
3300013297|Ga0157378_10143786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 2217 | Open in IMG/M |
3300013503|Ga0120127_10063387 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300013772|Ga0120158_10224531 | Not Available | 959 | Open in IMG/M |
3300013772|Ga0120158_10350616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
3300014054|Ga0120135_1069185 | Not Available | 581 | Open in IMG/M |
3300014322|Ga0075355_1018682 | Not Available | 1383 | Open in IMG/M |
3300014497|Ga0182008_10587249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
3300014498|Ga0182019_10901827 | Not Available | 637 | Open in IMG/M |
3300014501|Ga0182024_10001183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 67642 | Open in IMG/M |
3300014745|Ga0157377_11703311 | Not Available | 509 | Open in IMG/M |
3300014829|Ga0120104_1095738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 592 | Open in IMG/M |
3300015171|Ga0167648_1004096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 3742 | Open in IMG/M |
3300015360|Ga0163144_10388542 | Not Available | 1677 | Open in IMG/M |
3300015371|Ga0132258_11154354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 1958 | Open in IMG/M |
3300015371|Ga0132258_12213305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1380 | Open in IMG/M |
3300015371|Ga0132258_12386921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 1325 | Open in IMG/M |
3300015372|Ga0132256_101935884 | Not Available | 696 | Open in IMG/M |
3300015373|Ga0132257_101092627 | Not Available | 1007 | Open in IMG/M |
3300015373|Ga0132257_103569198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
3300015373|Ga0132257_103742634 | Not Available | 553 | Open in IMG/M |
3300015373|Ga0132257_103742634 | Not Available | 553 | Open in IMG/M |
3300015374|Ga0132255_102643861 | Not Available | 767 | Open in IMG/M |
3300016319|Ga0182033_11675754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 576 | Open in IMG/M |
3300016387|Ga0182040_10905869 | Not Available | 731 | Open in IMG/M |
3300017939|Ga0187775_10320066 | Not Available | 618 | Open in IMG/M |
3300017939|Ga0187775_10454870 | Not Available | 540 | Open in IMG/M |
3300017944|Ga0187786_10312094 | Not Available | 650 | Open in IMG/M |
3300017959|Ga0187779_10185635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1296 | Open in IMG/M |
3300017959|Ga0187779_10196795 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300017959|Ga0187779_10285718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1052 | Open in IMG/M |
3300017959|Ga0187779_10321627 | Not Available | 994 | Open in IMG/M |
3300017959|Ga0187779_10474045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
3300017959|Ga0187779_10882060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
3300017959|Ga0187779_10983335 | Not Available | 585 | Open in IMG/M |
3300017959|Ga0187779_10994215 | Not Available | 582 | Open in IMG/M |
3300017959|Ga0187779_11090764 | Not Available | 557 | Open in IMG/M |
3300017966|Ga0187776_11133107 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR23 | 583 | Open in IMG/M |
3300017973|Ga0187780_11412292 | Not Available | 513 | Open in IMG/M |
3300017974|Ga0187777_10039129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3044 | Open in IMG/M |
3300017974|Ga0187777_10805257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 671 | Open in IMG/M |
3300017974|Ga0187777_11404269 | Not Available | 515 | Open in IMG/M |
3300017999|Ga0187767_10302061 | Not Available | 546 | Open in IMG/M |
3300017999|Ga0187767_10366873 | Not Available | 511 | Open in IMG/M |
3300018029|Ga0187787_10106385 | Not Available | 906 | Open in IMG/M |
3300018029|Ga0187787_10373730 | Not Available | 555 | Open in IMG/M |
3300018029|Ga0187787_10434029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis metallicus | 525 | Open in IMG/M |
3300018058|Ga0187766_10850459 | Not Available | 640 | Open in IMG/M |
3300018060|Ga0187765_10073971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1807 | Open in IMG/M |
3300018060|Ga0187765_11281236 | Not Available | 518 | Open in IMG/M |
3300018060|Ga0187765_11326465 | Not Available | 511 | Open in IMG/M |
3300018422|Ga0190265_12234376 | Not Available | 649 | Open in IMG/M |
3300018422|Ga0190265_12772549 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300018429|Ga0190272_10752872 | Not Available | 887 | Open in IMG/M |
3300018481|Ga0190271_10998969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 961 | Open in IMG/M |
3300018481|Ga0190271_11469297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 799 | Open in IMG/M |
3300018482|Ga0066669_10202300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1522 | Open in IMG/M |
3300018482|Ga0066669_10259278 | Not Available | 1381 | Open in IMG/M |
3300018482|Ga0066669_12388930 | Not Available | 506 | Open in IMG/M |
3300019356|Ga0173481_10712688 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300019786|Ga0182025_1152132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1489 | Open in IMG/M |
3300020057|Ga0163151_10139009 | Not Available | 1514 | Open in IMG/M |
3300021432|Ga0210384_10779095 | Not Available | 853 | Open in IMG/M |
3300021478|Ga0210402_11225455 | Not Available | 678 | Open in IMG/M |
3300021479|Ga0210410_10626937 | Not Available | 954 | Open in IMG/M |
3300022467|Ga0224712_10352165 | Not Available | 696 | Open in IMG/M |
3300022467|Ga0224712_10636864 | Not Available | 522 | Open in IMG/M |
3300024347|Ga0179591_1018446 | Not Available | 1751 | Open in IMG/M |
3300024494|Ga0255194_1039274 | Not Available | 696 | Open in IMG/M |
3300025310|Ga0209172_10033138 | All Organisms → cellular organisms → Bacteria | 3402 | Open in IMG/M |
3300025324|Ga0209640_11064047 | Not Available | 619 | Open in IMG/M |
3300025872|Ga0208783_10002076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 11635 | Open in IMG/M |
3300025872|Ga0208783_10003933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 8228 | Open in IMG/M |
3300025872|Ga0208783_10120437 | Not Available | 1135 | Open in IMG/M |
3300025885|Ga0207653_10149885 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300025912|Ga0207707_11583410 | Not Available | 516 | Open in IMG/M |
3300025913|Ga0207695_11052634 | Not Available | 693 | Open in IMG/M |
3300025916|Ga0207663_11101814 | Not Available | 638 | Open in IMG/M |
3300025918|Ga0207662_10795139 | Not Available | 666 | Open in IMG/M |
3300025921|Ga0207652_10653011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 940 | Open in IMG/M |
3300025928|Ga0207700_11131156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
3300025935|Ga0207709_10458212 | Not Available | 987 | Open in IMG/M |
3300025937|Ga0207669_11768532 | Not Available | 528 | Open in IMG/M |
3300025939|Ga0207665_10680103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
3300025939|Ga0207665_11060538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 645 | Open in IMG/M |
3300025939|Ga0207665_11614814 | Not Available | 514 | Open in IMG/M |
3300025942|Ga0207689_11013151 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300025944|Ga0207661_11667754 | Not Available | 583 | Open in IMG/M |
3300025961|Ga0207712_10167469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 1714 | Open in IMG/M |
3300026078|Ga0207702_11650695 | Not Available | 634 | Open in IMG/M |
3300026078|Ga0207702_11863987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
3300026089|Ga0207648_11801756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300026095|Ga0207676_11863468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
3300026121|Ga0207683_11878212 | Not Available | 548 | Open in IMG/M |
3300026552|Ga0209577_10831399 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR23 | 517 | Open in IMG/M |
3300026824|Ga0207723_116093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300027854|Ga0209517_10254396 | Not Available | 1049 | Open in IMG/M |
3300027894|Ga0209068_10002530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 8800 | Open in IMG/M |
3300027894|Ga0209068_10320156 | Not Available | 874 | Open in IMG/M |
3300027894|Ga0209068_10885788 | Not Available | 528 | Open in IMG/M |
3300027915|Ga0209069_10094134 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300027915|Ga0209069_10533575 | Not Available | 666 | Open in IMG/M |
3300028379|Ga0268266_10938830 | Not Available | 837 | Open in IMG/M |
3300028380|Ga0268265_11952832 | Not Available | 594 | Open in IMG/M |
3300028556|Ga0265337_1205566 | Not Available | 535 | Open in IMG/M |
3300028573|Ga0265334_10211268 | Not Available | 672 | Open in IMG/M |
3300028577|Ga0265318_10186476 | Not Available | 759 | Open in IMG/M |
3300028587|Ga0247828_10506723 | Not Available | 718 | Open in IMG/M |
3300028590|Ga0247823_10693458 | Not Available | 766 | Open in IMG/M |
3300028665|Ga0302160_10099100 | Not Available | 640 | Open in IMG/M |
3300028799|Ga0307284_10398318 | Not Available | 560 | Open in IMG/M |
3300028799|Ga0307284_10410023 | Not Available | 552 | Open in IMG/M |
3300028800|Ga0265338_10000404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 77425 | Open in IMG/M |
3300028800|Ga0265338_10518775 | Not Available | 837 | Open in IMG/M |
3300028809|Ga0247824_10757597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
3300028881|Ga0307277_10086202 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1320 | Open in IMG/M |
3300029923|Ga0311347_10764448 | Not Available | 587 | Open in IMG/M |
3300029984|Ga0311332_10127962 | Not Available | 1869 | Open in IMG/M |
3300029987|Ga0311334_10333987 | Not Available | 1191 | Open in IMG/M |
3300030002|Ga0311350_10607473 | Not Available | 983 | Open in IMG/M |
3300030114|Ga0311333_11034152 | Not Available | 697 | Open in IMG/M |
3300031184|Ga0307499_10177178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
3300031228|Ga0299914_10626719 | Not Available | 916 | Open in IMG/M |
3300031228|Ga0299914_11432417 | Not Available | 542 | Open in IMG/M |
3300031232|Ga0302323_102212942 | Not Available | 626 | Open in IMG/M |
3300031238|Ga0265332_10079419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1392 | Open in IMG/M |
3300031247|Ga0265340_10267990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 760 | Open in IMG/M |
3300031249|Ga0265339_10403246 | Not Available | 639 | Open in IMG/M |
3300031344|Ga0265316_10461994 | Not Available | 910 | Open in IMG/M |
3300031543|Ga0318516_10161845 | Not Available | 1287 | Open in IMG/M |
3300031544|Ga0318534_10656490 | Not Available | 594 | Open in IMG/M |
3300031640|Ga0318555_10664361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300031716|Ga0310813_10825104 | Not Available | 836 | Open in IMG/M |
3300031716|Ga0310813_11955677 | Not Available | 552 | Open in IMG/M |
3300031731|Ga0307405_10885823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 754 | Open in IMG/M |
3300031771|Ga0318546_11099121 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR23 | 559 | Open in IMG/M |
3300031805|Ga0318497_10518116 | Not Available | 668 | Open in IMG/M |
3300031805|Ga0318497_10834988 | Not Available | 517 | Open in IMG/M |
3300031812|Ga0308411_10021181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 3602 | Open in IMG/M |
3300031824|Ga0307413_10485083 | Not Available | 989 | Open in IMG/M |
3300031847|Ga0310907_10156464 | Not Available | 1052 | Open in IMG/M |
3300031893|Ga0318536_10706310 | Not Available | 502 | Open in IMG/M |
3300031901|Ga0307406_10264186 | Not Available | 1304 | Open in IMG/M |
3300031902|Ga0302322_103863991 | Not Available | 512 | Open in IMG/M |
3300031908|Ga0310900_10638850 | Not Available | 846 | Open in IMG/M |
3300031908|Ga0310900_10937734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
3300031910|Ga0306923_11851004 | Not Available | 618 | Open in IMG/M |
3300031912|Ga0306921_10899683 | Not Available | 1005 | Open in IMG/M |
3300031938|Ga0308175_101512561 | Not Available | 750 | Open in IMG/M |
3300032001|Ga0306922_10759217 | Not Available | 1017 | Open in IMG/M |
3300032013|Ga0310906_10739821 | Not Available | 690 | Open in IMG/M |
3300032013|Ga0310906_11224905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
3300032043|Ga0318556_10755364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
3300032160|Ga0311301_10972939 | Not Available | 1128 | Open in IMG/M |
3300032261|Ga0306920_100729489 | Not Available | 1459 | Open in IMG/M |
3300032770|Ga0335085_10006132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 19075 | Open in IMG/M |
3300032770|Ga0335085_10010924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium IMCC26256 | 13514 | Open in IMG/M |
3300032770|Ga0335085_12099217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300032783|Ga0335079_10807001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 972 | Open in IMG/M |
3300032828|Ga0335080_11834451 | Not Available | 591 | Open in IMG/M |
3300032829|Ga0335070_11936053 | Not Available | 531 | Open in IMG/M |
3300032897|Ga0335071_10597120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1055 | Open in IMG/M |
3300033004|Ga0335084_10313220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1622 | Open in IMG/M |
3300033289|Ga0310914_10190070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium | 1830 | Open in IMG/M |
3300033412|Ga0310810_10471243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1262 | Open in IMG/M |
3300033551|Ga0247830_10737461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 783 | Open in IMG/M |
3300034123|Ga0370479_0106966 | Not Available | 744 | Open in IMG/M |
3300034125|Ga0370484_0129917 | Not Available | 669 | Open in IMG/M |
3300034176|Ga0364931_0172991 | Not Available | 700 | Open in IMG/M |
3300034268|Ga0372943_0724583 | Not Available | 657 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.39% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.49% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.49% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.29% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.69% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.40% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.40% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.40% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.99% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.10% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.10% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.80% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.80% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.20% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.20% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.50% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.50% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.90% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.90% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.60% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.60% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.60% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.60% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.60% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.60% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.60% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.60% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.60% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.60% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.60% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.30% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.30% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.30% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.30% |
Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 0.30% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.30% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.30% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.30% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.30% |
Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.30% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.30% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.30% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.30% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.30% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.30% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.30% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.30% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.30% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.30% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.30% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.30% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
3300015171 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300024494 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N56_05811170 | 2170459012 | Grass Soil | MFLAQQLIDAGQDGGAAFLAFAIMVFLFVGSLFYMDHIRKRREEQNK |
4ZMR_02056770 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRKREEKSDS |
INPhiseqgaiiFebDRAFT_1053399492 | 3300000364 | Soil | MVVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDHIRRRREDRENR* |
INPhiseqgaiiFebDRAFT_1054773232 | 3300000364 | Soil | MMLAQQLIDASKDGGAAFIAFAVMXFLFVGSLFYMDHVRRKREERDQP* |
INPhiseqgaiiFebDRAFT_1054819872 | 3300000364 | Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRIRRRREERDR* |
JGIcombinedJ13530_1031129192 | 3300001213 | Wetland | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRIRRKREEKSDS* |
A10PFW1_107423603 | 3300001538 | Permafrost | MLIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREERDQ* |
C688J35102_1181480872 | 3300002568 | Soil | MMLAQQLIDASKDGGAAFIAFAVMCFLFVGSLFYMDHVRRKREERDES* |
C688J35102_1195053562 | 3300002568 | Soil | MHVVAQQLIDASTDGGAAFLAFAIMCMLFMASLFYMDHIRKKREDGH* |
C688J35102_1202788182 | 3300002568 | Soil | MIVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDR* |
C688J35102_1208763892 | 3300002568 | Soil | MVLAQQLIDASKDGGAAFVAFAVMCFLFVGSLFYMDKVRRRRDERRGR* |
soilH1_103783552 | 3300003321 | Sugarcane Root And Bulk Soil | MLAQQLIDASKDGGAAFIAFSVMVFLFTASLFYMDRIRRKREERDQSNN* |
P52013CM_10475322 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | MLAQQLIDASEEGGLAFLTFAIMIFLFAGSLFYMDRVRRRAEERRDRGR* |
Ga0055471_101746742 | 3300003987 | Natural And Restored Wetlands | MHVVAQQLIDASTDGGAAFLAFAVMCMLFMASLFYMDHIRKKREEEQNR |
Ga0055470_101777011 | 3300003992 | Natural And Restored Wetlands | MFVAQQLVDASTQGGLAFLLFAIMCMLFVSSLFYMDHIRKRREQERGQQ* |
Ga0063454_1014299981 | 3300004081 | Soil | MHVVAQQLIDASKQGGAAFLAFAIMCMLFVASLFYMDHIRRKRDEERGR* |
Ga0063454_1016646202 | 3300004081 | Soil | VVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQGR* |
Ga0062593_1002588553 | 3300004114 | Soil | MMLAQQLIDASKDGGAAFIAFAVMCFLFVGSLFYMDHVRRKREERD* |
Ga0062593_1003347092 | 3300004114 | Soil | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREE* |
Ga0062593_1009337292 | 3300004114 | Soil | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEREN* |
Ga0062593_1031799032 | 3300004114 | Soil | MILAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDEQH* |
Ga0062589_1006718401 | 3300004156 | Soil | MLLAQQLIDGGHDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN* |
Ga0062590_1011315242 | 3300004157 | Soil | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDG* |
Ga0063356_1004812803 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREERQN* |
Ga0063356_1008565832 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTLAQQLIDASEQGGEAFLAFAIMVFLFAGSLFYMDRIRRKREERDEQTQD* |
Ga0062595_1002425312 | 3300004479 | Soil | IDASKDGGAAFVAMAVMCFLFVGSLFYMDKVRRKREERRGR* |
Ga0062595_1015342852 | 3300004479 | Soil | MIIAQQLIDASKDGGAAFVAMCVMIFLFVGSLFYMDKIRRR |
Ga0062595_1018134131 | 3300004479 | Soil | MFLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDG* |
Ga0062592_1004186062 | 3300004480 | Soil | MTVAQQLIDASEDGGLAFLVFAIMVFLFAGSLFYMDRIRRRREERDRNEP* |
Ga0062591_1002829022 | 3300004643 | Soil | VYLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0062591_1002889122 | 3300004643 | Soil | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN* |
Ga0062591_1009303832 | 3300004643 | Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDHVRRRREERGK* |
Ga0062591_1020490572 | 3300004643 | Soil | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRR |
Ga0058862_122375342 | 3300004803 | Host-Associated | MFLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYISRERDFAVRL* |
Ga0066672_104110392 | 3300005167 | Soil | MVLAQQLIDASKDGGAAFVAMAVMCALFVASLFYMDKVRRKREERRGR* |
Ga0066673_105180642 | 3300005175 | Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREERDN* |
Ga0066679_108693002 | 3300005176 | Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRRREERDD* |
Ga0066684_102573112 | 3300005179 | Soil | MVVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDHIRRRREDRQNR* |
Ga0066675_113891101 | 3300005187 | Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREDRDN* |
Ga0070676_114939172 | 3300005328 | Miscanthus Rhizosphere | QQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0070683_1023502152 | 3300005329 | Corn Rhizosphere | AQQLIDASKDGGAAFIAFACMVFLFAGSLFYMDHIRRTRQEKAEQKERDRHN* |
Ga0070690_1004384251 | 3300005330 | Switchgrass Rhizosphere | MIVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDE* |
Ga0066388_1016046272 | 3300005332 | Tropical Forest Soil | MLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDHIRRKREERQDR* |
Ga0066388_1018544482 | 3300005332 | Tropical Forest Soil | MVLAQQLIDASKDGAAAFIAFAVMVFLFTGSLFYMDKVRRRREDK* |
Ga0066388_1023149172 | 3300005332 | Tropical Forest Soil | MILAQQLIDASKDGAAAFIAFAVMVFLFTGSLFYMDKVRRRREDK* |
Ga0066388_1034167102 | 3300005332 | Tropical Forest Soil | MVLAQQLIDASKDGGAAFIAFCVMVFLFTGSLFYMDHVRRKREECDRPRDQ* |
Ga0066388_1065312061 | 3300005332 | Tropical Forest Soil | MFVAQQLIDASKQGGEAFLAFAIMVFLFTASLFYMDRIRKRREDRDRHD* |
Ga0070666_103559512 | 3300005335 | Switchgrass Rhizosphere | MLIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0070691_108672852 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLAQQLIDASKDGGAAFIAFACMVFLFAGSLFYMDHIRRTRQEKAEQKERDRHN* |
Ga0070691_108686151 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | AQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0070661_1007868531 | 3300005344 | Corn Rhizosphere | IDASKDGGAAFIAFACMVFLFAGSLFYMDHIRRTRQEKAEQKERDRHN* |
Ga0070674_1021422461 | 3300005356 | Miscanthus Rhizosphere | VLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREE* |
Ga0070703_105685851 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | PVYLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0070714_1021385581 | 3300005435 | Agricultural Soil | MVLAQQLIDASKDGGAAFIAFSVMVFLFAGSLFYMDKIRRRRAERDDTTRN* |
Ga0070710_112365702 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRQRREDSDKK* |
Ga0070701_112028012 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MTVAQQLIDASEDGGLAFLVFAIMVFLFTASLFYMDRIRRRREERDRNEP* |
Ga0070705_1008372372 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLAQQLIDGGKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN* |
Ga0070681_108288722 | 3300005458 | Corn Rhizosphere | MILAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDEQN* |
Ga0070681_110430782 | 3300005458 | Corn Rhizosphere | VVIAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDN* |
Ga0070679_1016225652 | 3300005530 | Corn Rhizosphere | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRIRRKREEGGK* |
Ga0070734_106064282 | 3300005533 | Surface Soil | MVLAQQLIDASKDGGAAFIAFATMCFLFAGSLFYMDKIRRKRQDRDDTHRN* |
Ga0070731_107049912 | 3300005538 | Surface Soil | MIVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRGE* |
Ga0070693_1009928292 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VVIAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEDN* |
Ga0070693_1013871531 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMDHIRKRREEQNR* |
Ga0070704_1013268092 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDRVRRQREDQQN* |
Ga0066905_1004840091 | 3300005713 | Tropical Forest Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDHVRR |
Ga0068861_1002990522 | 3300005719 | Switchgrass Rhizosphere | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDE* |
Ga0066903_1002717923 | 3300005764 | Tropical Forest Soil | MVVAQQLIDASKQGGEAFLAFAIMVFLFTASLFYMDRIRKRREDRDRNE* |
Ga0066903_1006327552 | 3300005764 | Tropical Forest Soil | MFLAQQLIDASKDGGAAFIAFAVMVFLFAGSLFYMDHIRKKREERDEPRNE* |
Ga0066903_1010918742 | 3300005764 | Tropical Forest Soil | MLIAQQLIDASKDGGAAFIAFAIMCFLFVGSLFYMDHVRRKREERNKPRNE* |
Ga0066903_1017771071 | 3300005764 | Tropical Forest Soil | MILAQQLIDASKDGGAAFIAMCVMIFLFVGSLFYMDKIRRRREERDEQNRN* |
Ga0066903_1018874662 | 3300005764 | Tropical Forest Soil | MLAQQLIDASKDGAAAFIAFAVMVFLFTGSLFYMDKVRRRRQDK* |
Ga0066903_1021477732 | 3300005764 | Tropical Forest Soil | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKIRRRREERDEHSN* |
Ga0066903_1025018962 | 3300005764 | Tropical Forest Soil | MVLAQQLIDASKDGGAAFIAFATMVFLFAGSLFYMDHIRRTRQEKQEEKERNRHN* |
Ga0066903_1029522522 | 3300005764 | Tropical Forest Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREERDNK* |
Ga0068863_1013030542 | 3300005841 | Switchgrass Rhizosphere | MVLAQQLIDASKDGGAAFIAFAVMCFLFVGSLFYMDHVRRKREERDES* |
Ga0075288_10660121 | 3300005874 | Rice Paddy Soil | MVLAQQLIDASKDGGAAFVAFAVMVFLFAGSLFYMDKVRRKREERRDR* |
Ga0066656_107626932 | 3300006034 | Soil | MIIAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDR* |
Ga0066652_1018252271 | 3300006046 | Soil | AQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMDHIRKRRDQERGR* |
Ga0075024_1001276162 | 3300006047 | Watersheds | MVIAQQLIDASKDGGAAFISFSIMVFLFAGSLFYMDRVRRRREERGK* |
Ga0075024_1004190882 | 3300006047 | Watersheds | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRKREEKSDS* |
Ga0075024_1004627862 | 3300006047 | Watersheds | VVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDEQGR* |
Ga0075026_1005810092 | 3300006057 | Watersheds | VVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRKREEQGR* |
Ga0075026_1006450631 | 3300006057 | Watersheds | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDS* |
Ga0075026_1008695362 | 3300006057 | Watersheds | MIIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRKRERKQ* |
Ga0075017_1000065264 | 3300006059 | Watersheds | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRKREEKTDS* |
Ga0075017_1003863131 | 3300006059 | Watersheds | MVLAQQLIDASKDGGAAFLSFAIMVFLFAGSLFYMDKVRR |
Ga0075017_1010651452 | 3300006059 | Watersheds | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRQKREERNK* |
Ga0075021_101114103 | 3300006354 | Watersheds | VVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREGR* |
Ga0075021_105046221 | 3300006354 | Watersheds | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDKVRQKREDREK* |
Ga0075021_109407432 | 3300006354 | Watersheds | MTLLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMDHIRKRREEQKR* |
Ga0075471_100054372 | 3300006641 | Aqueous | VVIAQQLIDASKDGAAAFVAFAVMVFLFTGSLFYMDYIRRRRGED* |
Ga0075471_100276823 | 3300006641 | Aqueous | VVLAQQLIDASKDGAAAFVAFAVMVFLFTGSLFYMDYIRRRRGED* |
Ga0075471_101518632 | 3300006641 | Aqueous | VVLAQQLIDASKDGGAAFLGMVIMIVLFMLSLFYMDRIRRRREEQRGG* |
Ga0066660_103380602 | 3300006800 | Soil | MVLAQQLIDASKDGGAAFVAMAVMCALFVGSLFYMDKVRRKREERRGR* |
Ga0079221_110113402 | 3300006804 | Agricultural Soil | MVVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRGE* |
Ga0079221_112606202 | 3300006804 | Agricultural Soil | MFLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQQR* |
Ga0079220_110803722 | 3300006806 | Agricultural Soil | MIVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREE* |
Ga0079220_112546012 | 3300006806 | Agricultural Soil | MLAQQLIDASKDGGLAFLFFAIMCMLFMASLFYMDHIRRRRED |
Ga0075425_1009988931 | 3300006854 | Populus Rhizosphere | MILAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMD |
Ga0073934_100129117 | 3300006865 | Hot Spring Sediment | MLAQQLIDASEEGGLAFLAFAIMVFLFAGSLFYMDRVRRRAEERRGRNE* |
Ga0073934_102464091 | 3300006865 | Hot Spring Sediment | MVLAQQLIDASEDGGLAFLVFAIMVFLFTGSLFYMDRVRQRRVEREEQRDRS* |
Ga0073934_104151162 | 3300006865 | Hot Spring Sediment | MVLAQQLIDASKDGGLAFLVFAIMVFCFTASLFYMDRVRQRRAERD |
Ga0075434_1018509682 | 3300006871 | Populus Rhizosphere | MILAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDDR* |
Ga0079217_102311991 | 3300006876 | Agricultural Soil | VPVLAQQLIDASHDGDLAFMAFAFMCFVFVGLLFA |
Ga0075435_1007320012 | 3300007076 | Populus Rhizosphere | MILAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDR* |
Ga0066710_1022399822 | 3300009012 | Grasslands Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRRREERDK |
Ga0105240_118241332 | 3300009093 | Corn Rhizosphere | MFLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRNN* |
Ga0111539_105151362 | 3300009094 | Populus Rhizosphere | MHVVAQQLIDASKDGGAAFLAFAIMCMLFMASLFYMDHIRKKREDGH* |
Ga0105245_106147292 | 3300009098 | Miscanthus Rhizosphere | MVVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREE* |
Ga0105245_107283952 | 3300009098 | Miscanthus Rhizosphere | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDHVRRRREERQK* |
Ga0066709_1000576135 | 3300009137 | Grasslands Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRRREDRDN* |
Ga0114129_105231432 | 3300009147 | Populus Rhizosphere | MHVVAQQLIDASEQGGAAFLAFAIMCMLFVASLFYMDHIRRKREEERGK* |
Ga0105243_113878682 | 3300009148 | Miscanthus Rhizosphere | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMGHVRRRREERQK* |
Ga0111538_109633922 | 3300009156 | Populus Rhizosphere | MHVVAQQLIDASTDGGAAFLAFAVMCMLFMASLFYMDHIRKKREDGH* |
Ga0105242_102559261 | 3300009176 | Miscanthus Rhizosphere | VYLAQQLIDASKDGGAAFLAFAILVFLFAGSLFYMDKVRRRREDRQN* |
Ga0105242_121590741 | 3300009176 | Miscanthus Rhizosphere | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0116217_106332632 | 3300009700 | Peatlands Soil | MVLAQQLIDASKDGGAAFLSFAIMVFLFAGSLFYMDKVRRRREGQGR* |
Ga0126384_123660811 | 3300010046 | Tropical Forest Soil | MLIAQQLIDASKDGGAAFIAFAIMCFLFVGSLFYMDHVRRKRDEQ* |
Ga0134065_104514312 | 3300010326 | Grasslands Soil | MMVLAQQLIDASKDGGAAFIAFAIMVFLFTGSLFYMDRVRRRREERDD* |
Ga0126376_125569452 | 3300010359 | Tropical Forest Soil | MFIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDHVRRRREEREK* |
Ga0126377_102140923 | 3300010362 | Tropical Forest Soil | MFVAQQLIDASKQGGEAFLAFAIMVFLFTASLFYMDRIRKRREERDRDRENH* |
Ga0126377_128797522 | 3300010362 | Tropical Forest Soil | MFVAQQLIDASKQGGEAFLAFAIMVFLFTASLFYMDRIRKRREDRDRHE* |
Ga0126379_124631542 | 3300010366 | Tropical Forest Soil | MTMVLAQQLIDASKDGAAAFIAFAVMVFLFTGSLFYMDKVRRRREDK* |
Ga0126379_128996421 | 3300010366 | Tropical Forest Soil | MVLAQQLIDASKDGGAAFIAFAVMVFLFAGSLFYMDHIRKKREERDEPRNE* |
Ga0126379_131484662 | 3300010366 | Tropical Forest Soil | MLLAQQLIDASKDGGAAFLAFAIMVFLFTASLFYMDRIRKRREDRDRHE* |
Ga0126379_134409232 | 3300010366 | Tropical Forest Soil | MVIAQQLIDASKDGGAAFIAFSVMVFLFAGSLFYMDHVRRHREERDR* |
Ga0105239_131096952 | 3300010375 | Corn Rhizosphere | MFLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0126381_1003116133 | 3300010376 | Tropical Forest Soil | MVIAQQLIDASKDGGAAFIAFSVMVFLFAGSLFYMDRVRRRREERDK* |
Ga0136449_10001860516 | 3300010379 | Peatlands Soil | MLVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREERGH* |
Ga0134126_104863121 | 3300010396 | Terrestrial Soil | MTLLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMDHIRKRREEQ |
Ga0134124_127214622 | 3300010397 | Terrestrial Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRKREEKSDT* |
Ga0126383_123949362 | 3300010398 | Tropical Forest Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYM |
Ga0134127_115960651 | 3300010399 | Terrestrial Soil | MLIAQQLIDGGHDGGAAFLAFAIMVFLFAGSLFYMDKVRR |
Ga0137382_109714872 | 3300012200 | Vadose Zone Soil | MVLAQQLIDASKDGGAAFVAMAVMCFLFVASLFYMDKVRRKREGRRGR* |
Ga0137376_106314151 | 3300012208 | Vadose Zone Soil | QQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRRREERDD* |
Ga0137376_115766741 | 3300012208 | Vadose Zone Soil | MVLAQQLIDASKDGGAAFVAMAVMCFLFVASLFYMDKVRRKREERRGR* |
Ga0150985_1047687042 | 3300012212 | Avena Fatua Rhizosphere | MLMVVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDR* |
Ga0150985_1072192132 | 3300012212 | Avena Fatua Rhizosphere | MTLLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFFMDHIRKRREEQNR* |
Ga0150985_1073103562 | 3300012212 | Avena Fatua Rhizosphere | MHVVAQQLIDASEQGGAAFLAFAIMCMLFMASLFYMDHIRKRREQERGR* |
Ga0150985_1109040742 | 3300012212 | Avena Fatua Rhizosphere | VPIAQQLIDASEQGGEAFLAFAIMVFLFAGSLFYMDRIRRRREERDREE* |
Ga0150985_1146151651 | 3300012212 | Avena Fatua Rhizosphere | MTVAQQLIDASEDGGLAFLVFAIMVFLFTASLFYMDRIRRRREERDRNQP* |
Ga0150985_1199204242 | 3300012212 | Avena Fatua Rhizosphere | MVLAQQLIDASKDGGAAFIAFSVMVFLFTASLFYMDRIRRKREERNQPKN* |
Ga0137361_113481762 | 3300012362 | Vadose Zone Soil | MVIAQQLIDASKDGGAAFISFSIMVFLFAGSLFYMDRVRRRREDRDK* |
Ga0150984_1066255941 | 3300012469 | Avena Fatua Rhizosphere | MVLAQQLIDASKDGGAAFVAFAVMCFLFVGSLFYMDKVRR |
Ga0150984_1105092242 | 3300012469 | Avena Fatua Rhizosphere | MHVVAQQLIDASEQGGAAFLAFAIMCMLFMASLFYMDHIRKRRE |
Ga0150984_1172023182 | 3300012469 | Avena Fatua Rhizosphere | MVLAQQLIDASKDGGAAFVAFAVMVFLFAGSLFYMDHIRRTRQEKAEQKERDRNH* |
Ga0150984_1187873072 | 3300012469 | Avena Fatua Rhizosphere | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDR* |
Ga0150984_1197415892 | 3300012469 | Avena Fatua Rhizosphere | MMLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN* |
Ga0137373_107497902 | 3300012532 | Vadose Zone Soil | MFVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDR* |
Ga0137358_109572862 | 3300012582 | Vadose Zone Soil | IVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDR* |
Ga0136616_103542641 | 3300012679 | Polar Desert Sand | DAGKERQGGLAFVAFSIMVMLTAGALFFMDRVRRRHEERDEPDPRA* |
Ga0137398_102674712 | 3300012683 | Vadose Zone Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRQREERDK* |
Ga0137398_109224831 | 3300012683 | Vadose Zone Soil | MLLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0137395_107838472 | 3300012917 | Vadose Zone Soil | MVIAQQLIDASKDGGAAFISFSIMVFLFAGSLFYMDRVRRRREDRDN* |
Ga0137413_107099012 | 3300012924 | Vadose Zone Soil | MIIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVR |
Ga0137413_116186932 | 3300012924 | Vadose Zone Soil | MIIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRQRREDRNK* |
Ga0137407_100375112 | 3300012930 | Vadose Zone Soil | MIIAQQLIDASKDGGAAFIAFSVMVFLFAGSLFYMDRVRQKREDRNK* |
Ga0153915_102362283 | 3300012931 | Freshwater Wetlands | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREEGEE* |
Ga0164299_106870472 | 3300012958 | Soil | VYLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN* |
Ga0164301_104587561 | 3300012960 | Soil | HPFPHRIRKETTMVLAQQLIDASKDGGAAFISFAVMVFLFTGSLFYMDKIRRRRQQRDEQRND* |
Ga0164301_115164972 | 3300012960 | Soil | MLIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRKREEK* |
Ga0164309_109171842 | 3300012984 | Soil | MVLAQQLIDASKDGGAAFIAFACMVFLFAGSLFYMDHIRR |
Ga0164309_115246732 | 3300012984 | Soil | VFLAQQLIDASKDGGAAFLAFAIMVFLFVGSLFYMDKVRRRREDRQN* |
Ga0157370_115888612 | 3300013104 | Corn Rhizosphere | MFLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDNQN* |
Ga0157378_101437863 | 3300013297 | Miscanthus Rhizosphere | MVIAQQLIDASKDGGAAFIAFSIMVSLFTGSLFYMDHVRRRREERQK* |
Ga0120127_100633872 | 3300013503 | Permafrost | MLIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRIRRKREEGGK* |
Ga0120158_102245312 | 3300013772 | Permafrost | MILAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0120158_103506162 | 3300013772 | Permafrost | MIIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRV |
Ga0120135_10691852 | 3300014054 | Permafrost | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN* |
Ga0075355_10186823 | 3300014322 | Natural And Restored Wetlands | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDHIRRKREERGK* |
Ga0182008_105872491 | 3300014497 | Rhizosphere | MIVAQQLIDASKDGGAAFVAMCVMIFLFVGSLFYMDKIRRRREERDEQQRH* |
Ga0182019_109018272 | 3300014498 | Fen | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRQKREEREK* |
Ga0182024_1000118337 | 3300014501 | Permafrost | MVLAQQLIDASKEGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDDRGR* |
Ga0157377_117033111 | 3300014745 | Miscanthus Rhizosphere | ARRLGGPVYLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0120104_10957381 | 3300014829 | Permafrost | TKMILAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREERDQ* |
Ga0167648_10040964 | 3300015171 | Glacier Forefield Soil | MIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREERDN* |
Ga0163144_103885422 | 3300015360 | Freshwater Microbial Mat | MIAQQLIDASEQGGEAFLAFAIMVFLFAGSLFYMDHVRRRNEERRDRNE* |
Ga0132258_111543541 | 3300015371 | Arabidopsis Rhizosphere | MIVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN* |
Ga0132258_122133051 | 3300015371 | Arabidopsis Rhizosphere | MTVAQQLIDASEDGGLAFLVFAIMVFLFTASLFYMDRIRRRREERARNEP* |
Ga0132258_123869212 | 3300015371 | Arabidopsis Rhizosphere | MVLAQQLIDASKDGGAAFISFAVMVFLFTGSLFYMDKIRRRRQQRDEQRHD* |
Ga0132256_1019358842 | 3300015372 | Arabidopsis Rhizosphere | MFVAQQMIDASKQGGEAFLAFAIMVFLFAGSLFYMDRVRRRREERDRDEN* |
Ga0132257_1010926272 | 3300015373 | Arabidopsis Rhizosphere | MTVAQQLIDASEDGGLAFLVFAIMVFLFTASLFYMDRIRRRR |
Ga0132257_1035691982 | 3300015373 | Arabidopsis Rhizosphere | VLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN* |
Ga0132257_1037426341 | 3300015373 | Arabidopsis Rhizosphere | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDKVRRRREE* |
Ga0132257_1037426343 | 3300015373 | Arabidopsis Rhizosphere | MIVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRR |
Ga0132255_1026438612 | 3300015374 | Arabidopsis Rhizosphere | VLAQQLIDASKDGGAAFIAFSVMVFLFTASLFYMDRIRRRREERDRNEP* |
Ga0182033_116757542 | 3300016319 | Soil | LAQQLIDASKDGGAAFIAFAVMVFLFAGSLFYMDHIRKKREERDEPRNE |
Ga0182040_109058692 | 3300016387 | Soil | MIIAQQLIDASKDGGAAFIAFACMVFLFTGSLFYMDHIRR |
Ga0187775_103200662 | 3300017939 | Tropical Peatland | MLLAQQLIDASKDGGAAFIAFAIMCFLFVGSLFYMDHVRRKREDR |
Ga0187775_104548701 | 3300017939 | Tropical Peatland | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQGR |
Ga0187786_103120942 | 3300017944 | Tropical Peatland | VVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQGR |
Ga0187779_101856352 | 3300017959 | Tropical Peatland | MVIAQQLIDASKDGGAAFVAFATMCFLFAGSLFYMDKVRRRRAERDEKNRPD |
Ga0187779_101967952 | 3300017959 | Tropical Peatland | MVIAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQGR |
Ga0187779_102857181 | 3300017959 | Tropical Peatland | LAQQLIDASKDGGAAFIAFATMCFLFAGSLFYMDKIRRRRQERDDASRD |
Ga0187779_103216272 | 3300017959 | Tropical Peatland | MVLAQQLIDASKDGGAAFIAFATMVFLFTGSLFYMDHIRRKREERDQPKQ |
Ga0187779_104740452 | 3300017959 | Tropical Peatland | MIAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRE |
Ga0187779_108820602 | 3300017959 | Tropical Peatland | MILAQQLIDASKDGGAAFIAFAVMVFLFTGSLFYMDKIRRRREERDDKPRD |
Ga0187779_109833352 | 3300017959 | Tropical Peatland | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREE |
Ga0187779_109942152 | 3300017959 | Tropical Peatland | MALAQQLIDASKDGGAAFIAFSVMCFLFAGSLFYMDKIRRRRQERDDASRN |
Ga0187779_110907642 | 3300017959 | Tropical Peatland | MLAQQLIDASKDGGAAFVAFAVMVFLFTGSLFYMDKIRRRREERDDKPRD |
Ga0187776_111331072 | 3300017966 | Tropical Peatland | MLVAQQLIDASKDGAAAFIAFAVMVFLFTGSLFYMDHVRRRREKQ |
Ga0187780_114122922 | 3300017973 | Tropical Peatland | MVVAQQLVDASKNGGLAFLLFAIMCMLFMASLFYMDHIRKRKEEQSGRR |
Ga0187777_100391293 | 3300017974 | Tropical Peatland | MVIAQQLIDASKDGGAAFVAFATMCFLFAGSLFYMDKVRRRRAERDEKNRPN |
Ga0187777_108052572 | 3300017974 | Tropical Peatland | MLVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQSR |
Ga0187777_114042691 | 3300017974 | Tropical Peatland | DASKDGGAAFIAFATMVFLFTGSLFYMDHIRRKREERDQPKQ |
Ga0187767_103020612 | 3300017999 | Tropical Peatland | MVVAQQLIDASKDGGAAFIAFATMVFLFAGSLFYMDKIRRRREERDDKPRD |
Ga0187767_103668732 | 3300017999 | Tropical Peatland | VVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDDSRR |
Ga0187787_101063852 | 3300018029 | Tropical Peatland | MTLLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMDHIRKRREEQKR |
Ga0187787_103737302 | 3300018029 | Tropical Peatland | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQG |
Ga0187787_104340292 | 3300018029 | Tropical Peatland | MMLAQQLIDASKDGGAAFIAFAVMCFLFVGSLFYMDHVRRKREERDES |
Ga0187766_108504591 | 3300018058 | Tropical Peatland | MVIAQQLIDASKDGGAAFLAFAIMVFLFAGSLFFMDRVRRRREDQQR |
Ga0187765_100739711 | 3300018060 | Tropical Peatland | IDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQGR |
Ga0187765_112812362 | 3300018060 | Tropical Peatland | MFIAQQLIDASKDGGAAFIAFSVMVFLFAGSLFYMDKVRRRREDQSR |
Ga0187765_113264651 | 3300018060 | Tropical Peatland | MLAQQLIDATTSGGLAFLAFAIMCMLFMASLFYMDHIRRKREQERGRE |
Ga0190265_122343762 | 3300018422 | Soil | MQFAQQWIDASEQGGAAFLAFAIMCMLFVASLFYMDHIRRRREEKQNR |
Ga0190265_127725492 | 3300018422 | Soil | MHLFAQQWIDASDQGGAAFLAFAIMCMLFVASLFYMDHIRRRREDDK |
Ga0190272_107528722 | 3300018429 | Soil | MFLAQQLIDASKDGGAAFLAFAIMVFLFTGSLFYMDHVRRKHEDRNN |
Ga0190271_109989692 | 3300018481 | Soil | MHLAQQWIDASEQGGAAFLAFAIMCMLFMASLFYMDHIRRRREDDSK |
Ga0190271_114692972 | 3300018481 | Soil | MTVAQQLIDASEDGGLAFLVFAIMVFLFAGSLFYMDRIRRRREERDRNEP |
Ga0066669_102023001 | 3300018482 | Grasslands Soil | MILAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN |
Ga0066669_102592782 | 3300018482 | Grasslands Soil | MVVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDHIRRRREDRQNR |
Ga0066669_123889302 | 3300018482 | Grasslands Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGALIYVDRVRRRREERDD |
Ga0173481_107126881 | 3300019356 | Soil | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEREN |
Ga0182025_11521322 | 3300019786 | Permafrost | MVLAQQLIDASKEGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDDRGR |
Ga0163151_101390092 | 3300020057 | Freshwater Microbial Mat | MIAQQLIDASEQGGEAFLAFAIMVFLFAGSLFYMDHVRRRNEERRDRNE |
Ga0210384_107790952 | 3300021432 | Soil | MVVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQGR |
Ga0210402_112254552 | 3300021478 | Soil | MMLLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMDHIRKRREEQNR |
Ga0210410_106269372 | 3300021479 | Soil | MVVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQGR |
Ga0224712_103521652 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MMIAQQLIDASKDGGAAFIAFSIMVFMFTGSLFYMDRIRQKRED |
Ga0224712_106368642 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRQKREDRNK |
Ga0179591_10184463 | 3300024347 | Vadose Zone Soil | MMLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN |
Ga0255194_10392741 | 3300024494 | Freshwater | VVLAQQLIDASKDGAAAFVAFAVMVFLFTGSLFFMDYIRRRRGED |
Ga0209172_100331382 | 3300025310 | Hot Spring Sediment | MLAQQLIDASEEGGLAFLAFAIMVFLFAGSLFYMDRVRRRAEERRGRNE |
Ga0209640_110640471 | 3300025324 | Soil | VNRVLAQQLIDASHDGDIAFIAFSIMCILFVGFLFAMDKVRRRGE |
Ga0208783_100020762 | 3300025872 | Aqueous | VVIAQQLIDASKDGAAAFVAFAVMVFLFTGSLFYMDYIRRRRGED |
Ga0208783_100039336 | 3300025872 | Aqueous | VVLAQQLIDASKDGAAAFVAFAVMVFLFTGSLFYMDYIRRRRGED |
Ga0208783_101204372 | 3300025872 | Aqueous | VVLAQQLIDASKDGGAAFLGMVIMIVLFMLSLFYMDRIRRRREEQRGG |
Ga0207653_101498852 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDE |
Ga0207707_115834101 | 3300025912 | Corn Rhizosphere | VVIAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRR |
Ga0207695_110526342 | 3300025913 | Corn Rhizosphere | MMIAQQLIDASKDGGAAFIAFSIMVFMFTGSLFYMDRIRQKREDRHK |
Ga0207663_111018142 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRKREEKSDS |
Ga0207662_107951392 | 3300025918 | Switchgrass Rhizosphere | MYLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDE |
Ga0207652_106530112 | 3300025921 | Corn Rhizosphere | MIIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRQRREDSDKK |
Ga0207700_111311562 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREDRDN |
Ga0207709_104582122 | 3300025935 | Miscanthus Rhizosphere | MFLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRRDE |
Ga0207669_117685322 | 3300025937 | Miscanthus Rhizosphere | VLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREE |
Ga0207665_106801032 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRRREERDD |
Ga0207665_110605382 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MFLAQQLIDAGQDGGAAFLAFAIMVFLFVGSLFYMDHIRKRREEQNR |
Ga0207665_116148142 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLAQQLIDASKDGGAAFIAFSVMVFLFTGSLFYMDRVRRKRQERDDSRRDH |
Ga0207689_110131512 | 3300025942 | Miscanthus Rhizosphere | VYLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEREN |
Ga0207661_116677541 | 3300025944 | Corn Rhizosphere | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREE |
Ga0207712_101674692 | 3300025961 | Switchgrass Rhizosphere | MTVAQQLIDASEDGGLAFLVFAIMVFLFTASLFYMDRIRRRREERDRNEP |
Ga0207702_116506951 | 3300026078 | Corn Rhizosphere | MIVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDEQN |
Ga0207702_118639872 | 3300026078 | Corn Rhizosphere | MIIAQQLIDASKDGGAAFVAMCVMIFLFVGSLFYMDKIRRRREERDEQQRH |
Ga0207648_118017562 | 3300026089 | Miscanthus Rhizosphere | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN |
Ga0207676_118634682 | 3300026095 | Switchgrass Rhizosphere | MMLAQQLIDASKDGGAAFIAFAVMCFLFVGSLFYMDHVRRKREERD |
Ga0207683_118782122 | 3300026121 | Miscanthus Rhizosphere | VYLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREERE |
Ga0209577_108313992 | 3300026552 | Soil | MVLAQQLIDASKDGGAAFVAMAVMCALFVGSLFYMDKVRRKREERRGR |
Ga0207723_1160932 | 3300026824 | Tropical Forest Soil | MLAQQLIDASKDGGAAFIAFATMVFLFAGSLFYMDHIRRKREDRPRE |
Ga0209517_102543961 | 3300027854 | Peatlands Soil | MVLAQQLIDASKDGGAAFLSFAIMVFLFAGSLFYMDKVRRRREGQGR |
Ga0209068_100025301 | 3300027894 | Watersheds | VVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREGR |
Ga0209068_103201562 | 3300027894 | Watersheds | MFLAQQLIDAGKDGGAAFLAFAIMVFLFVGSLFYMDHIRKRREDQNK |
Ga0209068_108857882 | 3300027894 | Watersheds | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRKREEKSDS |
Ga0209069_100941342 | 3300027915 | Watersheds | MVIAQQLIDASKDGGAAFISFSIMVFLFAGSLFYMDRVRRRREERGK |
Ga0209069_105335752 | 3300027915 | Watersheds | VVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRKREEQGR |
Ga0268266_109388302 | 3300028379 | Switchgrass Rhizosphere | MLIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRQRREDSDKK |
Ga0268265_119528322 | 3300028380 | Switchgrass Rhizosphere | VYLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDRQN |
Ga0265337_12055662 | 3300028556 | Rhizosphere | MIIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRIRQKREDRNK |
Ga0265334_102112681 | 3300028573 | Rhizosphere | RMVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQNR |
Ga0265318_101864761 | 3300028577 | Rhizosphere | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQR |
Ga0247828_105067231 | 3300028587 | Soil | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDK |
Ga0247823_106934582 | 3300028590 | Soil | MVLAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRIRRKREE |
Ga0302160_100991002 | 3300028665 | Fen | MLLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMDHI |
Ga0307284_103983181 | 3300028799 | Soil | HPSRLRANRRKTTMVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRVRRRREERDN |
Ga0307284_104100232 | 3300028799 | Soil | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDRVRRRREDQQN |
Ga0265338_1000040445 | 3300028800 | Rhizosphere | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQNR |
Ga0265338_105187752 | 3300028800 | Rhizosphere | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDKVRRKREEK |
Ga0247824_107575971 | 3300028809 | Soil | MVLAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDRIRRKREERDQPK |
Ga0307277_100862022 | 3300028881 | Soil | MVLAQQLIDASKDGGAAFVAMAVMCFLFVASLFYMDKVRRRREEQRGRGR |
Ga0311347_107644481 | 3300029923 | Fen | MLLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMD |
Ga0311332_101279622 | 3300029984 | Fen | MLLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMDHIRKRREEQNR |
Ga0311334_103339872 | 3300029987 | Fen | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDHIRRKREERGK |
Ga0311350_106074733 | 3300030002 | Fen | MLLAQQLIDASKDGGASFLSFAIMVFLFVGSLFYMDHIRKRREEQNR |
Ga0311333_110341522 | 3300030114 | Fen | MIIAQQLIDASKDGGAAFIAFSIMVFLFVGSLFYMDRIRRKREEQRDS |
Ga0307499_101771782 | 3300031184 | Soil | MFVAQQLIDASRQGGEAFLAFAIMVFLFTGSLFYMDRVRKRREERDRNEP |
Ga0299914_106267191 | 3300031228 | Soil | MVVAQQLIDASEEGGLAFLAFAIMVFMFTGSLFYMDRIRRRREEQR |
Ga0299914_114324172 | 3300031228 | Soil | MTLAQQLIDASEQGGEAFLAFAIMVFLFTASLFYMDRIRRRREERRRDEP |
Ga0302323_1022129422 | 3300031232 | Fen | MVIAQQLIDASKDGGAAFIAFSIMVFLFTGSLFYMDHIRRKREER |
Ga0265332_100794192 | 3300031238 | Rhizosphere | MIIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDHVRQKREDRHNKK |
Ga0265340_102679902 | 3300031247 | Rhizosphere | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQGC |
Ga0265339_104032461 | 3300031249 | Rhizosphere | MILAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRDREDRRH |
Ga0265316_104619942 | 3300031344 | Rhizosphere | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRQKREDRGNKK |
Ga0318516_101618452 | 3300031543 | Soil | MVLAQQLIDASKDGGAAFIAFAVMVFLFAGSLFYMDHIRKKREERDEPRNE |
Ga0318534_106564902 | 3300031544 | Soil | MIIAQQLIDASKDGGAAFIAFACMVFLFTGSLFYMDHIRRKREERDQPRND |
Ga0318555_106643612 | 3300031640 | Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDHVRRRREERDR |
Ga0310813_108251042 | 3300031716 | Soil | MIIAQQLIDASKDGGAAFVAMCVMIFLFVGSLFYMDKI |
Ga0310813_119556772 | 3300031716 | Soil | MIVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDQQN |
Ga0307405_108858232 | 3300031731 | Rhizosphere | MLIAQQLIDASEQGGEAFIAMVVMIVLFVASLFYMDKVRRKREERDRT |
Ga0318546_110991212 | 3300031771 | Soil | MVLAQQLIDASKDGGAAFIAFAIMCMLFMASLFYMDRVRRKHEDRDDQRH |
Ga0318497_105181162 | 3300031805 | Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMD |
Ga0318497_108349882 | 3300031805 | Soil | MLAQQLIDASKDGAAAFIAFAVMVFLFTGSLFYMDRVRRRRQDK |
Ga0308411_100211813 | 3300031812 | Hot Spring Phototrophic Mat | MVLAQQLIDASEDGGLAFLVFAIMVFCFTASLFYMDRVRQRRVEREEQRDRGH |
Ga0307413_104850832 | 3300031824 | Rhizosphere | MVLAQQLIDASKDGGAAFIAMCIMIFLFVGSLFYMDKIRRSREERDEQSKN |
Ga0310907_101564642 | 3300031847 | Soil | MTLAQQLIDASEQGGEAFLAFAIMVFLFAGSLFYMDKVRRRREE |
Ga0318536_107063102 | 3300031893 | Soil | MLAQQLIDASKDGGAAFIAFATMCFLFAGSLFYMDKIRRRREERDKPRD |
Ga0307406_102641862 | 3300031901 | Rhizosphere | MSLVAQQWIDASEQGGAAFLAFAIMCMLFVASLFYMDHIRQKREDQNR |
Ga0302322_1038639911 | 3300031902 | Fen | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMD |
Ga0310900_106388502 | 3300031908 | Soil | MLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREERQN |
Ga0310900_109377342 | 3300031908 | Soil | MTLAQQLIDASEQGGEAFLAFAIMVFLFAGSLFYMDRIRRKREERDEQTQD |
Ga0306923_118510042 | 3300031910 | Soil | MLIAQQLIDASKDGGAAFIAFAIMCFLFVGSLFYMDHVRRKRDEK |
Ga0306921_108996832 | 3300031912 | Soil | GGDPMVLAQQLIDASKDGGAAFIAFAVMVFLFAGSLFYMDHIRKKREERDEPRNE |
Ga0308175_1015125612 | 3300031938 | Soil | MVLAQQLIDASKDGGAAFIAFAVMVFLFAGSLFYMDHIRRTRQEKAEQKERDRHN |
Ga0306922_107592172 | 3300032001 | Soil | MVLAQQLIDASKDGGAAFIAFATMCFLFAGSLFYMDKVRRRRQERDD |
Ga0310906_107398211 | 3300032013 | Soil | RLRLGELMLLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREERQN |
Ga0310906_112249052 | 3300032013 | Soil | MTLAQQLIDASEQGGEAFLAFAIMVFLFAGSLFYMDRIRRKREERDEQT |
Ga0318556_107553641 | 3300032043 | Soil | MVLAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREERDK |
Ga0311301_109729392 | 3300032160 | Peatlands Soil | MLVAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREERGH |
Ga0306920_1007294892 | 3300032261 | Soil | MVLAQQLIDASKDGGAAFIAFATMCFLFAGSLFYMDKVRRRRQERDDSTRN |
Ga0335085_100061328 | 3300032770 | Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREERGDNK |
Ga0335085_100109244 | 3300032770 | Soil | MVVAQQLIDASKDGGAAFIAFSVMVFLFAGSLFYMDRVRRKREERDR |
Ga0335085_120992171 | 3300032770 | Soil | VVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRRRREERDR |
Ga0335079_108070012 | 3300032783 | Soil | MVIAQQLVDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQGR |
Ga0335080_118344512 | 3300032828 | Soil | MVIAQQLIDASKDGGAAFIAFSVMVFLFAGSLFYMDRIRRKRDERNR |
Ga0335070_119360531 | 3300032829 | Soil | MVLAQQLIDASKDGGAAFLSFAIMVFLFVGSLFYMD |
Ga0335071_105971202 | 3300032897 | Soil | MFLAQQLIDASKDGGAAFIAFAVMVFLFAGSLFYMDKVRRRREERDDKPRD |
Ga0335084_103132202 | 3300033004 | Soil | MLIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFFMDRVRRRREERER |
Ga0310914_101900701 | 3300033289 | Soil | VLAQQLIDASKDGGAAFIAFAVMVFLFAGSLFYMDHIRKKREERDEPRNE |
Ga0310810_104712432 | 3300033412 | Soil | MILAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREDEQH |
Ga0247830_107374612 | 3300033551 | Soil | MVLAQQLIDASKDGGAAFIAFSIMVFLFTASLFYMDRIRRKREERDQPKN |
Ga0370479_0106966_569_715 | 3300034123 | Untreated Peat Soil | MLLGQQLIDASKDGGAAFIAFSIMVFLFTASLFYMDRVRRKREEKSDS |
Ga0370484_0129917_489_632 | 3300034125 | Untreated Peat Soil | MVLAQQLIDASKDGGAAFLAFAIMVFLFAGSLFYMDKVRRRREEQNR |
Ga0364931_0172991_3_122 | 3300034176 | Sediment | MLAQQLIDATEQGGEAFIAMTVMVVIFALTLFMMDRIRRR |
Ga0372943_0724583_5_151 | 3300034268 | Soil | MVIAQQLIDASKDGGAAFIAFSIMVFLFAGSLFYMDRVRQRREDSEKK |
⦗Top⦘ |