NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F007863

Metagenome / Metatranscriptome Family F007863

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F007863
Family Type Metagenome / Metatranscriptome
Number of Sequences 343
Average Sequence Length 178 residues
Representative Sequence DEDLGEDIIMKGEPFHYNQKRPAAKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPAAHKLFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Number of Associated Samples 211
Number of Associated Scaffolds 343

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.59 %
% of genes near scaffold ends (potentially truncated) 81.05 %
% of genes from short scaffolds (< 2000 bps) 91.25 %
Associated GOLD sequencing projects 194
AlphaFold2 3D model prediction Yes
3D model pTM-score0.24

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (91.254 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(48.396 % of family members)
Environment Ontology (ENVO) Unclassified
(77.551 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.633 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Mixed Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 17.30%    Coil/Unstructured: 82.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.24
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 343 Family Scaffolds
PF01400Astacin 0.29


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.25 %
UnclassifiedrootN/A8.75 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005516|Ga0066831_10223788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300006378|Ga0075498_1319858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani655Open in IMG/M
3300007513|Ga0105019_1087343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1729Open in IMG/M
3300007554|Ga0102820_1166606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300007863|Ga0105744_1065319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani897Open in IMG/M
3300007864|Ga0105749_1057153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani798Open in IMG/M
3300007958|Ga0105743_1010408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani823Open in IMG/M
3300008791|Ga0103696_1022265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300008791|Ga0103696_1037211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani532Open in IMG/M
3300008832|Ga0103951_10223710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani931Open in IMG/M
3300008835|Ga0103883_1023599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300008929|Ga0103732_1026945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani843Open in IMG/M
3300008933|Ga0103736_1043381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300008937|Ga0103740_1003647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1392Open in IMG/M
3300008993|Ga0104258_1063240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300009022|Ga0103706_10199129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300009172|Ga0114995_10572732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300009268|Ga0103874_1011287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani705Open in IMG/M
3300009402|Ga0103742_1039538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300009422|Ga0114998_10210458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300009496|Ga0115570_10107439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1354Open in IMG/M
3300009497|Ga0115569_10451566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300009592|Ga0115101_1278633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300009592|Ga0115101_1341520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1092Open in IMG/M
3300009599|Ga0115103_1613376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani866Open in IMG/M
3300009608|Ga0115100_11248075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300009679|Ga0115105_10128624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani732Open in IMG/M
3300009679|Ga0115105_10174488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani778Open in IMG/M
3300009679|Ga0115105_10533094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300009679|Ga0115105_10779213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300009679|Ga0115105_11322518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani792Open in IMG/M
3300010883|Ga0133547_12077337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1037Open in IMG/M
3300010981|Ga0138316_10133621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300010981|Ga0138316_10587093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani844Open in IMG/M
3300010981|Ga0138316_11268091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300010985|Ga0138326_10820266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani748Open in IMG/M
3300010985|Ga0138326_12122733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300010987|Ga0138324_10007446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2583Open in IMG/M
3300010987|Ga0138324_10394326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani676Open in IMG/M
3300010987|Ga0138324_10424096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300010987|Ga0138324_10483329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300010987|Ga0138324_10518780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300010987|Ga0138324_10568341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani565Open in IMG/M
3300010987|Ga0138324_10617065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300010987|Ga0138324_10661125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300010987|Ga0138324_10709328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300012413|Ga0138258_1216121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani909Open in IMG/M
3300012413|Ga0138258_1300417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani796Open in IMG/M
3300012415|Ga0138263_1149949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani966Open in IMG/M
3300012416|Ga0138259_1608324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani754Open in IMG/M
3300012518|Ga0129349_1442276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani692Open in IMG/M
3300012523|Ga0129350_1210858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani942Open in IMG/M
3300012528|Ga0129352_10836450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300012954|Ga0163111_12031506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani579Open in IMG/M
3300017719|Ga0181390_1136670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani628Open in IMG/M
3300017748|Ga0181393_1112189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani696Open in IMG/M
3300017751|Ga0187219_1143197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300017767|Ga0181406_1175291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300017769|Ga0187221_1095159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani914Open in IMG/M
3300017770|Ga0187217_1149313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300017772|Ga0181430_1171210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300017782|Ga0181380_1253665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300017783|Ga0181379_1126450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani922Open in IMG/M
3300017783|Ga0181379_1143337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani855Open in IMG/M
3300018596|Ga0193060_1012123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300018597|Ga0193035_1022377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani534Open in IMG/M
3300018628|Ga0193355_1011799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300018628|Ga0193355_1015507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani704Open in IMG/M
3300018649|Ga0192969_1053081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani551Open in IMG/M
3300018674|Ga0193166_1023857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300018674|Ga0193166_1026046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani550Open in IMG/M
3300018684|Ga0192983_1005284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1376Open in IMG/M
3300018684|Ga0192983_1006475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1300Open in IMG/M
3300018684|Ga0192983_1014814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani994Open in IMG/M
3300018692|Ga0192944_1018256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani973Open in IMG/M
3300018692|Ga0192944_1021783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani905Open in IMG/M
3300018692|Ga0192944_1030066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300018730|Ga0192967_1018986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1078Open in IMG/M
3300018730|Ga0192967_1050650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300018742|Ga0193138_1040839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300018742|Ga0193138_1043763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300018746|Ga0193468_1040270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani685Open in IMG/M
3300018763|Ga0192827_1034967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani868Open in IMG/M
3300018765|Ga0193031_1028449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani868Open in IMG/M
3300018765|Ga0193031_1032514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani827Open in IMG/M
3300018765|Ga0193031_1043584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300018765|Ga0193031_1053231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani676Open in IMG/M
3300018765|Ga0193031_1084659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300018765|Ga0193031_1092982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300018766|Ga0193181_1047844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani625Open in IMG/M
3300018776|Ga0193407_1040208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300018779|Ga0193149_1037720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300018780|Ga0193472_1025213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300018782|Ga0192832_1040451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300018782|Ga0192832_1053237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300018787|Ga0193124_1035206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300018791|Ga0192950_1041706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani669Open in IMG/M
3300018791|Ga0192950_1043000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani660Open in IMG/M
3300018801|Ga0192824_1107999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300018812|Ga0192829_1102831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300018813|Ga0192872_1092354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300018830|Ga0193191_1056568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300018830|Ga0193191_1062701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300018830|Ga0193191_1078785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani529Open in IMG/M
3300018831|Ga0192949_1066227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani718Open in IMG/M
3300018836|Ga0192870_1063512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300018838|Ga0193302_1049851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani711Open in IMG/M
3300018838|Ga0193302_1080449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300018838|Ga0193302_1083642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300018858|Ga0193413_1072380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300018860|Ga0193192_1029363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300018862|Ga0193308_1046052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani716Open in IMG/M
3300018862|Ga0193308_1067077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300018862|Ga0193308_1086801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300018870|Ga0193533_1099436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300018905|Ga0193028_1067051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300018905|Ga0193028_1121084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300018913|Ga0192868_10057264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300018913|Ga0192868_10076939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300018926|Ga0192989_10154253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani554Open in IMG/M
3300018948|Ga0192985_1162258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300018955|Ga0193379_10109190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani785Open in IMG/M
3300018967|Ga0193178_10038074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300018974|Ga0192873_10170500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani953Open in IMG/M
3300018974|Ga0192873_10266682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani738Open in IMG/M
3300018977|Ga0193353_10227808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300018977|Ga0193353_10241835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300018980|Ga0192961_10165124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani672Open in IMG/M
3300018981|Ga0192968_10157118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300018982|Ga0192947_10127482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani849Open in IMG/M
3300018982|Ga0192947_10207983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300018982|Ga0192947_10227910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani606Open in IMG/M
3300018982|Ga0192947_10296584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani507Open in IMG/M
3300018989|Ga0193030_10060663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1055Open in IMG/M
3300018989|Ga0193030_10115540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani841Open in IMG/M
3300018989|Ga0193030_10138024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani781Open in IMG/M
3300018989|Ga0193030_10303194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300018997|Ga0193257_10140703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani741Open in IMG/M
3300019001|Ga0193034_10102989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300019001|Ga0193034_10121413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300019001|Ga0193034_10123971All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300019001|Ga0193034_10185461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300019003|Ga0193033_10127245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani742Open in IMG/M
3300019003|Ga0193033_10131929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani726Open in IMG/M
3300019003|Ga0193033_10171068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300019017|Ga0193569_10254763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300019017|Ga0193569_10280892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani699Open in IMG/M
3300019020|Ga0193538_10169698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani764Open in IMG/M
3300019022|Ga0192951_10157584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani805Open in IMG/M
3300019025|Ga0193545_10056459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani814Open in IMG/M
3300019025|Ga0193545_10090617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani645Open in IMG/M
3300019027|Ga0192909_10286853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani516Open in IMG/M
3300019031|Ga0193516_10292966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300019032|Ga0192869_10167603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani916Open in IMG/M
3300019032|Ga0192869_10431260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300019033|Ga0193037_10156154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani751Open in IMG/M
3300019033|Ga0193037_10160430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300019033|Ga0193037_10264764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani599Open in IMG/M
3300019036|Ga0192945_10117910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani844Open in IMG/M
3300019036|Ga0192945_10137612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300019037|Ga0192886_10214525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani622Open in IMG/M
3300019039|Ga0193123_10302797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300019045|Ga0193336_10150030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani868Open in IMG/M
3300019045|Ga0193336_10190385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani812Open in IMG/M
3300019045|Ga0193336_10237792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300019045|Ga0193336_10254546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani744Open in IMG/M
3300019045|Ga0193336_10275920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani725Open in IMG/M
3300019045|Ga0193336_10286683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani716Open in IMG/M
3300019045|Ga0193336_10309026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani699Open in IMG/M
3300019045|Ga0193336_10468040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300019048|Ga0192981_10098240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1142Open in IMG/M
3300019048|Ga0192981_10254145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300019050|Ga0192966_10128462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani889Open in IMG/M
3300019050|Ga0192966_10322915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani540Open in IMG/M
3300019051|Ga0192826_10147939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani863Open in IMG/M
3300019051|Ga0192826_10192849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani753Open in IMG/M
3300019051|Ga0192826_10220814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300019051|Ga0192826_10223255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300019051|Ga0192826_10228281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300019051|Ga0192826_10260107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani638Open in IMG/M
3300019051|Ga0192826_10278673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300019095|Ga0188866_1027073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300019102|Ga0194243_1004827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani679Open in IMG/M
3300019103|Ga0192946_1019309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1007Open in IMG/M
3300019103|Ga0192946_1033409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani776Open in IMG/M
3300019108|Ga0192972_1057609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani739Open in IMG/M
3300019116|Ga0193243_1053798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300019117|Ga0193054_1032519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani779Open in IMG/M
3300019117|Ga0193054_1048638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300019117|Ga0193054_1053504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300019117|Ga0193054_1065936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300019118|Ga0193157_1014733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani767Open in IMG/M
3300019118|Ga0193157_1027542Not Available589Open in IMG/M
3300019118|Ga0193157_1032412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300019123|Ga0192980_1036541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani941Open in IMG/M
3300019123|Ga0192980_1051583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani784Open in IMG/M
3300019125|Ga0193104_1021082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani868Open in IMG/M
3300019125|Ga0193104_1032492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300019125|Ga0193104_1051703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300019125|Ga0193104_1052055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani571Open in IMG/M
3300019125|Ga0193104_1063026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani513Open in IMG/M
3300019139|Ga0193047_1087775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300020382|Ga0211686_10199586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani825Open in IMG/M
3300020382|Ga0211686_10350306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300021342|Ga0206691_1396906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300021345|Ga0206688_10420903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani603Open in IMG/M
3300021348|Ga0206695_1420894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani976Open in IMG/M
3300021350|Ga0206692_1485862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300021350|Ga0206692_1880566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300021353|Ga0206693_1907453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani617Open in IMG/M
3300021359|Ga0206689_10358640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani504Open in IMG/M
3300021365|Ga0206123_10270566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani732Open in IMG/M
3300021868|Ga0063111_113082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani732Open in IMG/M
3300021872|Ga0063132_113591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300021872|Ga0063132_117900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani832Open in IMG/M
3300021872|Ga0063132_117901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani782Open in IMG/M
3300021881|Ga0063117_1011236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani750Open in IMG/M
3300021890|Ga0063090_1063487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300021894|Ga0063099_1029863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani804Open in IMG/M
3300021902|Ga0063086_1037304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300021902|Ga0063086_1075184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300021908|Ga0063135_1045112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1314Open in IMG/M
3300021912|Ga0063133_1007799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani537Open in IMG/M
3300021927|Ga0063103_1095560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani725Open in IMG/M
3300021928|Ga0063134_1094386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300021934|Ga0063139_1094702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani662Open in IMG/M
3300022074|Ga0224906_1187896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300023555|Ga0232120_107083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300023555|Ga0232120_108805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300023566|Ga0228679_1019226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani702Open in IMG/M
3300023695|Ga0228680_1020576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300025849|Ga0209603_1149136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani954Open in IMG/M
3300026403|Ga0247557_1022556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani714Open in IMG/M
3300026420|Ga0247581_1032304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani817Open in IMG/M
3300026443|Ga0247559_1104160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300026458|Ga0247578_1054740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani766Open in IMG/M
3300026471|Ga0247602_1088063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani813Open in IMG/M
3300026495|Ga0247571_1134413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300026503|Ga0247605_1129480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300028102|Ga0247586_1094924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani559Open in IMG/M
3300028106|Ga0247596_1106717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300028109|Ga0247582_1063257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani969Open in IMG/M
3300028110|Ga0247584_1153837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300028137|Ga0256412_1164221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani820Open in IMG/M
3300028137|Ga0256412_1260707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300028137|Ga0256412_1282291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300028137|Ga0256412_1307473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani583Open in IMG/M
3300028137|Ga0256412_1334769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300028233|Ga0256417_1138087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani656Open in IMG/M
3300028282|Ga0256413_1245797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani636Open in IMG/M
3300028335|Ga0247566_1041413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani761Open in IMG/M
3300028575|Ga0304731_10201979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani844Open in IMG/M
3300028575|Ga0304731_11184708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300028575|Ga0304731_11511095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani555Open in IMG/M
3300030670|Ga0307401_10435852All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani596Open in IMG/M
3300030670|Ga0307401_10436826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani595Open in IMG/M
3300030671|Ga0307403_10153487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1174Open in IMG/M
3300030671|Ga0307403_10570711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300030699|Ga0307398_10139355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1240Open in IMG/M
3300030699|Ga0307398_10542759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani642Open in IMG/M
3300030715|Ga0308127_1017721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani861Open in IMG/M
3300030715|Ga0308127_1033856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300030723|Ga0308129_1015162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani829Open in IMG/M
3300030725|Ga0308128_1030173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani643Open in IMG/M
3300030780|Ga0073988_10035612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani616Open in IMG/M
3300030780|Ga0073988_12361099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani541Open in IMG/M
3300030780|Ga0073988_12369550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300030781|Ga0073982_10000308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300030781|Ga0073982_11709034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani575Open in IMG/M
3300030856|Ga0073990_12015924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani582Open in IMG/M
3300030856|Ga0073990_12026374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300030856|Ga0073990_12052896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani563Open in IMG/M
3300030857|Ga0073981_11720772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani798Open in IMG/M
3300030912|Ga0073987_11175170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300030912|Ga0073987_11191362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani526Open in IMG/M
3300030912|Ga0073987_11205207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani601Open in IMG/M
3300030956|Ga0073944_11350630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani688Open in IMG/M
3300031004|Ga0073984_11259757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300031032|Ga0073980_10000608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300031038|Ga0073986_12039074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani764Open in IMG/M
3300031062|Ga0073989_10013772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani641Open in IMG/M
3300031062|Ga0073989_10015776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani527Open in IMG/M
3300031062|Ga0073989_13581934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani515Open in IMG/M
3300031062|Ga0073989_13591481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300031062|Ga0073989_13592371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani715Open in IMG/M
3300031522|Ga0307388_10200548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1207Open in IMG/M
3300031522|Ga0307388_10887958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani600Open in IMG/M
3300031540|Ga0308143_115928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani753Open in IMG/M
3300031540|Ga0308143_121325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300031542|Ga0308149_1043597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani564Open in IMG/M
3300031579|Ga0308134_1116224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani613Open in IMG/M
3300031589|Ga0307996_1105916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani745Open in IMG/M
3300031594|Ga0302131_1124231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani885Open in IMG/M
3300031621|Ga0302114_10144811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1049Open in IMG/M
3300031637|Ga0302138_10246942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani584Open in IMG/M
3300031700|Ga0302130_1233127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani556Open in IMG/M
3300031710|Ga0307386_10277519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani835Open in IMG/M
3300031725|Ga0307381_10244749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani635Open in IMG/M
3300031735|Ga0307394_10074314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1249Open in IMG/M
3300031738|Ga0307384_10488171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani581Open in IMG/M
3300031739|Ga0307383_10247190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani852Open in IMG/M
3300031742|Ga0307395_10203867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani842Open in IMG/M
3300031742|Ga0307395_10522293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300031743|Ga0307382_10296029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300031752|Ga0307404_10403476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300032047|Ga0315330_10429218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani810Open in IMG/M
3300032491|Ga0314675_10600389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300032707|Ga0314687_10693610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300032713|Ga0314690_10494911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300032727|Ga0314693_10787709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani508Open in IMG/M
3300032747|Ga0314712_10389440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300032749|Ga0314691_10393050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani576Open in IMG/M
3300032750|Ga0314708_10390084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani680Open in IMG/M
3300032754|Ga0314692_10569022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine48.40%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine25.66%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.87%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.21%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.62%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.33%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous1.46%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.46%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.17%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.17%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.87%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.58%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.29%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.29%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.29%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.29%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.29%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.29%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.29%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.29%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007958Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459BC_3.0umEnvironmentalOpen in IMG/M
3300008791Microbial communities from seawater in eastern North Pacific Ocean - P1 free-living McLaneEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008937Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3CEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009268Eukaryotic communities of water from the North Atlantic ocean - ACM43EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018596Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002183 (ERX1782364-ERR1711927)EnvironmentalOpen in IMG/M
3300018597Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782201-ERR1712206)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018658Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000674 (ERX1789517-ERR1719451)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018735Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018813Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782297-ERR1712172)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018858Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789628-ERR1719293)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019102Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782448-ERR1712220)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021868Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300023555Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 89R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023676Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028102Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 45R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030781Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S7_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031700Marine microbial communities from Western Arctic Ocean, Canada - CB9_surfaceEnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0008458J53046_10579413300003677SeawaterGLTCIPDHQLFATGMNGDEDLGQDIIMKGKPFHYNQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN*
Ga0066831_1022378813300005516MarineMNGDEDLGEDIIMKGEPYHYGQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRQALFATGMNGDEDLGEDIIMKGEPYHYNQKPPQKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPPQKKLFATGMNGDEDLGEDIIMKGEPYHYN*
Ga0075498_131985813300006378AqueousHPAAAGLLQTSSCVNANTQGVRCIPNQQLWAVGMNGDEDLGEDIIMKGQKFHFEQKPEKTQLWAVGMNGDEDLGEDIIMKGQKFHFEQKPQNTKLFAVGMNGDEDLGQDIIMKGNKFHYDSKPANTQLWAVGMNGDEDLGQDIIIKGQKFHYESKPDNTQLFAVGMNGDEDLGQDIIMKGAKFHYNQAE*
Ga0105019_108734323300007513MarineMVQFATGMNGDEDLGQDITMKGEKFHYNQQNLSQFATGMNGDEDLGQDITMKGEKFHYGQNLVQTRFATGMNGDEDLGQDITMKGEKFHYNQQNLSQFATGMNGDEDLGQDITMKGEKFHYGQNLVQFATGMNGDEDLGQDITMKGEKFHYNQAPSDEKLFATGMNGDEDLGQDITMKGEKFHYNQQ*
Ga0102820_116660613300007554EstuarineFNQNLVQSKFATGMNGDEDLGEDITMKGNKFHFNQNLVQSKFATGMNGDEDLGEDITMKGNKFHFNQNLAQFATGMNGDEDLGEDITMKGNKFHFNQAPESHALFATGMNGDEDLGEDITMKGNKFHFNQENQQKLAQFATGMNGDEDLGEDITMKGNKFHFNQELVQVQGEGEGEA
Ga0105744_106531913300007863Estuary WaterALFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN*
Ga0105749_105715313300007864Estuary WaterIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN*
Ga0105743_101040813300007958Estuary WaterEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN*
Ga0103696_102226513300008791Ocean WaterMNGDEDLGEDIIMKGEPYHYAQKAPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNCDEDLGEDIIMKGEPYHYQQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYN*
Ga0103696_103721113300008791Ocean WaterMLFATGMNGDEDLGEDITMKGEKFHYQQKPQALFATGMNGDEDLGEDITMKGEKFHYSQKPENKRLFATGMNGDEDLGEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGQDIIMKGDKYHYNQELVQFASGMNGDEDLGQDIIMKGDKYHYDQNLVQFASGMNGDEDLGQDIIMK
Ga0103951_1022371023300008832MarineHGDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGEPYHYHQKRQALHQFATGMNGDEDLGEDIIMKGEPYHYNQRPSSKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRQALSQFATGMNGDEDLG*
Ga0103883_102359913300008835Surface Ocean WaterSCVPYHQFFATGMNGDEDLGEDIIMKGEPYHYNQKKIQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRIQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANAKLFATGMNGDEDLGEDIIMKGEPYHYTQKK*
Ga0103732_102694523300008929Ice Edge, Mcmurdo Sound, AntarcticaMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKAAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK*
Ga0103736_104338113300008933Ice Edge, Mcmurdo Sound, AntarcticaIMKGDKYHYNQNMAQFATGMNGDEDLGEDIIMKGEPYHYQQKAAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKTAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK*
Ga0103740_100364713300008937Ice Edge, Mcmurdo Sound, AntarcticaMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQNKLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ*
Ga0104258_106324013300008993Ocean WaterLGEDIIMKGEPYHYNQKKISSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGADITMKGQKFHYNQAPESQALFATGMNGDEDLGADITMKGQKFHYAQEPQALFATGMNGDEDLGADITMKG*
Ga0103706_1019912913300009022Ocean WaterNLAQFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANHKLFATGMNGDEDLGEDIIMKGEPYHYTQKK*
Ga0114995_1057273213300009172MarineIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK*
Ga0103874_101128713300009268Surface Ocean WaterGEDIIMKGEPYHYNQKKIQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRIQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANAKLFATGMNGDEDLGEDIIMKGEPYHYTQKK*
Ga0103742_103953813300009402Ice Edge, Mcmurdo Sound, AntarcticaMNGDEDLGQDIIMKGDKFHYNQKNLVQFATGMNGDEDLGEDIIMKGEPYHYQQKAAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK*
Ga0114998_1021045823300009422MarineATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK*
Ga0115570_1010743933300009496Pelagic MarineMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK*
Ga0115569_1045156613300009497Pelagic MarineIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKKRTGCLDLTPESQ*
Ga0115101_127863313300009592MarineKKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKQGATKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQRPENHKLFATGMNGDEDLGQDITMKGEPYHYQQKK*
Ga0115101_134152013300009592MarineMNGDEDLAEDITMKGDKFHYIQKKSAFATGMNGDEDLAEDITMKGDKFHYVQKPAHSKLFATGMNGDEDLAEDITMKGDKFHYVQKPAQQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHTLFATGMNGDEDLGEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ*
Ga0115103_161337613300009599MarineITMKGEPYHFQQKPKSKKLFATGMNGDEDLGEDITMKGEPYHFQQRPGAKKLFATGMNGDEDLGEDITMKGEPYHFQQKPRNKKLFATGMNGDEDLGEDITMKGEPYHFQQRKPANNKLFATGANGDEDLGEDITMKGEPYHFQQKRPENAKLFATGANGDEDLGEDITMKGEPYHFQQKK*
Ga0115100_1124807513300009608MarineRPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKQGATKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLAEDITMKGDKFHYIQKKSAFA
Ga0115105_1012862413300009679MarineNGDEDLGEDIIMKGEPYHYNQKRPAAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPGHKKLFATGMNGDEDLGEDIIMKGEPYHYNQRQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPVNQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPSQQKLFATGMNGDEDLGEDIIMKGEPFHYHQKKQALFATGMNGDEDLGEDIIMKG
Ga0115105_1017448813300009679MarineLGEDITMKGDKFHYVQRPAAKQLFATGMNGDEDLGEDITMKGDKFHYVQRPAAKQLFATGMNGDEDLGEDITMKGDKFHYVQRPGAKALFATGMNGDEDLGEDITMKGDKFHYMQKPANDKLFATGMNGDEDLGEDITMKGDKFHYVQKPASKALFATGMNGDEDLGEDITMKGDKFHYMQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQKQ*
Ga0115105_1053309413300009679MarineGQDIIMKGEKFHYNQGKKLAQFATGMNGDEDLGQDIIMKGEKFHYNEKNAKKLAQFATGMNGDEDLGQDIIMKGEKFHYDQKPANHKLFATGMNGDEDLGQDIIMKGEKFHYNEKNTQKLAQFATGMNGDEDLGQDIIMKGEKFHYDQKPSNNKLFATGMNGDEDLGQDIIMKGEKFHYMEKPANNKLFATGMNGDEDLGQDIIMKGEKFH
Ga0115105_1077921313300009679MarineGEPYHYGQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRQALFATGMNGDEDLGEDIIMKGEPYHYNQKPPQKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPPQKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPANNKLFATGMNGDEDLGEDIIMKGEPYHYTQKK*
Ga0115105_1132251813300009679MarineMNGDEDLGQDIIMKGEKFHYDQKPQNKKLFATGMNGDEDLGQDIIMKGEKFHYDQKPANKKLFATGMNGDEDLGQDIIMKGEKFHYNEKNAQKLAQFATGMNGDEDLGQDIIMKGEKFHYDQKPANNKLFATGMNGDEDLGQDIIMKGEKFHYDQKPANAKLFATGMNGDEDLGQDIIMKGEKFHYNEKNTQKLAQFA
Ga0133547_1207733723300010883MarineKGKPFHYNQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN*
Ga0138316_1013362113300010981MarineHYQQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQQRQQ*
Ga0138316_1058709323300010981MarineMNGDEDLGEDITMKGEKFHYNQKPTNKKLFATGMIGDEDLGEDITMKGEKFHYAQKKFATGMNGDEDMGEDITMKGEKFHYGQKPASKKLFATGMNGDEDLGEDITMKGEKFHYHQKPQALFATGMNGDEDLGEDITMKGEKFHYNQKPENKRLFATGMNGDEDLGEDITMKGEKFHYNQRPQESQLFATGMNGDEDLGEDITMKGEKFHYQQMIKNSH*
Ga0138316_1126809113300010981MarineGEPYHYNQKPPTKNLFATGMNGDEDLGEDIIMKGEPYHYNQKNQSKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKK*
Ga0138326_1082026613300010985MarineMNGDEDLGEDIIMKGEPYHYTQKKAQKMAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPAAKKLFATGMNGDEDLGEDIIMKGEPYHYTQKKQQKMAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMK
Ga0138326_1212273313300010985MarineDITMKGEKFHYAQKKFATGMNGDEDLAEDITMKGEKFHYNQKPQNRKLFATGMNGDEDLGEDITMKGEKFHYSQKPENKRLFATGMNGDEDLGEDITMKGEKFHYQQKPENKKLFATGMNGDEDLGEDITMKGEKFHYQQKPENKKLFATGMNGDEDLGEDITMKGEKFHYSQKPENHKLFATGMNGDEDLGEDITMKGEKFHYSQRPENHKLFATGMNGDEDLAEDIIMKGEKFHYAQKPEDHKLF
Ga0138324_1000744633300010987MarineMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYGQKPPAKRLFATGMNGDEDLGEDIIMKGEPYHYNQQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYTQKK*
Ga0138324_1039432613300010987MarineEDIIMKGEPYHYNQKKSKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPPTKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQSKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKK*
Ga0138324_1042409613300010987MarineCVPDHQFFATGNNGDEDLGEDIIMKGEPYHYTQKKQSSRAQFATGMNGDEDLGEDIIMKGEPYHYQQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKIQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPANNKLFATGMNGDEDLGEDIIMKGEPYHYNQRK*
Ga0138324_1048332913300010987MarineEDLGEDIIMKGEPYHYNQRPAAKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRQALSQFATGMNGDEDLGEDIIMKGEPYHYNQRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKK*
Ga0138324_1051878013300010987MarineDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQNKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYTQKK*
Ga0138324_1056834113300010987MarineNGAGLSCVPDNQFFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPAAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPATQKLFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDE
Ga0138324_1061706513300010987MarineALFATGMNGDEDLGEDITMKGDKFHYVQRPGAKALFATGMNGDEDLGEDITMKGDKFHYVQRPGAKALFATGMNGDEDLGEDITMKGDKFHYVQRPGAKALFATGMNGDEDLGEDITMKGDKFHYMQKPANKALFATGMNGDEDLGEDITMKGDKFHYMQRPGNDKLFATGMNGDEDLGE
Ga0138324_1066112513300010987MarineMNGDEDLGEDIIMKGEPFHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANNKLFATGNNGDEDLGEDIIMKGEPYHYIQKK*
Ga0138324_1070932813300010987MarineNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKMASRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPANTKLFATGMNGDEDLGEDIIMKGEPYHYNQKK*
Ga0138258_121612113300012413Polar MarineMKGDKFHYMQKPAAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPSAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPASQKLFATGMNGDEDLAEDITMKGDKFHYMQKPANQKLFATGMNGDEDLAEDITMKGDKFHYMQRPAEQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAEEKLFATGMNGDEDLGEDITMKGDKFHYVQKA*
Ga0138258_130041723300012413Polar MarineMNGDEDLAEDITMKGDKFHYIQKPAQHKLFATGMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQQKLFATGMNGDEDLAEDITMKGDKFHYVQRPTKNKLFATGM
Ga0138263_114994913300012415Polar MarineTGMNGDEDLAEDITMKGDKFHYMQKPAAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPAAQKLFATGMNGDEDLAEDITMKGDKFHYIQKPAAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPSAQKLFATGMNGDEDLAEDITMNGDKFHYMQKPASQKLFATGMNGDEDLAEDITMKGDKFHYMQKPANQKLFATGMNGDEDLAEDITMKGDKFHYMQRPAEQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAE*
Ga0138259_115715013300012416Polar MarineLFATGMNGDEDLAEDITMKGDKFHYIQKPAQHKLFATGMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQNKLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFTTSKDNEELVQP*
Ga0138259_160832413300012416Polar MarineQKLFATGMNGDEDLAEDITMKGDKFHYMQKPSAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPASQKLFATGMNGDEDLAEDITMKGDKFHYMQKPANQKLFATGMNGDEDLAEDITMKGDKFHYMQRPAEQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAEEKLFATGMNGDEDLGEDITMKGDKFHYVQKA*
Ga0129349_144227613300012518AqueousPYHYNQKKQQKQALFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPSNDKLFATGMNGDEDLGEDIIMKGEPYHYNQKK*
Ga0129350_121085813300012523AqueousGDEDLGEDIIMKGEPYHYNQKKQGVKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKQGVKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKQGVKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTDKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPSDKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK*
Ga0129352_1012823113300012528AqueousYNQQKPQRLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAAHKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMNGKPFHYNQN*
Ga0129352_1083645013300012528AqueousFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPSNDKLFATGMNGDEDLGEDIIMKGEPYHYNQKK*
Ga0163111_1203150613300012954Surface SeawaterEDIIMKGNPFHYNQQKQKPQRLFATGMNGDEDLGEDIIMKGNPFHYEQKPAAHKLFATGMNGDEDLGEDIIMKGEPYHYNQKKAQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKMASRAQFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFAT
Ga0181390_113667013300017719SeawaterTGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYQQKRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0181393_111218913300017748SeawaterEDIIMKGEPFHYNQKKPTNHKLFATGMNGDEDLGEDIIMKGEPFHYNQKKEQSKKLAQFATGMNGDEDLGEDIIMKGEPFHYHQKRPANQKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0187219_114319713300017751SeawaterGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKKQQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0181406_117529113300017767SeawaterGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKEGSKKLAQFATGMNGDEDLGEDIIMKGEPFHYNQKKAQKKQLAQFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLG
Ga0187221_109515913300017769SeawaterLFATGMNGDEDLGEDIIMKGEPYHYNQKKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGVKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKQGVKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGETYHYN
Ga0187217_114931313300017770SeawaterEDLGEDIIMKGEPFHYNQKKPAAKALFATGMNGDEDLGEDIIMKGEPYHYNQKAKGAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKPKNQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKEASKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANQKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0181430_117121013300017772SeawaterLINFLGLQDKEEVVDDDDKKDKKGDCEDIIMKGKPFHYNQQKKQALFATGMNGDEDLGEDIIMKGKPFHYNQQPKQALFATGMNGDEDLGEDIIMKGKPFHYNQQPKQALFATGMNGDEDLGEDIIMKGKPFHYNQAPANQKLFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGA
Ga0181380_125366513300017782SeawaterDLGEDIIMKGEPYHYNQKKEGSKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLAQFATGMNGDEDLGEDILMKGEPYHYNQKPADK
Ga0181379_112645023300017783SeawaterGEDILMKGEKFHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYQQKKQQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0181379_114333723300017783SeawaterQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLAQFATGMNGDEDLGEDILMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKKXALWSQ
Ga0192960_10214313300018515MarineGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKKQALFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYAQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQKQQALFATGMNGDEDLGEDIIMKGKPFHYDQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0193060_101212313300018596MarineMNGDEDLGEDITMKGEKFHYSQKPQKLAQFATGMNGDEDLGEDITMKGEKFHYSQKPENKRLFATGMNGDEDLGEDITMKGEKFHYNQRPQESQLFATGMNGDEDLGEDITMKGEKFHYQQMMKNSH
Ga0193035_102237713300018597MarineFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193355_101179913300018628MarineQKPQNNKLFATGMNGDEDLGEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYNQKPTNNKLFATGMNGDEDLGEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYGQKPENHKLFATGMNGDEDLGEDITMKGEKFHYSQKPEDHKLFATGMNGDEDLGEDITMKGEKFHYSQKH
Ga0193355_101550713300018628MarineSCVPNHQLFATGMNGDEDLGEDITMKGEKFHYNQKPTNNKLFATGMNGDEDLGEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYGQKPENHKLFATGMNGDEDLGEDITMKGEKFHYSQKPEDHKLFATGMNGDEDLGEDITMKGEKFHYSQKH
Ga0192969_105308113300018649MarineGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQTQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHY
Ga0192906_101867613300018658MarineIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPTNSKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193166_102385713300018674MarineTGMNGDEDLGEDIIMKGEPFHYNQKHQKKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPASQKLFATGMNGDEDLGEDIIMKGEPFHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193166_102604613300018674MarineGEDIIMKGEPYHYNQKKEKSKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKEQSKKLAQFATGMNGDEDLGEDILMKGEPYHYHQKRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192983_100528413300018684MarineTGMNGDEDLGEDIIMKGKPFHYDQRPANDKLFSTGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNEKLFATGMNGDEDLGEDIIMKGKPFHYEQKPASDKLFATGMNGDEDLGEDIIMKGKPFHYD
Ga0192983_100647513300018684MarinePNTQLFSTGMNGDEDLGEDIIMKGKPFHYDQRPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNEKLFATGMNGDEDLGEDIIMKGKPFHYEQKPASDKLFATGMNGDEDLGEDIIMKGKPFHYD
Ga0192983_101481413300018684MarineGDEDLAEDITMKGDKFHYIQKPAQHKLFATGMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQNKLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0192944_101825613300018692MarineMNGDEDLGEDIIMKGEPYHYQQKKNLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKVAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0192944_102178323300018692MarineMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKVAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0192944_103006613300018692MarineGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0192967_101898623300018730MarineMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKAAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0192967_105065013300018730MarineGDEDLGEDIIMKGEPYHYQQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKKXERCLDLTPESQXTIITNREAVHSVI
Ga0193544_100991313300018735MarineGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193544_101093213300018735MarinePFHYEQKPQAHKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193138_104083923300018742MarineATGMNGDEDLGEDIIMKGEPYHYNQKKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGVKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKPSDKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193138_104376313300018742MarineEKFHYSQKPQNKKLFATGMNGDEDLGEDITMKGEKFHYAQNKFATGMNGDEDLGEDITMKGEKFHYGQKPNNKKLFATGMNGDEDLGEDITMKGEKFHYSQKPKNAELFATGMNGDEDLGEDITMKGEKFHYNQKPENQQLFATGMNGDEDLGEDIIMKGDKFHYNQVIANSHXASPKIKISELKXTKXKH
Ga0193468_104027013300018746MarineFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0192827_103496713300018763MarineEDLGEDIIMKGEPFHYNQKKEQKKHLAQFATGMNGDEDLGEDIIMKGEPFHYNQKKPTNHKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPTNHKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPTNHKLFATGMNGDEDLGEDIIMKGEPFHYNQKKEQSKKLAQFATGMNGDEDLGEDIIMKGEPFHYHQKRPANQKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193031_102844913300018765MarineDLGEDIIMKGKPFHYNQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPTNSKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQ
Ga0193031_103251413300018765MarineQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKPPAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPANEKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193031_104358413300018765MarineQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKPPAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193031_105323113300018765MarineMQLSACVQSGVGGAGLSCVPNDQFFATGNNGDEDLGEDIIMKGEPYHYSQKQQELNQFATGNNGDEDMGEDIIMKGEPYHYHQKLVQFATGNNGDEDLGEDIIMKGEPYHYSQKHQELNQFATGNNGDEDMGEDIIMKGEPYHYHQKL
Ga0193031_108465913300018765MarineNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDILMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDILMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193031_109298213300018765MarineATGMNGDEDLGEDIIMKGEPFHYNQKKPTNHKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQLAQFATGMNGDEDLGEDIIMKGEPFHYHQKRPANQKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193181_100977613300018766MarineMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNDKLFATGMNGDEDLGEDIIMKGKPFHYDQRPANDRLFATGMNGDEDLGEDIIMKGKPFHYNQASNDDKKGWVELKNCTGAAGEKPLMEFQENASWANCKRTRDD
Ga0193181_104784413300018766MarineEDLGEDIIMKGEPYHYNQKKAQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKMASRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPANTKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193407_104020813300018776MarineQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPASTKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193149_103772013300018779MarineFATGMNGDEDLGEDITMKGEKFHYNQKPSNKKLFATGMNGDEDLGEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYGQKPASKKLFATGMNGDEDLGEDITMKGEKFHYNQKPSNKKLFATGMNGDEDLGEDITMKGEKFHYNQRPQESQLFATGMNGDEDLGEDITMKGEKFHYQQMIKNSH
Ga0193472_102521313300018780MarineLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0192832_104045113300018782MarineEPYHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASQKLFATGMNGDEDLGEDIIMKGEPYHYHQKGQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192832_105323713300018782MarineKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193124_103520613300018787MarineKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANHKLFATGMNGDEDLGEDIIMKGEPYHYTQKKXGX
Ga0192950_100651413300018791MarineMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYEQKPASDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNDRLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNDKLFATGMNGDEDLGEDIIMKGKPFHYNQQITKE
Ga0192950_104170613300018791MarineMNGDEDLGEDIIMKGDPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKVAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0192950_104300013300018791MarineGDEDLGEDILMKGEAFHYSQKKPAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKXG
Ga0192824_110799913300018801MarineDHQFFATGMNGDEDLGEDIIMKGEPYHYNQKKPAAKALFATGMNGDEDLGEDIIMKGEPYHYNQKAKGAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKPKNQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKEQSKKLAQFATGMNGDEDLGEDIIMKGEPYHYN
Ga0192829_110283113300018812MarineMNGDEDLGEDIIMKGEPYHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASQKLFATGMNGDEDLGEDIIMKGEPYHYHQKGQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPSNKKLFATG
Ga0192872_109235413300018813MarineLDSGINGAGLSCVPNHQLFATGMNGDEDLGEDITMKGEKFHYSQKPQNSKLFATGMNGDEDLGEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYNQKPTNNKLFATGMNGDEDLGEDITMKGEKFHYSQKPENQKLFATGMNGDEDLGEDITMKGEKFHYA
Ga0193191_105656813300018830MarineFATGMNGDEDLGEDIIMKGEPYHYNQKKAQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKMASRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPANTKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193191_106270113300018830MarinePQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193191_107878513300018830MarinePQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAAQKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0192949_106622713300018831MarineGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0194240_100325813300018832MarineNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0192870_106351213300018836MarineEDITMKGEKFHYNQKPSNKKLFATGMNGDEDLAEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYGQKPASKKLFATGMNGDEDLGEDITMKGEKFHYHQKPQALFATGMNGDEDLGEDITMKGEKFHYNQKPENKRLFATGMNGDEDLGEDITMKGEKFHYNQRPQESQLFATGMNGDEDLGEDITMKGEKFHYNQMIKNS
Ga0193302_104985113300018838MarineMNGDEDLGEDIIMKGEPYHYNQKKEASKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKPSDKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPVDKKFTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193302_108044913300018838MarineKKPAAKQLFATGMNGDEDLGEDIIMKGEPFHYNQKKEQKKHLAQFATGMNGDEDLGEDIIMKGEPFHYNQKKPTNHKLFATGMNGDEDLGEDIIMKGEPFHYNQKKEQSKKLAQFATGMNGDEDLGEDIIMKGEPFHYHQKRPANQKLFATGMNGDEDLGEDIIMKGEPYHYTQKK
Ga0193302_108364213300018838MarineIMKGEPYHYNQKKAQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKMASRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPANTKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193253_103284913300018846MarineMNGDEDLGEDIIMKGKPFHYDQRPANEKLYATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQKPANDRLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPANEKLYATGMNGDEDLGEDIIMKGKPFHYDQRPANDRLFATGMNGDEDLGEDIIMKGKPFHYNQASNDGKNGWIELKNCTGAAGEKPLMEFHENASWANCKTTRHDD
Ga0193253_105636813300018846MarineMNGDEDLGEDIIMKGKPFHYDQRPANEKLYATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQKPANDRLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNDKLFATGMNGDEDLGEDIIMKGKPFHYDQRPANDRLFATGMNGDEDLGEDIIMKGKPFHYNQASND
Ga0193413_107238013300018858MarineKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPASTKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193192_102936313300018860MarineMKGEPFHYNQKKPAHKSLFATGMNGDEDLGEDIIMKGEPFHYNQKKAQKKNLAQFATGMNGDEDLGEDIIMKGEPFHYNQKKPTNHKLFATGMNGDEDLGEDIIMKGEPFHYNQKKEQSKKLAQFATGMNGDEDLGEDIIMKGEPFHYHQKRPANQKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193308_104605213300018862MarineDQKPAAQKLFATGMNGYEDLGEDIIMKGKPFHYDQKPAAQKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193308_106707713300018862MarineMNVDEDLGEDITMKGEKFHYQQKPENKKLFATGMNGDEDLGEDITMKGEKFHYSQKPENHKLFATGMNGDEDLGEDITMKGEKFHYSQRPENHKLFATGMNGDEDLAEDIIMKGEKFHYAQKPEDHKLFATGMNGDEDLGEDIIMKGEKFHYN
Ga0193308_108680113300018862MarineAGLSCVPDHQFFATGMNGDEDLGEDIIMKGEPYHYNQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANHKLFATGMNGDEDLVRTSS
Ga0193533_109943613300018870MarineLGEDIIMKGEPYHYNQKPPAKKLFATGMNGDEDLGEDIIMKGEPYHYNQQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPGNKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193090_104106513300018899MarineNDKLFSTGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNEKLFATGMNGDEDLGEDIIMKGKPFHYEQKPASDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNDKLFATGMNGDEDLGEDIIMKGKPFHYDQRPANDKLFATGMTGSEDLTVQPVKAEP
Ga0193028_106705113300018905MarineKSKFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPPAKKLFATGMNGDEDLGEDIIMKGEPYHYNQQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPGNKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193028_112108413300018905MarineQNPQKLSQFATGMNGDEDLGQDITMKGEKFHYQQNPQKLSQFATGMNGDEDLGQDITMKGEKFHYGQNLLQTKFATGMNGDEDLGQDITMKGEKFHYNQAPSDVKLFATGMNGDEDLGQDITMKGEKFHYNQQXIIKAXTELLTKARCSKNDKKRILFKYAWIKA
Ga0192868_1005726413300018913MarineLQLSACSASGINGAGLTCVPDHEYFATGMNGDEDLGEDIIMKGEPYHYNQKKEGSKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKAQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYTQKK
Ga0192868_1007693913300018913MarineMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYNQKPTNNKLFATGMNGDEDLGEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYGQKPENQKLFATGMNGDEDLGEDITMKGEKFHYNQKPEDHKLFATGMNGDEDLGEDITMKGEKFHYSQKH
Ga0192989_1015425313300018926MarineYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLAQFATGMNGDEDLGEDILMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192985_116225813300018948MarineEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQNKLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0193379_1010919013300018955MarineFVQFATGMNGDEDLGQDIIMKGEPYHYQQFGSRAQFATGMNGDEDLGQDIIMKGEPYHYQQMGSRAQFATGMNGDEDLGQDIIMKGEPYHYQQVGSRAQFATGMNGDEDLGQDIIMKGEPYHYQQVGSRAQFATGMNGDEDLGQDIIMKGEPYHYQQVGSRAQFATGMNGDEDLGQDIIMKGEPYHYTQRN
Ga0193178_1003807413300018967MarineLTCMPDHQYFATGMNGDEDLGEDIIMKGEPYHYNQKKAQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKMASRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPANTKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192873_1017050013300018974MarineMNGDEDLAEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYGQKPASKKLFATGMNGDEDLGEDITMKGEKFHYHQKPQALFATGMNGDEDLGEDITMKGEKFHYNQKPENKRLFATGMNGDEDLGEDITMKGEKFHYNQRPQESQLFATGMNGDEDLGEDITMKGEKFHYSQMIKNSH
Ga0192873_1026668223300018974MarineGMNGDEDMGEDITMKGEKFHYAQKQAKFATGMNGDEDLGEDITMKGEKFHYGQKPNNKKLFATGMNGDEDLAEDITMKGEKFHYAQNKFATGMNGDEDLGEDITMKGEKFHYGQKPKANKLFATGMNGDEDLGEDITMKGEKFHYSQKPENQKLFATGMNGDEDMGDDITMKGEGFHYNQKPEPTALRHWHER
Ga0193353_1022780823300018977MarineMNGDEDLGEDIIMKGEPYHYNQKKQHLGQFATGMNGDEDLGEDIIMKGEPYHYNQKPPSKKLFATGMNGDEDMGEDIIMKGEPYHYGQRPADKKLFATGMNGDEDLGEDIIMKGEPYHYNQKGQKSQKK
Ga0193353_1024183513300018977MarineLGEDIQMKGEPYHYKQKRFANGMNGDEDLGEDITMKGEPYHYKQKKFANGMNGDEDLGEDITMKGEPYHYKQKPSNKKLFANGMNGDEDLGEDIQMKGEPYHYRQRPSNHKLFANGMNGDEDLGEDIQMKGEPYHYKQKPSNKKLFANGMNGDEDLGEDIQMKGEPYHYQHR
Ga0192961_1016512413300018980MarineAQFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKVAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0192968_1015711813300018981MarineGDEDLGEDIIMKGEPYHYQQKAAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKKXERCLDLTPESQXTIKTNREAVHSVI
Ga0192947_1012748213300018982MarineGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192947_1020798313300018982MarineFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0192947_1022791013300018982MarineDNQFFATGMNGDEDLAEDIIMKGEPYHYTQKKASSRAQFATGMNGDEDLGEDIIMKGEPYHYNQKKPAEKKLFATGMNGDEDLGEDIIMKGEPYHYTQKKTASRAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYTQKK
Ga0192947_1029658413300018982MarineSSRAQFATGMNGDEDLGEDIIMKGEPYHYNQKKPAEKKLFATGMNGDEDLGEDIIMKGEPYHYTQKKTASRAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYTQKK
Ga0193030_1006066323300018989MarineMNGDEDLAEDIIMKGEPYHYNQKKQKSKFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPPAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPGNKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193030_1011554013300018989MarineINGAGLSCVPNHQLFATGMNGDEDLGEDITMKGEKFHYSQKKFATGMNGDEDMGEDITMKGEKFHYNQAKKSLAQFATGMNGDEDLGEDITMKGEKFHYNQKPTNNKLFATGMNGDEDLGEDITMKGEKFHYSQKPENHKLFATGMNGDEDLAEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYGQKPEDHKLFATGMNGDEDLGEDITMKGEKFHYSQKH
Ga0193030_1013802413300018989MarineNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193030_1030319413300018989MarineEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKKQQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANQKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193257_1009615913300018997MarineFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPTNSKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193257_1014070313300018997MarineFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQKPQALFATGMNGDEDLGEDIIMKGKPFHYHQAPANQKLFATGMNGDEDLGEDIIMKGKPFHYNQH
Ga0193034_1010298913300019001MarineATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193034_1012141313300019001MarineGDEDLGEDIIMKGEPYHYNQKKEGSKKLAQFATGMNGDEDLGEDIIMKGEPCHYNQKKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPSDKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPVDKKFTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193034_1012397113300019001MarineCVPDHQYFATGMNGDEDLGEDIIMKGEPFHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPFHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANNKLFATGNNGDEDLGEDIIMKGEPYHYNQKK
Ga0193034_1018546113300019001MarineMNGDEDLGEDIIMKGEPFHYNQKKPTNHKLFATGMNGDEDLGEDIIMKGEPFHYNQKKEQSKKLAQFATGMNGDEDLGEDIIMKGEPFHYHQKRPANQKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193033_1012724513300019003MarineGINGAGLSCVPDKQFFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPPAKKLFATGMNGDEDLGEDIIMKGEPYHYNQQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPGNKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193033_1013192913300019003MarineDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQKQQPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKK
Ga0193033_1017106813300019003MarineNGDEDLGEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYNQKPTNNKLFATGMNGDEDLGEDITMKGEKFHYSQKPENHKLFATGMNGDEDLAEDITMKGEKFHYAQKKFATGMNGDEDLGEDITMKGEKFHYGQKPEDHKLFATGMNGDEDLGEDITMKGEKFHYSQKH
Ga0193569_1018775723300019017MarineEDIIMKGKPFHYNQQKPQRLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193569_1025476313300019017MarineNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPTNSKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193569_1028089213300019017MarineNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPAAKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLNQDIIMKGEPFHYNQKKPAANKLFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193538_1016969813300019020MarineKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQKQQPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKK
Ga0192951_1015758413300019022MarineKPFHYNQQKKQALFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0193545_1005645913300019025MarineGGDEDLAEDITMKGDKFHYIQKKSAFATGMNGDEDLAEDITMKGDKFHYVQKPAHTKLFATGMNGDEDLAEDITMKGDKFHYVQKPAQQRLFATGMNGDEDLAEDITMKGDKFHYVQRPAQQRLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHTLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0193545_1009061713300019025MarineMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANKKLFATGMNGDEDLGEDIIMKGEPYHYTQKKTASRAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYTHKK
Ga0192909_1028685313300019027MarineTWAGMNGDEDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193516_1029296613300019031MarineKKAAKLAQFATGMNGDEDLGEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPASNKLFATGMNGDEDLGEDIIMKGEPFHYQQKKPADSKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0192869_1016760313300019032MarineVNCLPNNQLFATGMNGDEDLAEDITMKGDKFHYIQKKSAFATGMNGDEDLAEDITMKGDKFHYVQKPATHKLFATGMNGDEDLSEDITMKGDKFHYVQKPATQRLFATGMNGDEDLAEDITMKGDKFHYVQKPAQHNLFATGMNGDEDLAEDITMKGDKFHYLQNRPAAQKLFATGMNGDEDLGEDITMKGDKFHYVQRPANEKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0192869_1043126013300019032MarineHGATGMNGDEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193037_1015615413300019033MarineVDIIMKGEPYHYNQKKAQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQKKMASRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPANTKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193037_1016043013300019033MarineVSSGVAGVSCVPNSELFATGMNGDEDLGEDITMKGDKFHYVQKPAAKALFATGMNGDEDLGEDITMKGDKFHYVQRPGAKALFATGMNGDEDLGEDITMKGDKFHYVQKPAAKALFATGMNGDEDLGEDITMKGDKFHYMQRPAAKALFATGMNGDEDLGEDITMKGDKFHYVQRPDNKKLFATGMNGDEDLGEDITMKGDKFHYMQRPSNDKLFATGMNGDEDLGEDITMKGDKFHYVQRPANDKL
Ga0193037_1026476413300019033MarineAGVNCVPNAELFATGMNGDEDLGEDITMKGDKFHYVQRPAAQKLFATGMNGDEDLGEDITMKGDKFHYVQRPSQQKLFATGMNGDEDLGEDITMKGDKFHYVQRPAQQKLFATGMNGDEDLGEDITMKGDKFHYVQRPASQKLFATGMNGDEDLGEDITMKGDKFHYVQRPASQKLFATGMNGDEDLGEDITMKVTSST
Ga0192945_1011791013300019036MarineFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKVAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0192945_1013761213300019036MarineGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQKQQALFATGMNGDEDLGEDIIMKGKPFHYDQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0192886_1021452513300019037MarineSACSQSGIAGAGISCIPDHQFFATGMNGDEDLGEDIIMKGEPYHYNQRQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPASKNLFATGMNGDEDLGEDIIMKGEPYHYNQQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRRPANSKLFATGNNGDEDLGEDIIMKGEPYHYNQK
Ga0193123_1030279723300019039MarineHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANHKLFATGMNGDEDLGEDIIMKGEPYHYTQKKXGX
Ga0193336_1003157313300019045MarineMKGKPFHYNQQKPQRLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193336_1015003013300019045MarineQSGINGAGLSCVPDHQFFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYGQKPPAKRLFATGMNGDEDLGEDIIMKGEPYHYNQQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYTQKK
Ga0193336_1019038523300019045MarineGDEDLGEDIIMKGEPYHYTQKKAGSRAQFATGMNGDEDLGEDIIMKGEPYYYNQKKPAQHKFFATGMNGDEDFGEDIIMKGEPYHYTQKKQQKMAQFATGMNGDEDLGEDIIMKGESYYYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYTQKK
Ga0193336_1023779213300019045MarineHGKKPASQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYHQKRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193336_1025454613300019045MarineKPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPATNKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193336_1027592013300019045MarineTGMNGDEDLGEDIIMKGDPYHYNQKKPASQKLFATGMNGDEDLGEDIIMKGDPYHYHQKGQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPGNSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193336_1028668323300019045MarineGATGMNGDEDLGEDIIMKGEPYHYQQRPTSKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKIQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPANNKLFATGMNGDEDLGEDIIMKGEPYHYNQKKXIVVAPKKSLSID
Ga0193336_1030902613300019045MarineMNGDEDLGEDIIMKGEPYHYSQKPPAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQSKQALFATGMNGDEDLGEDIIMKGEPYHYHQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYHQKRPSNDKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193336_1046804013300019045MarineDLGEDIIMKGEPFHYNQKKEQKKHLAQFATGMNGDEDLGEDIIMKGEPFHYNQKKPTNHKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPGNSKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192981_1009824013300019048MarineGDEDLAEDITMKGDKFHYIQKPAAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPSAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPASQKLFATGMNGDEDLAEDITMKGDKFHYMQKPANQKLFATGMNGDEDLAEDITMKGDKFHYMQRPAEQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAEEKLFATGMNGDEDLGEDITMKGDKFHYVQKA
Ga0192981_1025414513300019048MarineYHYQQKKSLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0192966_1012846213300019050MarineGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQTQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0192966_1032291513300019050MarineGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQTQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGK
Ga0192826_1010591013300019051MarineGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGEPYHYNQKKEQSKKLAQFATGMNGDEDLGEDIIMKGEPYHYHQKRPANQKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0192826_1014793913300019051MarineEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKKVKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192826_1019284913300019051MarineMNGDEDLGEDIIMKGEPYHYNQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPSDHKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192826_1021179213300019051MarineLTCMPDHQYFATGMNGDEDLGEDIIMKGKPFHYNQQKPQRLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQRLFATGMNGDEDLGEDIIMNGDEDLGEDIIMKGKPF
Ga0192826_1022081413300019051MarineMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPATKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYHQKRPENQKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192826_1022325513300019051MarineEDIIMKGEPYHYNQKPKNQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKEQSKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPGNSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192826_1022828113300019051MarineGEDITMKGDKFHYVQRPAAQRLFATGMNGDEDLGEDITMKGDKFHYVQRPAQQRLFATGMNGDEDLGEDITMKGDKFHYIQKPAANKLFATGMNGDEDLGEDITMKGDKFHYMQRPAQQRLFATGMNGDEDLGEDITMKGDKFHYMQRPAEQKLFATGMNGDEDLGEDITMKGDKFHYVQRPGEDKLFATGMNGDEDLGEDITMKGDHFHYVQKA
Ga0192826_1026010713300019051MarineDLGEDIIMKGEPYHYNQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPPSKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKTQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQKKQKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKPASQKLFATGMNGDEDLGEDIIMKGEPYHYNQKRQQKLAQFATGMNGDEDLGEDIIMKGE
Ga0192826_1027867313300019051MarineNGAGLSCIPDNQFFATGMNGDEDLGEDIIMKGEPYHYNQKQPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKKQALFATGMNGDEDLGEDIIMKGEPYHYN
Ga0188866_102707313300019095Freshwater LakeEPYHYNQQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0194243_100482713300019102MarineMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQNXADELLEGLQPFNSVINGK
Ga0192946_101930913300019103MarineHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYEQKPASDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNDRLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNDKLFATGMNGDEDLGEDIIMKGKPFHYDQRPANEKLFATGMTGSEDLIVQPVKAEP
Ga0192946_103340913300019103MarineNGAGLTCVPDHEYFATGMNGDEDLGEDILMKGEPFHYNQKKPASKALFATGMNGDEDLGEDIIMKGEPYHYNQKAKGAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKEQSKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQRRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0192972_105760913300019108MarineITMKGDKFHYIQKPAAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPSAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPASQKLFATGMNGDEDLAEDITMKGDKFHYMQKPANQKLFATGMNGDEDLAEDITMKGDKFHYMQRPAEQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAEEKLFATGMNGDEDLGEDITMKGDKFHYVQKA
Ga0193243_105379813300019116MarineDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193054_102927913300019117MarineHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQKQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPANTKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0193054_103251913300019117MarineMNGDEDLGEDIIMKGEPYHYNQKKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASQKLFATGMNGDEDLGEDIIMKGEPYHYHQKGQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193054_104863813300019117MarineASKKLFATGMNGDEDLGQDITMKGEPYHYQARQKLAQFATGMNGDEDLGQDITMKGEPFHYQGKQKLAQFATGMNGDEDLGQDITMKGEPFHYQAKQHMAQKKFATGMNGDEDLGQDITMKGEPFHYQGKPANKKLFATGMNGDEDLGQDITMKGEPFHYQAKGAPENHKLFATGMNGDEDLGQDITMKGEPYHYQGKIQH
Ga0193054_105350413300019117MarineHGDEDLGQDITMKGEPYHYQARQKLAQFATGMNGDEDLGQDITMKGEPFHYQGKQKLAQFATGMNGDEDLGQDITMKGEPFHYQAKQHMAQKKFATGMNGDEDLGQDITMKGEPFHYQGKPANKKLFATGMNGDEDLGQDITMKGEPFHYQAKGAPENHKLFATGMNGDEDLGQDITMKGEPYHYQGKIQH
Ga0193054_106593613300019117MarineGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQALSQFATGMNGDEDLGEDIIMKGEPYHYNQRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKXTGEXAWSS
Ga0193157_101473313300019118MarineITMKGDKFHYVQRPATKKLFATGMNGDEDLGEDITMKGDKFHYVQRPATKKLFATGMNGDEDLGEDITMKGDKFHYVQRPSQQKLFATGMNGDEDLGEDITMKGDKFHYVQKPAQNKLFATGMNGDEDLGEDITMKGDKFHYVQKPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0193157_102754213300019118MarineEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193157_103241213300019118MarineNQQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPAHKKLFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPVNQKLFATGMNGDEDLGEDIIMKGEPYHYTQKKXGC
Ga0192980_103654113300019123MarineFLQTSACASAGVAGVNCLPNNQLFATGMNGDEDLAEDITMKGDKFHYIQKPAAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPSAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPASQKLFATGMNGDEDLAEDITMKGDKFHYMQKPANQKLFATGMNGDEDLAEDITMKGDKFHYMQRPAEQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAEEKLFATGMNGDEDLGEDITMKGDKFHYVQKA
Ga0192980_105158313300019123MarineFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQTQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0193104_102108213300019125MarineDIIMKGKPFHYNQKQQPQQLFATGMNGDEDLGEDIIMKGKPFHYNQKQQPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKK
Ga0193104_103249213300019125MarineSTGMNGDEDLAEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0193104_105170323300019125MarineMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQKQQP
Ga0193104_105205513300019125MarineQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0193104_106302613300019125MarineLQLSACSSSGINGAGLSCVPDNQFFATGMNGDEDLAEDIIMKGEPYHYNQKKQKSKFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPPAKKLFATGMNGDEDLGEDIIMKGEPYHYNQQKQKKQALFATGMNGDEDLGED
Ga0193436_102880913300019129MarineHKLFATGMNGDEDLGEDIIMKGKPFHYDQKPAAQKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKQ
Ga0193047_108777513300019139MarineDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPTNSKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0182058_154619413300019283Salt MarshEPYHFQQKPRNKKLFATGMNGDEDLGEDITMKGEPYHFQQKKPANHKLFATGANGDEDLGEDITMKGEPYHFQQKPKSKKLFATGMNGDEDLGEDITMKGEPYHFQQKKPAAKKLFATGMNGDEDLGEDITMKGEPYHFQQKPRNKKLFATGMNGDEDLGEDITMKGEPYHFQQ
Ga0211686_1019958613300020382MarineIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQTQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0211686_1035030613300020382MarineFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKAAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0206691_139690623300021342SeawaterATGNNGDEDMGEDIIMKGEKFHYQQKPSSQKLFATGNNGDEDMGEDIIMKGEKFHYGQKPQKLSQFATGMNGDEDLGEDITMKGEKFHYGQKLAQFATGNNGDEDMGEDIIMKGEKFHYGQKPQKIVQFATGNNGDEDMGEDIIMKGEKFHYGQKPQKLSQFATGMNGDEDLGEDITMKGEKFHYG
Ga0206688_1042090313300021345SeawaterKKLFATGMNGDEDMGEDITMKGEKFHYAQNKFATGMNGDEDLGEDITMKGEKFHYGQKPNNKKLFATGMNGDEDLGEDITMKGEKFHYSQTPKNNQLFATGMNGDEDMGEDIIMKGEKFHYNQKPENQQLFATGMNGDEDMGEDIIMKGEKFHYNQVIANSH
Ga0206695_142089413300021348SeawaterMNGDEDLGQDIIMKGEKFHYKQGKKLAQFATGMNGDEDLGQDIIMKGEKFHYDQKPANKKLFATGMNGDEDLGQDIIMKGEKFHYNEKNAKKLAQFATGMNGDEDLGQDIIMKGEKFHYDQKPANNKLFATGMNGDEDLGQDIIMKGEKFHYDQKPANAKLFATGMNGDEDLGQDIIMKGEKFHYNEKNTQKLAQFATGMNGDEDLGQDIIMKGEKFHYDQK
Ga0206692_148586223300021350SeawaterMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQKPANDRLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNDKLFATGMNGDEDLGED
Ga0206692_188056613300021350SeawaterKKLFATGMNGDEDLGQDITMKGEPYHYQQKQGATKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQRPENHKLFATGMNGDEDLGQDITMKGEPYHYQQKK
Ga0206693_190745313300021353SeawaterNGDEDLGQDITMKGEKFHYNQKQALFAVGMNGDEDLGQDITMKGDKYHYNQVPNHKLFATGMNGDEDLGQDITMKGEKFHYNQQQALFATGMNGDEDLGQDITMKGEKFHYNQVPNQKLFATGMNGDEDLGQDITMKGEKFHYNQVPDHQLFATGMNGDEDLGQDITMKGQPFHYAQAKFAEGMRGDEDLGQDITMKGQPFHYNQ
Ga0206689_1035864013300021359SeawaterTMKGEKFHYGQKPNNKKLFATGMNGDEDLGEDITMKGEKFHYTQKPKNTELFATGMNGDEDMGEDITMKGEKFHYNQKPENQQLFATGMNGDEDMGEDIIMKGEKFHYAQKKFATGMNGDEDMGEDITMKGEKFHYGQKPNNKKLFATGMNGDEDLGEDITMKGEKF
Ga0206123_1027056613300021365SeawaterKGDEFHYVQKPAHAKLFATGMNGDEDLAEDITMKGDKFHYVQKPATQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAAKQLFATGMNGDEDLAEDITMKGDKFHYVQKPATKQYFATGMNGDEDLAEDITMKGDKFHYVQRPATQKLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0063111_11308213300021868MarineEDLGEDIIMKGEPFHYNQKKPAAKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPAQNKLFATGMNGDEDLGEDIIMKGEPFHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQAKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPGNSKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0063132_10952213300021872MarineMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPTNSKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0063132_11359113300021872MarineLFATGMNGDEDLGEDIIMKGKPFHYNQKQQPQQLFATGMNGDEDLGEDIIMKGKPFHYNQKQQPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKK
Ga0063132_11790013300021872MarinePNNQLFATGMNGDEDLAEDITMKGDKFHYIQKKSAFATGMNGDEDLAEDITMKGDKFHYVQKPAHTKLFATGMNGDEDLAEDITMKGDKFHYVQKPAQQRLFATGMNGDEDLAEDITMKGDKFHYVQRPAQQRLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHTLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0063132_11790113300021872MarineQTSACNSAGVAGVNCLPNNQLFATGMNGDEDLAEDITMKGDKFHYIQKKSAFATGMNGDEDLAEDITMKGDKFHYVQKPAHTKLFATGMNGDEDLAEDITMKGDKFHYVQKPAQQRLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHTLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0063117_101123613300021881MarineDNQYFATGMNGDEDLGEDIIMKGEPYHYNQKKQALHQFATGMNGDEDLGEDIIMKGEPYHYNQRPAAKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQALSQFATGMNGDEDLGEDIIMKGEPYHYNQRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKXTGXAWPS
Ga0063090_106348713300021890MarineEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0063099_102986313300021894MarineTMKGDKFHYIQKKSAFATGMNGDEDLAEDITMKGDKFHYVQKPAHAKLFATGMNGDEDLAEDITMKGDKFHYVQKPATQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAAKQLFATGMNGDEDLAEDITMKGDKFHYVQKPATKQYFATGMNGDEDLAEDITMKGDKFHYVQRPATQKLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQR
Ga0063086_103730413300021902MarineGFLQLSACSASGINGAGLSCVPDHQFFATGMNGDEDLGEDIIMKGEPYHYTQKKQQSRAQFATGMNGDEDLGEDIIMKGEPYHYQQKPASQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKIQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQRPANTKLFATGNNGDEDLGEDIIMKGEPYHYNQKK
Ga0063086_107518413300021902MarineLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0063135_104511233300021908MarineMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQKPANDRLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNDKLFATGMNGDEDLGEDIIMKGKPFHYDQRPANDRLFATGMNGDEDLGEDIIMKGKPFHYNQASNDGTKGWIELKNCTGAAGEKPLMEFHENASWANCKTTRHDN
Ga0063133_100779913300021912MarinePASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0063103_109556013300021927MarineLGQDIIMKGKPFHYNQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0063134_109438613300021928MarineFATGMNGDEDLGEDIIMKGEPFHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKPAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0063139_109470213300021934MarinePAAKKLFATGMNGDEDLGEDITMKGEPYHFQQRPKARKLFATGMNGDEDLGEDITMKGEPYHFQQKKPAAKKLFATGMNGDEDLGEDITMKGEPYHFQQKKPAAKKLFATGMNGDEDLGEDITMKGEPYHFQQKKPANDKLFATGMNGDEDLGEDITMKGEKYHYQQNKPENHKLFATGMNGDEDLGEDITMKGEAYHYNQKK
Ga0224906_118789613300022074SeawaterDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPANNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQK
Ga0232120_10708313300023555SeawaterDHQFFATGMNGDEDLGEDIIMKGEPYHYNQKKQQKQALFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYHQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPSNEKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0232120_10880513300023555SeawaterIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRIQSRAQFATGMNGDEDLGEDILMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0228679_101922623300023566SeawaterMNGDEDLGEDIIMKGKTFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNG
Ga0232114_11292813300023676SeawaterEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0228680_102057613300023695SeawaterCVPDHQFFATGMNGDEDLGEDIIMKGEPYHYNQKKQQKQALFATGMNGDEDLGEDIIMKGEPYHYHQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYHQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPSNEKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0209603_114913613300025849Pelagic MarineQKAPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0247557_102255613300026403SeawaterMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLAQFATGMNGDEDLGEDILMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0247581_103230413300026420SeawaterPSKASLFATGMNGDEDLGQDIIMKGKPFHYNQQKKQALFATGMNGDEDLGEDIIMKGKPFHYNQQPKQALFATGMNGDEDLGEDIIMKGKPFHYNQQPKQALFATGMNGDEDLGEDIIMKGKPFHYNQAPANQKLFATGMNGDEDLGEDIIMKGKPFHYNQH
Ga0247559_110416013300026443SeawaterTGMNGDEDLGQDIIMKGKPFHYNQQKKQALFATGMNGDEDLGEDIIMKGKPFHYNQQPKQALFATGMNGDEDLGEDIIMKGKPFHYNQQPKQALFATGMNGDEDLGEDIIMKGKPFHYNQAPANQKLFATGMNGDEDLGEDIIMKGKPFHYNQH
Ga0247607_102485913300026447SeawaterGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPTNSKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0247578_105474023300026458SeawaterMNGDEDLGEDIIMKGKPFHYEQKPEAHKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0247600_105605223300026461SeawaterMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQKPANDRLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNDKLFATGMNGDEDLGEDIIMKGKPFHYDQRPANDRLFATGMNGDED
Ga0247602_108806313300026471SeawaterATGMNGDEDLGEDIIMKGEPYHYHQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYHQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPSNDKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0247571_113441313300026495SeawaterGMNGDEDLGEDIIMKGEPYHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYHQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPSNDKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0247605_112948013300026503SeawaterMNGDEDLGEDIIMKGEPYHYNQKKEGSKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHY
Ga0247586_109492413300028102SeawaterHSKLFATGMNGDEDLAEDITMKGDKFHYVQKPAQQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHTLFATGMNGDEDLGEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHFIQKPAEYVQFATGMNGDEDLGEDITMKGDKFHFIQKPAEYVQFATGMNGDEDLGEDIT
Ga0247596_110671713300028106SeawaterNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPTNSKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNHKPANDKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0247582_106325713300028109SeawaterEPYHYNQKKEGSKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLAQFATGMNGDEDLGEDILMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0247584_115383713300028110SeawaterKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYHQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPSNDKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0256412_104372813300028137SeawaterMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQKPANDRLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQRPSNDKLFATGMNGDEDLGEDIIMKGKPFHYDQRPANDRLFATGMNGDEDLGEDIIMKGKPFHYNQASNDGTKGWIELKNCTGAAGEKPLMEFHENASWANCKTTRHDD
Ga0256412_116422123300028137SeawaterMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKKQQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0256412_126070713300028137SeawaterKLFATGMNGDEDLGEDIIMKGKPFHYNQKPASNKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYDQKPTNSKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0256412_128229113300028137SeawaterMNGDEDLGQDITMKGEPYHYQQRPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQKPGAKKLFATGMNGDEDLGQDITMKGEPYHYQQRPENHKLFATGMNGDEDLGQDITMKGEPYHYQQKK
Ga0256412_130747313300028137SeawaterLETTRCLEAGVNGVTCVPVDSQLFATGMNGDEDLGEDIIMKGEPYHYNQKRPVDQKLFATGMNGDEDLAEDIIMKGEPYHYNQKKPENHQLFATGMNGDEDLGEDIIMKGEPYHYNQKKPEDHKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPENHQLFATGMNGDEDLGEDITMKGDKFHFIQRPAANNLFA
Ga0256412_133476913300028137SeawaterDLGEDIIMKGEPYHYNQKRIQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQKAKGAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKPKNQKLFATGMNGDEDLGEDIIMKGEPYHYNQKKEASKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANQKLFATGMNGDEDLGEDIIMKGEP
Ga0256417_113808713300028233SeawaterHQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPYHYHQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPSNDKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0256413_124579713300028282SeawaterGMNGDEDLGEDIIMKGKPFHYEQKPEAHKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQN
Ga0247566_104141313300028335SeawaterPYHYNQKKQQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKKPNNKKLFSTGMNGDEDLGEDIIMKGEPYHYNQKPSNKKPAQFATGMNGDEDLGEDILMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQKT
Ga0304731_1020197923300028575MarineMNGDEDLGEDITMKGEKFHYNQKPTNKKLFATGMIGDEDLGEDITMKGEKFHYAQKKFATGMNGDEDMGEDITMKGEKFHYGQKPASKKLFATGMNGDEDLGEDITMKGEKFHYHQKPQALFATGMNGDEDLGEDITMKGEKFHYNQKPENKRLFATGMNGDEDLGEDITMKGEKFHYNQRPQESQLFATGMNGDEDLGEDITMKGEKFHYQQMIKNSH
Ga0304731_1118470813300028575MarineHYQQRPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDITMKGDKFHFNQRPAQYVQFATGMNGDEDLGEDITMKGDKFHFNQQRQQ
Ga0304731_1151109513300028575MarineGEPYHYNQKPPTKNLFATGMNGDEDLGEDIIMKGEPYHYNQKNQSKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPANQKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0307401_1043585213300030670MarinePYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKAAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0307401_1043682613300030670MarineIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0307403_1015348713300030671MarineKFHYMQKPAAQKLFATGMNGDEDLAEDITMKGDKFHYIQKPAAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPSAQKLFATGMNGDEDLAEDITMKGDKFHYMQKPASQKLFATGMNGDEDLAEDITMKGDKFHYMQKPANQKLFATGMNGDEDLAEDITMKGDKFHYMQRPAEQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAEEKLFATGMNGDEDLGEDITMKGDKFHYVQKA
Ga0307403_1057071113300030671MarineIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKAAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0307398_1013935523300030699MarineMNGDEDLGQDIIMKGEKFHYNQGKKLAQFATGMNGDEDLGQDIIMKGEKFHYNQNKKLAQFATGMNGDEDLGQDIIMKGEKFHYDQKPANKKLFATGMNGDEDLGQDIIMKGEKFHYNQENAKKLAQFATGMNGDEDLGQDIIMKGEKFHYDQKPADKKLFATGMNGDEDLGQDIIMKGEKFHYQQKPADAKLFATGMNGDEDLG
Ga0307398_1054275913300030699MarineANKLFATGMNGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQTQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0308127_101772113300030715MarineMHPRQPYFATGMNGDEDLGEDIIMKGEPYHYAQKAPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0308127_103385613300030715MarineQFATGMNGDEDLGEDITMKGEPYHYQQKQQKKQALFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0308129_101516223300030723MarineMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0308128_103017313300030725MarineGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0073988_1003561213300030780MarineGDEDLGEDIIMKGEPYHYNQKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKKQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQRPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPAN
Ga0073988_1236109913300030780MarineTGMNGDEDLGEDIIMKGEPYHYNQKKPASQKLFATGMNGDEDLGEDIIMKGEPYHYHQKGQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPGNSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0073988_1236955013300030780MarineEDITMKGDPFHYHGKPAQKKLFATGMNGDEDLGEDITMKGDPFHYHGKPAQKKLFATGMNGDEDLGEDITMKGDPFHYHGKKAPASKKLFATGMNGDEDLGEDITMKGDPFHYHGKKSLAQQKFATGMNGDEDLGEDITMKGDPFHYQAKKSLAQQKFATGMNGDEDLGEDITMKGDPFHYQ
Ga0073982_1000030813300030781MarineMNGDEDLGEDIIMKGKPFHYDQKPAAQKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQKPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPEAHKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQ
Ga0073982_1170903413300030781MarineNGDEDLGEDIIMKGEPFHYNQKKPAAHKLFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKAQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQK
Ga0073990_1201592413300030856MarineMKGKPFHYNQQKPQNLFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQRLFATGMNGDEDLGEDIIMKGKPFHYDQKPNNNKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANSKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGED
Ga0073990_1202637413300030856MarineSCVPDNQFFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKRPAAKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQGKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPAAHKLFATGMNGDEDLGEDIIMKGEPFHYNQKRPAN
Ga0073990_1204541113300030856MarineMNGDEDLGEDIIMKGKPFHYDQKPATQKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSTQKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDEDLGEDIIMKGKPFHYEQKPEAHKLFATGMNGDEDLGEDIIMKGKPFHYNQQKPQQLFATGMNGDED
Ga0073990_1205289613300030856MarineIMKGEPYHYNQKKPAAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPAAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASQKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0073981_1172077213300030857MarineMNGDEDLGEDITMKGDKFHYVQKPAKKALFATGMNGDEDLGEDITMKGDPFHYVQKPANKALFATGMNGDEDLGEDITMKGDKFHYVQKPANKALFATGMNGDEDLGEDITMKGDHFHYVQRPANEKLFATGMNGDEDLGEDITMKGDKFHYVQRPANEKLFATGMNGDEDLGEDITMKGDKFHYVQKQ
Ga0073987_1117517013300030912MarineKLFATGMNGDEDLGEDITMKGDKFHYVQRPSQQKLFATGMNGDEDLGEDITMKGDKFHYVQRPSQQKLFATGMNGDEDLGEDITMKGDKFHYVQRPASQKLFATGMNGDEDLGEDITMKGDKFHYVQRPASQKLFATGMNGDEDLGEDITMKGDKFHYVQRPANEKLFATGMNGDEDLGE
Ga0073987_1119136213300030912MarineEDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPANKKLFATGMNGDEDLGEDIIMKGEPYHYNQKPADKKLTQFATGMNGDEDLGEDIIMKGEPYHYNQK
Ga0073987_1120520713300030912MarineDEDLGEDIIMKGEPFHYNQKRPAAKKLFATGMNGDEDLGEDIIMKGEPFHYNQKKQAKQALFATGMNGDEDLGEDIIMKGEPFHYNQKKPAAHKLFATGMNGDEDLGEDIIMKGEPFHYNQKRPADKKLFATGMNGDEDLGEDIIMKGEPFHYNQKK
Ga0073944_1135063013300030956MarineMNGDEDLGEDIIMKGEPYHYNQKKPLNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKQSKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYHQKRPSNDKLF
Ga0073984_1125975713300031004MarineMNGDEDLGEDIIMKGEPYHYNQKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASQKLFATGMNGDEDLGEDIIMKGEPYHYHQKGQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKKXGGTL
Ga0073980_1000060813300031032MarineEDLGEDIIMKGEPYHYNQKKPAQHKLFATGMNGDEDLGEDIIMKGEPYHYTQKKTASRAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYTQKK
Ga0073986_1203907413300031038MarineSCVPDHQFFATGMNGDEDLGEDIIMKGEPFHYNQKHQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKKPAAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPAAKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASQKLFATGMNGDEDLGEDIIMKGEPYHYNQKRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0073989_1001377213300031062MarineNGDEDLGEDITMKGDKFHYVQRPGAKALFATGMNGDEDLGEDITMKGDKFHYVQRPGAKALFATGMNGDEDLGEDITMKGDKFHYMQKPANKALFATGMNGDEDLGEDITMKGDKFHYVQRPGNDKLFATGMNGDEDLGEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQKQ
Ga0073989_1001577613300031062MarineNGDEDLGEDIIMKGEPYHYNQKKPAAKALFATGMNGDEDLGEDIIMKGEPYHYTQKKAASRAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPGNSKLFATGMNGDEDLGEDIIMKGEPYHYTQKK
Ga0073989_1358193413300031062MarinePASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASQKLFATGMNGDEDLGEDIIMKGEPYHYHQKGQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKRPGNSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0073989_1359148113300031062MarinePDHEYFATGMNGDEDLGEDIIMKGEPYHYNQKKEGSKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKAQKLSQFATGMNGDEDLGEDIIMKGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQK
Ga0073989_1359237113300031062MarineEDLGEDIIMKGEPYHYNQKKPASHKLFATGMNGDEDLGEDIIMKGEPYHYNQKKPASKKLFATGMNGDEDLGEDIIMKGEPYHYNQKAQKKQALFATGMNGDEDLGEDIIMKGEPYHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQRPANSKLFATGMNGDEDLGEDIIMKGEPYHYNQKK
Ga0307388_1020054823300031522MarineQRPANDKLFSTRMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNEKLFATGMNGDEDLGEDIIMKGKPFHYEQKPASDKLFATGMNGDEDLGEDIIMKGKPFHYD
Ga0307388_1088795813300031522MarineEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYAQQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYNQQ
Ga0308143_11592813300031540MarineIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0308143_12132513300031540MarineIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0308149_104359713300031542MarineKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0308134_111622413300031579MarineDHQLFATGMNGDEDLGQDIIMKGKPFHYNQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNG
Ga0307996_110591613300031589MarineDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQKPAQRQLFATGMNGDEDLAEDITMKGDKFHYVQRPAQHKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAQNKLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0302131_112423113300031594MarineATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0302114_1014481113300031621MarineCIPDNQYFATGMNGDEDLGEDIIMKGEPYHYAQKAPTNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0302138_1024694213300031637MarineKSQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0307393_105878913300031674MarineMKGKPFHYNQQKKQALFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYNQQKKQALFATGMNGDEDLGEDIIMKGKPFHYDQKPAANKLFATGMNGDEDLGEDIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQTQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKP
Ga0302130_123312723300031700MarineLGEDIIMKGEPYHYAQKAPLNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYN
Ga0307386_1027751913300031710MarineMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0307381_1024474913300031725MarineATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0307394_1007431413300031735MarineGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPANEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNEKLFATGMNGDEDLGEDIIMKGKPFHYEQKPASDKLFATGMNGDEDLGEDIIMKGKPFHYD
Ga0307384_1048817113300031738MarineITMKGDKFHYVQKPAAQALFATGMNGDEDLGEDITMKGDKFHYVQKPAAQALFATGMNGDEDLAEDITMKGDKFHYMQRPANDKLYATGMNGDEDLGEDITMKGDKFHYMQQRPANDKLYATGMNGDEDLGEDISMKGDKFHYNQKY
Ga0307383_1024719023300031739MarineMNGDEDLGEDIIMKGEPYHYQQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKKXERCLDLTPESQXTIITNREAVHSVI
Ga0307395_1020386723300031742MarineMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKQQKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0307395_1052229313300031742MarineYDQKPAANKLFATGMNGDEDLGEEIIMKGKPFHYTQKKNLAQFATGMNGDEDLGEDIIMKGKPFHYNQQTQKQQALFATGMNGDEDLGEDIIMKGKPFHYEQKPTNNKLFATGMNGDEDLGEDIIMKGKPFHYEQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYEQKPAND
Ga0307382_1029602913300031743MarineMNGDEDLGEDIIMKGEPYHYQQKKNLAQFATGMNGDEDLGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKAAPKKQALFATGMNGDEDLGEDIIMKGEPYHYQQKAAPRPANSKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0307404_1040347613300031752MarineMRSIAILALLDAAFAARLNSCLQTGIDGAGLTCMPPNTQLFSTGMNGDEDLGEDIIMKGKPFHYDQRPANDKLFSTGMNGDEDLGEDIIMKGKPFHYDQKPANDKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNEKLFATGMNGDEDLGEDIIMKGKPFHYDQKPSNEKLFATGMNGDEDLGEDIIMK
Ga0315330_1042921813300032047SeawaterGEPYHYNQKKPTNKKLFATGMNGDEDLGEDIIMKGEPFHYNQKPSNKKLFATGMNGDEDLGEDIIMKGEPYHYNQKRIQSRAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANAKLFATGMNGDEDLGEDIIMKGEPYHYTQKK
Ga0314675_1060038913300032491SeawaterGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDILMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0314689_1030863513300032518SeawaterSAFATGMNGDEDLSEDITMKGDKFHYVQKPAHAKLFATGMNGDEDLAEDITMKGDKFHYVQKPATQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAAKQLFATGMNGDEDLAEDITMKGDKFHYVQKPATKQYFATGMNGDEDLAEDITMKGDKFHYVQRPATQKLFATGMNGDEDLAEDITMKGDKFHYVQRPANDKLFATGMNGDEDLGEDITMKGDKFHYVQRQ
Ga0314687_1069361013300032707SeawaterGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0314690_1049491113300032713SeawaterGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGEPYHYQQKSAKKLAQFATGMNGDEDLGEDILMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKVEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK
Ga0314693_1078770913300032727SeawaterFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0314712_1038944013300032747SeawaterNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0314691_1039305013300032749SeawaterSAFATGMNGDEDLAEDITMKGDKFHYVQKPAHAKLFATGMNGDEDLAEDITMKGDKFHYVQKPATQKLFATGMNGDEDLAEDITMKGDKFHYVQRPAAKQLFATGMNGDEDLAEDITMKGDKFHYVQKPATKQYFATGMNGDEDLAEDITMKGDKFHYVQRPATQKLFATGMNGDEDLAEDITMKGDKFHY
Ga0314708_1039008413300032750SeawaterFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQAPANATLFATGMNGDEDLGQDIIMKGKPFHYNQQKSQALFATGMNGDEDLGQDIIMKGKPFHYNQQPQALFATGMNGDEDLGQDIIMKGKPFHYNQAPANSKLFATGMNGDEDLGQDIIMKGKPFHYNQN
Ga0314692_1056902213300032754SeawaterGEDIIMKGEPYHYNQKKRLAQFATGMNGDEDLGEDIIMKGDPYHYQQKSAKKLAQFATGMNGDEDLGEDIIMKGEPYHYNQKRPANTKLYATGMNGDEDLGEDILMKGEKFHYNQRPADHKLFATGMNGDEDLGEDIIMKGEPYHYVQKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.