NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F007728

Metagenome / Metatranscriptome Family F007728

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F007728
Family Type Metagenome / Metatranscriptome
Number of Sequences 346
Average Sequence Length 38 residues
Representative Sequence LKQHPRWKVDQLPDGTFRWTTPSGRQYDTEPTRYPI
Number of Associated Samples 253
Number of Associated Scaffolds 346

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.89 %
% of genes near scaffold ends (potentially truncated) 92.77 %
% of genes from short scaffolds (< 2000 bps) 88.44 %
Associated GOLD sequencing projects 240
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.347 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.098 % of family members)
Environment Ontology (ENVO) Unclassified
(17.919 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.064 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 18.75%    Coil/Unstructured: 81.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 346 Family Scaffolds
PF08044DUF1707 5.20
PF12680SnoaL_2 4.34
PF04264YceI 2.60
PF00156Pribosyltran 2.31
PF01872RibD_C 2.02
PF00196GerE 1.73
PF09391DUF2000 1.73
PF08241Methyltransf_11 1.45
PF03176MMPL 1.45
PF04073tRNA_edit 1.45
PF00106adh_short 1.45
PF01266DAO 1.16
PF13411MerR_1 1.16
PF04248NTP_transf_9 1.16
PF01243Putative_PNPOx 1.16
PF00005ABC_tran 0.87
PF01370Epimerase 0.87
PF13847Methyltransf_31 0.87
PF08281Sigma70_r4_2 0.87
PF00491Arginase 0.87
PF00535Glycos_transf_2 0.87
PF00440TetR_N 0.87
PF13466STAS_2 0.87
PF13649Methyltransf_25 0.87
PF11716MDMPI_N 0.87
PF07077DUF1345 0.87
PF03636Glyco_hydro_65N 0.87
PF01047MarR 0.87
PF10604Polyketide_cyc2 0.87
PF02627CMD 0.58
PF06053DUF929 0.58
PF00155Aminotran_1_2 0.58
PF13521AAA_28 0.58
PF04909Amidohydro_2 0.58
PF01061ABC2_membrane 0.58
PF13546DDE_5 0.58
PF13228DUF4037 0.58
PF05721PhyH 0.58
PF00111Fer2 0.58
PF00266Aminotran_5 0.58
PF00652Ricin_B_lectin 0.58
PF02467Whib 0.58
PF00920ILVD_EDD 0.58
PF03466LysR_substrate 0.58
PF05368NmrA 0.29
PF13561adh_short_C2 0.29
PF07728AAA_5 0.29
PF03551PadR 0.29
PF00175NAD_binding_1 0.29
PF13602ADH_zinc_N_2 0.29
PF01636APH 0.29
PF13565HTH_32 0.29
PF00392GntR 0.29
PF08327AHSA1 0.29
PF01909NTP_transf_2 0.29
PF02803Thiolase_C 0.29
PF01053Cys_Met_Meta_PP 0.29
PF12681Glyoxalase_2 0.29
PF03704BTAD 0.29
PF02574S-methyl_trans 0.29
PF13977TetR_C_6 0.29
PF10502Peptidase_S26 0.29
PF07508Recombinase 0.29
PF13193AMP-binding_C 0.29
PF02426MIase 0.29
PF00929RNase_T 0.29
PF01145Band_7 0.29
PF03403PAF-AH_p_II 0.29
PF04542Sigma70_r2 0.29
PF05899Cupin_3 0.29
PF13549ATP-grasp_5 0.29
PF04655APH_6_hur 0.29
PF10269Tmemb_185A 0.29
PF03881Fructosamin_kin 0.29
PF12867DinB_2 0.29
PF02254TrkA_N 0.29
PF03625DUF302 0.29
PF05685Uma2 0.29
PF00072Response_reg 0.29
PF00583Acetyltransf_1 0.29
PF05977MFS_3 0.29
PF00230MIP 0.29
PF13360PQQ_2 0.29
PF09335SNARE_assoc 0.29
PF08242Methyltransf_12 0.29
PF07931CPT 0.29
PF00528BPD_transp_1 0.29
PF01521Fe-S_biosyn 0.29
PF0209660KD_IMP 0.29
PF13607Succ_CoA_lig 0.29
PF13676TIR_2 0.29
PF01988VIT1 0.29
PF13340DUF4096 0.29
PF00743FMO-like 0.29
PF01476LysM 0.29
PF00126HTH_1 0.29
PF13185GAF_2 0.29
PF13490zf-HC2 0.29
PF02219MTHFR 0.29
PF00294PfkB 0.29
PF14030DUF4245 0.29
PF00041fn3 0.29
PF06445GyrI-like 0.29
PF01609DDE_Tnp_1 0.29
PF12746GNAT_acetyltran 0.29
PF02661Fic 0.29
PF00248Aldo_ket_red 0.29
PF13560HTH_31 0.29
PF09995MPAB_Lcp_cat 0.29
PF13751DDE_Tnp_1_6 0.29
PF13508Acetyltransf_7 0.29
PF13404HTH_AsnC-type 0.29
PF00361Proton_antipo_M 0.29
PF10042DUF2278 0.29
PF13419HAD_2 0.29
PF01230HIT 0.29

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 346 Family Scaffolds
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 2.60
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 2.02
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 2.02
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 1.45
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 1.45
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 1.16
COG2343Uncharacterized conserved protein, DUF427 familyFunction unknown [S] 1.16
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.87
COG1554Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamilyCarbohydrate transport and metabolism [G] 0.87
COG4291Uncharacterized membrane proteinFunction unknown [S] 0.87
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.58
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.58
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 0.58
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.29
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.29
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.29
COG0316Fe-S cluster assembly iron-binding protein IscAPosttranslational modification, protein turnover, chaperones [O] 0.29
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.29
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.29
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.29
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.29
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.29
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.29
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.29
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.29
COG0646Methionine synthase I (cobalamin-dependent), methyltransferase domainAmino acid transport and metabolism [E] 0.29
COG06855,10-methylenetetrahydrofolate reductaseAmino acid transport and metabolism [E] 0.29
COG0706Membrane protein insertase Oxa1/YidC/SpoIIIJCell wall/membrane/envelope biogenesis [M] 0.29
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.29
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.29
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.29
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.29
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.29
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.29
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.29
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.29
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.29
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.29
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.29
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.29
COG2040Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)Amino acid transport and metabolism [E] 0.29
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.29
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.29
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.29
COG3001Fructosamine-3-kinaseCarbohydrate transport and metabolism [G] 0.29
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.29
COG3293TransposaseMobilome: prophages, transposons [X] 0.29
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.29
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 0.29
COG3570Streptomycin 6-kinaseDefense mechanisms [V] 0.29
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 0.29
COG3896Chloramphenicol 3-O-phosphotransferaseDefense mechanisms [V] 0.29
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 0.29
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.29
COG4188Predicted dienelactone hydrolaseGeneral function prediction only [R] 0.29
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.29
COG4829Muconolactone delta-isomeraseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.29
COG4841Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF familyFunction unknown [S] 0.29
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.29
COG5421TransposaseMobilome: prophages, transposons [X] 0.29
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.29
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.29


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.35 %
UnclassifiedrootN/A19.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_182422Not Available609Open in IMG/M
3300001356|JGI12269J14319_10032668All Organisms → cellular organisms → Bacteria3422Open in IMG/M
3300001356|JGI12269J14319_10075387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1830Open in IMG/M
3300001593|JGI12635J15846_10622499All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300001867|JGI12627J18819_10366457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia584Open in IMG/M
3300003505|JGIcombinedJ51221_10339781All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300003505|JGIcombinedJ51221_10360808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales591Open in IMG/M
3300004092|Ga0062389_100897594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1069Open in IMG/M
3300004152|Ga0062386_100648342All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005169|Ga0066810_10005364All Organisms → cellular organisms → Bacteria1682Open in IMG/M
3300005337|Ga0070682_100507681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales935Open in IMG/M
3300005341|Ga0070691_10273634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales913Open in IMG/M
3300005406|Ga0070703_10179401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales817Open in IMG/M
3300005434|Ga0070709_10411611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1011Open in IMG/M
3300005435|Ga0070714_100049934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3561Open in IMG/M
3300005435|Ga0070714_100903565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales857Open in IMG/M
3300005435|Ga0070714_101549066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia647Open in IMG/M
3300005435|Ga0070714_102044489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii559Open in IMG/M
3300005437|Ga0070710_10237914All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300005437|Ga0070710_10592498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales770Open in IMG/M
3300005451|Ga0066681_10978817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300005467|Ga0070706_100242621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1682Open in IMG/M
3300005468|Ga0070707_100049845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4014Open in IMG/M
3300005534|Ga0070735_10064719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2372Open in IMG/M
3300005541|Ga0070733_10902758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300005541|Ga0070733_10940517All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300005554|Ga0066661_10275100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1040Open in IMG/M
3300005556|Ga0066707_10144736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1502Open in IMG/M
3300005560|Ga0066670_10925643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300005561|Ga0066699_10405182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia976Open in IMG/M
3300005577|Ga0068857_100631959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1013Open in IMG/M
3300005591|Ga0070761_10622013All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005615|Ga0070702_100944260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales678Open in IMG/M
3300005616|Ga0068852_101684631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia656Open in IMG/M
3300005712|Ga0070764_10086160All Organisms → cellular organisms → Bacteria1659Open in IMG/M
3300005764|Ga0066903_105651710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300005764|Ga0066903_106377620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales615Open in IMG/M
3300005921|Ga0070766_11161789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300006028|Ga0070717_10262668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1528Open in IMG/M
3300006028|Ga0070717_11565165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300006046|Ga0066652_100315933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1394Open in IMG/M
3300006052|Ga0075029_100123306All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300006059|Ga0075017_100657484All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300006163|Ga0070715_10441560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia733Open in IMG/M
3300006163|Ga0070715_10687469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia609Open in IMG/M
3300006172|Ga0075018_10580428All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300006173|Ga0070716_100462548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300006173|Ga0070716_100655501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia796Open in IMG/M
3300006175|Ga0070712_100097575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2166Open in IMG/M
3300006175|Ga0070712_100989312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia728Open in IMG/M
3300006175|Ga0070712_101552847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300006176|Ga0070765_100100678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2496Open in IMG/M
3300006176|Ga0070765_100132873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia2198Open in IMG/M
3300006176|Ga0070765_101100122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia751Open in IMG/M
3300006176|Ga0070765_101215405All Organisms → cellular organisms → Bacteria712Open in IMG/M
3300006237|Ga0097621_102319385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300006575|Ga0074053_11764347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia811Open in IMG/M
3300006606|Ga0074062_10017777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae1582Open in IMG/M
3300006755|Ga0079222_11659153Not Available610Open in IMG/M
3300006796|Ga0066665_10703100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia800Open in IMG/M
3300006804|Ga0079221_10269730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia979Open in IMG/M
3300006804|Ga0079221_11267070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales577Open in IMG/M
3300006804|Ga0079221_11271345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300006804|Ga0079221_11736758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300006806|Ga0079220_10177476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1205Open in IMG/M
3300006806|Ga0079220_11822648All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006852|Ga0075433_10389422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1230Open in IMG/M
3300006854|Ga0075425_103016478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300006871|Ga0075434_100398382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1397Open in IMG/M
3300006893|Ga0073928_10119689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2172Open in IMG/M
3300006903|Ga0075426_11313743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300006954|Ga0079219_11733362Not Available580Open in IMG/M
3300009036|Ga0105244_10106690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1366Open in IMG/M
3300009089|Ga0099828_10799809Not Available845Open in IMG/M
3300009090|Ga0099827_11641821All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300009101|Ga0105247_10498940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia886Open in IMG/M
3300009522|Ga0116218_1343868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300009525|Ga0116220_10563950Not Available521Open in IMG/M
3300009545|Ga0105237_10452213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1290Open in IMG/M
3300009551|Ga0105238_10493377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae1225Open in IMG/M
3300009551|Ga0105238_11303036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300009551|Ga0105238_11613229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia679Open in IMG/M
3300009551|Ga0105238_11978562Not Available616Open in IMG/M
3300009628|Ga0116125_1143281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia659Open in IMG/M
3300009698|Ga0116216_10139267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1492Open in IMG/M
3300009792|Ga0126374_10380501Not Available979Open in IMG/M
3300009839|Ga0116223_10708526Not Available578Open in IMG/M
3300010152|Ga0126318_10303863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300010152|Ga0126318_10926204Not Available531Open in IMG/M
3300010335|Ga0134063_10113767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300010335|Ga0134063_10277578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica802Open in IMG/M
3300010343|Ga0074044_10866223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300010359|Ga0126376_11429489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Allokutzneria → unclassified Allokutzneria → Allokutzneria sp. NRRL B-24872717Open in IMG/M
3300010359|Ga0126376_12369686Not Available577Open in IMG/M
3300010366|Ga0126379_10441407All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300010371|Ga0134125_10427149All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300010371|Ga0134125_10655135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1159Open in IMG/M
3300010371|Ga0134125_11249388Not Available811Open in IMG/M
3300010371|Ga0134125_12187401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300010376|Ga0126381_100767817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1382Open in IMG/M
3300010379|Ga0136449_100664525All Organisms → cellular organisms → Bacteria1757Open in IMG/M
3300010379|Ga0136449_102122670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria823Open in IMG/M
3300010396|Ga0134126_10609633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1248Open in IMG/M
3300010396|Ga0134126_12565771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300010876|Ga0126361_10531728Not Available623Open in IMG/M
3300010876|Ga0126361_10749751Not Available563Open in IMG/M
3300010876|Ga0126361_11258292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2168Open in IMG/M
3300012201|Ga0137365_10555526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium843Open in IMG/M
3300012202|Ga0137363_11634681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300012207|Ga0137381_10454288Not Available1118Open in IMG/M
3300012207|Ga0137381_10538171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1019Open in IMG/M
3300012208|Ga0137376_10453982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1112Open in IMG/M
3300012209|Ga0137379_10040238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae4512Open in IMG/M
3300012210|Ga0137378_11212628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces670Open in IMG/M
3300012211|Ga0137377_10095415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2812Open in IMG/M
3300012211|Ga0137377_10441021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1240Open in IMG/M
3300012351|Ga0137386_11008774Not Available592Open in IMG/M
3300012351|Ga0137386_11145730Not Available547Open in IMG/M
3300012356|Ga0137371_10234601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1434Open in IMG/M
3300012360|Ga0137375_10159930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2187Open in IMG/M
3300012360|Ga0137375_10177705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2045Open in IMG/M
3300012360|Ga0137375_11162909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300012532|Ga0137373_10051165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3836Open in IMG/M
3300012532|Ga0137373_10453576All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300012927|Ga0137416_11540351Not Available604Open in IMG/M
3300012958|Ga0164299_10165391Not Available1241Open in IMG/M
3300012961|Ga0164302_10212238Not Available1200Open in IMG/M
3300012975|Ga0134110_10599809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora511Open in IMG/M
3300012985|Ga0164308_10025492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3525Open in IMG/M
3300012987|Ga0164307_11074447Not Available660Open in IMG/M
3300013100|Ga0157373_11011201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300013100|Ga0157373_11328250Not Available545Open in IMG/M
3300013102|Ga0157371_10151930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1652Open in IMG/M
3300013104|Ga0157370_11305429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300013297|Ga0157378_12500498Not Available568Open in IMG/M
3300013306|Ga0163162_13444574All Organisms → cellular organisms → Bacteria → Terrabacteria group504Open in IMG/M
3300013307|Ga0157372_11454333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300013832|Ga0120132_1077527All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes675Open in IMG/M
3300014326|Ga0157380_10272256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1544Open in IMG/M
3300014326|Ga0157380_10670029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1038Open in IMG/M
3300014492|Ga0182013_10000182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria81533Open in IMG/M
3300015373|Ga0132257_100947208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1081Open in IMG/M
3300016341|Ga0182035_10736992Not Available861Open in IMG/M
3300016357|Ga0182032_10435396All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300016357|Ga0182032_10508763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales991Open in IMG/M
3300016357|Ga0182032_11770219All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300016404|Ga0182037_12164792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii501Open in IMG/M
3300016422|Ga0182039_11225651All Organisms → cellular organisms → Bacteria → Terrabacteria group678Open in IMG/M
3300016422|Ga0182039_12205233Not Available508Open in IMG/M
3300017821|Ga0187812_1092755All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300017821|Ga0187812_1251096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300017822|Ga0187802_10125199All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300017926|Ga0187807_1066162Not Available1124Open in IMG/M
3300017928|Ga0187806_1353605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300017932|Ga0187814_10177628Not Available797Open in IMG/M
3300017932|Ga0187814_10375053Not Available551Open in IMG/M
3300017937|Ga0187809_10113610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia ammonioxydans916Open in IMG/M
3300017970|Ga0187783_11121682Not Available566Open in IMG/M
3300017972|Ga0187781_10050050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2875Open in IMG/M
3300017974|Ga0187777_10566749Not Available798Open in IMG/M
3300017975|Ga0187782_10148147All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1745Open in IMG/M
3300017993|Ga0187823_10040702All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300017993|Ga0187823_10358045Not Available521Open in IMG/M
3300018001|Ga0187815_10274117Not Available714Open in IMG/M
3300018012|Ga0187810_10069450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1352Open in IMG/M
3300018034|Ga0187863_10587444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium626Open in IMG/M
3300018034|Ga0187863_10705794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MBRL 10570Open in IMG/M
3300018058|Ga0187766_10509524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii811Open in IMG/M
3300018062|Ga0187784_11047036All Organisms → cellular organisms → Bacteria → Terrabacteria group648Open in IMG/M
3300018062|Ga0187784_11093111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Litchfieldia → Litchfieldia alkalitelluris633Open in IMG/M
3300020002|Ga0193730_1114042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300020579|Ga0210407_10623636Not Available839Open in IMG/M
3300020582|Ga0210395_10597333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. P24828Open in IMG/M
3300020582|Ga0210395_11149481Not Available572Open in IMG/M
3300021171|Ga0210405_10605197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia853Open in IMG/M
3300021180|Ga0210396_10353112All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300021374|Ga0213881_10113866Not Available1174Open in IMG/M
3300021374|Ga0213881_10132739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300021388|Ga0213875_10171738Not Available1018Open in IMG/M
3300021403|Ga0210397_10616050All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300021403|Ga0210397_10817925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora peucetia719Open in IMG/M
3300021403|Ga0210397_10935801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii671Open in IMG/M
3300021405|Ga0210387_10230087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1617Open in IMG/M
3300021407|Ga0210383_10333915All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300021420|Ga0210394_10971968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia737Open in IMG/M
3300021433|Ga0210391_10475869All Organisms → cellular organisms → Bacteria → Terrabacteria group980Open in IMG/M
3300021433|Ga0210391_11231220All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300021477|Ga0210398_10475811Not Available1018Open in IMG/M
3300021477|Ga0210398_10661901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria846Open in IMG/M
3300021478|Ga0210402_10208420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1797Open in IMG/M
3300021478|Ga0210402_11556186Not Available588Open in IMG/M
3300021479|Ga0210410_10170508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1944Open in IMG/M
3300021560|Ga0126371_12848188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300022522|Ga0242659_1090191All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300022527|Ga0242664_1024978Not Available968Open in IMG/M
3300022873|Ga0224550_1066143All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300024176|Ga0224565_1016613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii793Open in IMG/M
3300024225|Ga0224572_1058171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria717Open in IMG/M
3300024249|Ga0247676_1051462Not Available672Open in IMG/M
3300024290|Ga0247667_1008251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2151Open in IMG/M
3300024290|Ga0247667_1022475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora peucetia1214Open in IMG/M
3300024323|Ga0247666_1044757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora peucetia903Open in IMG/M
3300024331|Ga0247668_1103477Not Available577Open in IMG/M
3300025134|Ga0207416_1054198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1653Open in IMG/M
3300025898|Ga0207692_10697698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium659Open in IMG/M
3300025898|Ga0207692_11168254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300025903|Ga0207680_10817551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → Microbispora rosea668Open in IMG/M
3300025904|Ga0207647_10477660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium697Open in IMG/M
3300025905|Ga0207685_10696890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300025906|Ga0207699_11192465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300025913|Ga0207695_10995821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora peucetia718Open in IMG/M
3300025916|Ga0207663_10591258Not Available871Open in IMG/M
3300025919|Ga0207657_10080034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2747Open in IMG/M
3300025919|Ga0207657_10125809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2105Open in IMG/M
3300025921|Ga0207652_10292258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1470Open in IMG/M
3300025922|Ga0207646_10172054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1956Open in IMG/M
3300025922|Ga0207646_11512561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia581Open in IMG/M
3300025928|Ga0207700_10745354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium875Open in IMG/M
3300025928|Ga0207700_10985514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300025928|Ga0207700_11766052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa544Open in IMG/M
3300025929|Ga0207664_11450039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300025949|Ga0207667_11203534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300026078|Ga0207702_10171222Not Available1991Open in IMG/M
3300026078|Ga0207702_11930648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium581Open in IMG/M
3300026116|Ga0207674_10054497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4071Open in IMG/M
3300027050|Ga0209325_1011307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora ureilytica1004Open in IMG/M
3300027064|Ga0208724_1009222All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300027110|Ga0208488_1080827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus526Open in IMG/M
3300027158|Ga0208725_1063938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300027568|Ga0208042_1118053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria669Open in IMG/M
3300027648|Ga0209420_1065681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1065Open in IMG/M
3300027703|Ga0207862_1261769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300027765|Ga0209073_10049451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1375Open in IMG/M
3300027767|Ga0209655_10043840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1496Open in IMG/M
3300027775|Ga0209177_10334044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300027867|Ga0209167_10417952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300027867|Ga0209167_10472550Not Available686Open in IMG/M
3300027903|Ga0209488_10042880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3319Open in IMG/M
3300027908|Ga0209006_10646346Not Available870Open in IMG/M
3300028742|Ga0302220_10043243Not Available1933Open in IMG/M
3300028742|Ga0302220_10075528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1359Open in IMG/M
3300028781|Ga0302223_10020784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2430Open in IMG/M
3300028781|Ga0302223_10043620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1546Open in IMG/M
3300028781|Ga0302223_10067345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1198Open in IMG/M
3300028789|Ga0302232_10376915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. zg-Y820698Open in IMG/M
3300028819|Ga0307296_10377496All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300028824|Ga0307310_10035371All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300028828|Ga0307312_11003339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300028906|Ga0308309_10634621All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300028906|Ga0308309_11543131Not Available566Open in IMG/M
3300029882|Ga0311368_10053253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3680Open in IMG/M
3300029910|Ga0311369_10528096All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300029943|Ga0311340_10382103Not Available1301Open in IMG/M
3300029951|Ga0311371_11295307All Organisms → cellular organisms → Bacteria → Terrabacteria group831Open in IMG/M
3300029997|Ga0302302_1091213Not Available1259Open in IMG/M
3300029999|Ga0311339_11382644Not Available633Open in IMG/M
3300030007|Ga0311338_10219507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2169Open in IMG/M
3300030056|Ga0302181_10167975All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300030056|Ga0302181_10237089Not Available831Open in IMG/M
3300030058|Ga0302179_10074225Not Available1509Open in IMG/M
3300030503|Ga0311370_11987895All Organisms → cellular organisms → Bacteria → Terrabacteria group581Open in IMG/M
3300030520|Ga0311372_10172780All Organisms → cellular organisms → Bacteria → Proteobacteria3683Open in IMG/M
3300030520|Ga0311372_11073947All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300030520|Ga0311372_11425698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia861Open in IMG/M
3300030520|Ga0311372_12757690Not Available541Open in IMG/M
3300030580|Ga0311355_10064833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4215Open in IMG/M
3300030617|Ga0311356_10311958All Organisms → cellular organisms → Bacteria → Terrabacteria group1573Open in IMG/M
3300030618|Ga0311354_11327561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii644Open in IMG/M
3300031027|Ga0302308_10075795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia2354Open in IMG/M
3300031028|Ga0302180_10009192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6863Open in IMG/M
3300031170|Ga0307498_10034123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1276Open in IMG/M
3300031234|Ga0302325_10112157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales5052Open in IMG/M
3300031234|Ga0302325_10223951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3187Open in IMG/M
3300031234|Ga0302325_10460488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1944Open in IMG/M
3300031236|Ga0302324_100170614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Thermasporomyces → Thermasporomyces composti3526Open in IMG/M
3300031236|Ga0302324_100891132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1225Open in IMG/M
3300031543|Ga0318516_10850451Not Available514Open in IMG/M
3300031564|Ga0318573_10066435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1794Open in IMG/M
3300031572|Ga0318515_10268378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria915Open in IMG/M
3300031640|Ga0318555_10156640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1220Open in IMG/M
3300031668|Ga0318542_10503748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300031679|Ga0318561_10692533All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031708|Ga0310686_108298351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia655Open in IMG/M
3300031713|Ga0318496_10332148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300031713|Ga0318496_10725158All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300031713|Ga0318496_10829419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300031715|Ga0307476_10095597Not Available2091Open in IMG/M
3300031723|Ga0318493_10085754All Organisms → cellular organisms → Bacteria → Terrabacteria group1559Open in IMG/M
3300031724|Ga0318500_10695186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300031744|Ga0306918_10744958Not Available766Open in IMG/M
3300031744|Ga0306918_11286213All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031747|Ga0318502_10160748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MP131-181285Open in IMG/M
3300031747|Ga0318502_10989515Not Available513Open in IMG/M
3300031768|Ga0318509_10822989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300031770|Ga0318521_10324169Not Available910Open in IMG/M
3300031771|Ga0318546_10564323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales800Open in IMG/M
3300031778|Ga0318498_10298668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300031779|Ga0318566_10101897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1409Open in IMG/M
3300031782|Ga0318552_10060414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1815Open in IMG/M
3300031793|Ga0318548_10127094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300031793|Ga0318548_10231113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria909Open in IMG/M
3300031795|Ga0318557_10442368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300031796|Ga0318576_10536337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300031799|Ga0318565_10404876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella661Open in IMG/M
3300031819|Ga0318568_10326853All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300031819|Ga0318568_10777825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Phycicoccus594Open in IMG/M
3300031821|Ga0318567_10495990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300031823|Ga0307478_11452990Not Available568Open in IMG/M
3300031846|Ga0318512_10444084Not Available654Open in IMG/M
3300031860|Ga0318495_10156940All Organisms → cellular organisms → Bacteria1026Open in IMG/M
3300031890|Ga0306925_10340189Not Available1612Open in IMG/M
3300031910|Ga0306923_10537600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1318Open in IMG/M
3300031939|Ga0308174_10904341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300031941|Ga0310912_10446637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300031962|Ga0307479_11548060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300032001|Ga0306922_11855287Not Available592Open in IMG/M
3300032009|Ga0318563_10020742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3202Open in IMG/M
3300032009|Ga0318563_10512227Not Available648Open in IMG/M
3300032010|Ga0318569_10291366Not Available759Open in IMG/M
3300032025|Ga0318507_10029219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella aluminosa2041Open in IMG/M
3300032025|Ga0318507_10159083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales968Open in IMG/M
3300032043|Ga0318556_10611932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii568Open in IMG/M
3300032043|Ga0318556_10654727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300032055|Ga0318575_10732135Not Available500Open in IMG/M
3300032065|Ga0318513_10508467Not Available590Open in IMG/M
3300032065|Ga0318513_10591583All Organisms → cellular organisms → Bacteria → Terrabacteria group543Open in IMG/M
3300032066|Ga0318514_10083681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1597Open in IMG/M
3300032066|Ga0318514_10435197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300032067|Ga0318524_10130382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1262Open in IMG/M
3300032067|Ga0318524_10454118All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300032067|Ga0318524_10790900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300032180|Ga0307471_103743407All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300032205|Ga0307472_100882541Not Available826Open in IMG/M
3300032828|Ga0335080_11812888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300032954|Ga0335083_10005479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia15992Open in IMG/M
3300032954|Ga0335083_10125664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2469Open in IMG/M
3300032955|Ga0335076_10175448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2052Open in IMG/M
3300032955|Ga0335076_10697797Not Available896Open in IMG/M
3300033134|Ga0335073_10444283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1501Open in IMG/M
3300033134|Ga0335073_11705514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300033158|Ga0335077_11720950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus carbonis592Open in IMG/M
3300033289|Ga0310914_11055266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300033290|Ga0318519_10052809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2038Open in IMG/M
3300033290|Ga0318519_10814099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia575Open in IMG/M
3300034163|Ga0370515_0408027Not Available573Open in IMG/M
3300034163|Ga0370515_0432677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.10%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.07%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.89%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.89%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.89%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.60%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.02%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.02%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.02%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.73%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.45%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.16%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.16%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.87%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.87%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.58%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.58%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.58%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.58%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.58%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.58%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.58%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.58%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.29%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.29%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.29%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.29%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.29%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.29%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.29%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.29%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.29%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.29%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.29%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013832Permafrost microbial communities from Nunavut, Canada - A3_5cm_0MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017993Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024249Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17EnvironmentalOpen in IMG/M
3300024290Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027050Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027064Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_034203502199352024SoilHRLKQHPKWKVDQLPDGTFRWPTPSGRQYTTEPTRYPT
JGI12269J14319_1003266853300001356Peatlands SoilMQAFSEVPADHRVKQDPRWKVEQLTPAVIRWITPAGRQYTTEPTRYPI*
JGI12269J14319_1007538723300001356Peatlands SoilMTTGSQDPRWKVEQLPSGDFQWTSPSGRRCTTEPTRYPV*
JGI12635J15846_1062249913300001593Forest SoilHCHRMKQDPRWKAEHLPGGQVRWTMPSGRQYVTEPTRYPI*
JGI12627J18819_1036645713300001867Forest SoilHRLKQHPKWHVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
JGIcombinedJ51221_1033978123300003505Forest SoilKCRFDHRVKQDPRWKVEQLPSGEVRWTMPSGRQYTTEPTRYPI*
JGIcombinedJ51221_1036080823300003505Forest SoilPKCRCDHRMKQDPRWKAEQLPNGEVRWTMPSGRQYVTEPTRYPV*
Ga0062389_10089759423300004092Bog Forest SoilDHRLKQHPKWTVEQIPPATFRWTAPSGRSCTTEATRYPI*
Ga0062386_10064834233300004152Bog Forest SoilMQAECRHDHRLKQDPRWKVEQISPATFRWTAPSGRSCTTEATRYPI*
Ga0066810_1000536433300005169SoilMSAGHRLKQDPRWKVDQLRDGTFRWTTPSGRTYTTEPTRYPI*
Ga0070682_10050768113300005337Corn RhizosphereDHRLKQHPKWKVDQLPDGTFRWTTPTGRSYDTEPTRYPI*
Ga0070691_1027363413300005341Corn, Switchgrass And Miscanthus RhizosphereDHRLKQHPRWKVDQLPDGTFRWTTPSGRQYTTEPTRYPT*
Ga0070703_1017940133300005406Corn, Switchgrass And Miscanthus RhizosphereKVSADHRLKQHPKWKVDQLPDGTFRWTTPSGRTFAAEPTRYPI*
Ga0070709_1041161123300005434Corn, Switchgrass And Miscanthus RhizosphereVIIRLKQQPQWNVDQLPDGTFRWTTPSGRDYITEPTRTPV*
Ga0070714_10004993463300005435Agricultural SoilMTTDSKQQPQWKVEQLPDGTFRWTTPSGRDYTTEPTRYPI*
Ga0070714_10090356533300005435Agricultural SoilMPEVSHDHRLKQQPGWTVDQLPDGTFGGTTPAGRSYDTEPT
Ga0070714_10154906613300005435Agricultural SoilDHRLKQDPRWHVDQLPDGTFRWTTPTGRQYTTEPTRYPI*
Ga0070714_10204448913300005435Agricultural SoilVSTDHRLKQQPGWTVDQLPDGTFRWTTPAGRSYDTEPTRHSI*
Ga0070710_1023791433300005437Corn, Switchgrass And Miscanthus RhizosphereMTTGSQQPQWKVEQLPDGTFRWTTPSGRDYTTEPTRYPI*
Ga0070710_1059249823300005437Corn, Switchgrass And Miscanthus RhizosphereMITGSQQPGWKVDQLPDGTFRWTIPAGRTYDTEPTRYPV*
Ga0066681_1097881713300005451SoilMTTGSKQHPKWKVDQLPDGTFRWIAPSGRQYTTEPTRYPT*
Ga0070706_10024262113300005467Corn, Switchgrass And Miscanthus RhizosphereVITLKQDPRWKVDQLPDATFLWTTPTGRQYITEPTRYPV*
Ga0070707_10004984513300005468Corn, Switchgrass And Miscanthus RhizosphereHDHRLKQHPKWKVDQLPDGTFRWTTPTGRSYDTEPTRYPI*
Ga0070735_1006471913300005534Surface SoilLKQHPKWTVDQLPDGTFRWTTPAGRTYTTEPTRYPI*
Ga0070733_1090275823300005541Surface SoilDHRMKQDPRWNSEQLPGGYVRWTMPSGRQHVTEPTRYPI*
Ga0070733_1094051713300005541Surface SoilMKQDPRWNSEQLPGGYVRWTMPSGRQHVTEPTRYPI*
Ga0066661_1027510023300005554SoilLKQHPRWKVDQLPDGTFRWTTPSGRTYTTEPTRYPD*
Ga0066707_1014473613300005556SoilMIILKQQPGWTVDQLPDGTFRWTTPSGRSYDTEPTRYPI*
Ga0066670_1092564313300005560SoilRHDHRLKQHPKWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0066699_1040518233300005561SoilKQHPRWKVDQLPDGTFRWTTPTGRSYDTEPTRYPI*
Ga0068857_10063195913300005577Corn RhizosphereLKQQPGWTVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0070761_1062201323300005591SoilRVKQHPRWRVDQLPDGTVRWTTPAGRQYTKEPARYPI*
Ga0070702_10094426033300005615Corn, Switchgrass And Miscanthus RhizosphereDHRLKQHPKWNVDQLPDGTFRWTTPAGRIYTTEPTRYPI*
Ga0068852_10168463123300005616Corn RhizosphereHDHRLKQHPKWKVDQFPDGTFRWTTPAGRQYTTEPTRYPI*
Ga0070764_1008616013300005712SoilEHRLKQDPRWKVEQITPGTFRRTAPSGRQYTTEPTRYPI*
Ga0066903_10565171013300005764Tropical Forest SoilRHDHRLKQHPKWRVDQLPDGTFRWTTPAGRSYETEPTRYPI*
Ga0066903_10637762023300005764Tropical Forest SoilDHRLKQDPRWTVDQFADGTFQWTTPTGRRYLTEPTRYPV*
Ga0070766_1116178923300005921SoilQHPRWKVEQLPDGTFQWTAPSGRQYLTEPTRYPI*
Ga0070717_1026266813300006028Corn, Switchgrass And Miscanthus RhizosphereDPKCRSDHRMKQDPRWRTEQPPNGYVCWTMPSGWQDITEPARYPI*
Ga0070717_1156516513300006028Corn, Switchgrass And Miscanthus RhizosphereMPSDHRLKQHPRWKVDQLPEDVPLDHPAGRTYETEPTRYPV*
Ga0066652_10031593323300006046SoilMAVRSVGVIIGSQDPRWTVDQLPDGTFRWTTPTGRQYTTEPTRYPI*
Ga0075029_10012330613300006052WatershedsFDHRIKQDPRWKAEQLPNGNVQWTTPSGRQYVTEPTRYPI*
Ga0075017_10065748423300006059WatershedsMKQDPRWQAEQLPNGDVRWTTPSGRQYTTQPTRHPI*
Ga0070715_1044156023300006163Corn, Switchgrass And Miscanthus RhizosphereKQDPRWTVDQLPDGRFRWTTPTGRQYTTEPTRYPV*
Ga0070715_1068746913300006163Corn, Switchgrass And Miscanthus RhizosphereQHPKWNVDQLPDGTFRWTTPAGRTYTTEPTRYPI*
Ga0075018_1058042813300006172WatershedsMSADHRLKQHPRWKVDQLPDGTFRWTTPAGRSYETEPTRYPI*
Ga0070716_10046254833300006173Corn, Switchgrass And Miscanthus RhizosphereQHPKWRVDQLPDGTFRWTTPSGRTYTSEPTRYPI*
Ga0070716_10065550123300006173Corn, Switchgrass And Miscanthus RhizosphereLKQQPGWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0070712_10009757523300006175Corn, Switchgrass And Miscanthus RhizosphereMITGSKQQPGWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0070712_10098931213300006175Corn, Switchgrass And Miscanthus RhizospherePQCRHDHKLKQHPKRKVDQLSDGTVRWTTPSGRTPTTEPTRYPV*
Ga0070712_10155284713300006175Corn, Switchgrass And Miscanthus RhizosphereLKQHPRWKVEQLPDGTFRWTNPSGRTYTTEPTRYPI*
Ga0070765_10010067843300006176SoilMKQDPRWKAEQLPSGDVRWTTPSGRQSVTERTRYPI*
Ga0070765_10013287313300006176SoilQDPRWKVEQPAPAIIRWRTPAGRLYSTEPTRYPT*
Ga0070765_10110012213300006176SoilQDSRWQAEQLENGNIRWTMPSGRQYVTEPTRYPT*
Ga0070765_10121540513300006176SoilMKQHPRWKAEHLPAGEIRWTTPSGRQHTTEPTRYPV*
Ga0097621_10231938513300006237Miscanthus RhizosphereLKQHPKWKVDQLPDGTFRWTTPSGRTYTTEPTRYPI*
Ga0074053_1176434723300006575SoilPKCRHDHRLKQHPKWKVDQLPDGTSVLDHPSRADLTTEPTRYPI*
Ga0074062_1001777713300006606SoilRYDHRLKQHPKWKVDQLPDGTFRWSTPSGRQYTTEPTRYPA*
Ga0079222_1165915323300006755Agricultural SoilMSCRHDHKLEQHPHWKADQLPDGTVRWTTRSGRSYTTE
Ga0066665_1070310013300006796SoilHDHRLKQDPRWKVDQLPDGTFRWTTPTGRQYITEPTLYPV*
Ga0079221_1026973023300006804Agricultural SoilMTTGSQQPGWKVDQLPDGTFRWTTPSGRDYITEPTRYPI*
Ga0079221_1126707013300006804Agricultural SoilKQHPKWKVDQLADGTFRWTTPSGRQYTTEPTRCPT*
Ga0079221_1127134513300006804Agricultural SoilKQHPRWTVAQLPDGTFRWTTPAGRTYTTEPTRYPI*
Ga0079221_1173675823300006804Agricultural SoilMITGSQQPRWNVEQLPDGTFRWTTPSGRDYTTEPTRYPI*
Ga0079220_1017747613300006806Agricultural SoilHRLKQQPGWKVDQLPDGTFRWTTPAGRSYETEPTRYPI*
Ga0079220_1182264813300006806Agricultural SoilRDHRLKQDPRWKVDRLPDGTFQWTTPTGRTFSTELTRYPI*
Ga0075433_1038942223300006852Populus RhizosphereMTTGSQQPGWTVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0075425_10301647823300006854Populus RhizosphereKQHPKWTVDQLPDGTFHWTTPAGRQYTTEPTRYPI*
Ga0075434_10039838213300006871Populus RhizosphereDHRLKQHPKWKVDQLPDGTFRWTTPSGRTYTAGPTRYPI*
Ga0073928_1011968943300006893Iron-Sulfur Acid SpringDHRLKQHPGWNSEHLADGSVRWTMPSGRKYTTEPTRYPV*
Ga0075426_1131374323300006903Populus RhizosphereLKQHPEWKVEQLPDGTFRWTTPSGRQYTTEPTRYPV*
Ga0079219_1173336223300006954Agricultural SoilLKQHPRWKVDQLPDGTFRWTTPSGRQYDTEPTRYPI*
Ga0105244_1010669013300009036Miscanthus RhizosphereHRLKQQPGWTVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0099828_1079980913300009089Vadose Zone SoilQDPRWNVDQLPDSTFRWTTPSGRHYTKEPTRYPI*
Ga0099827_1164182113300009090Vadose Zone SoilQHPRWNVEQLADGTFRWTTPSGRQYTTESTRYPT*
Ga0105247_1049894013300009101Switchgrass RhizosphereHRLKQHPQWTVDQLPDGTFRWTTPSGRSYDTEPTRYPI*
Ga0116218_134386823300009522Peatlands SoilDHRLKQHLRWKADQLPGGTFRWTAPSGRQYVTEATRYPI*
Ga0116220_1056395013300009525Peatlands SoilQHPGWTVEHLADGTIRWTMPSGRQYTTEPARYPV*
Ga0105237_1045221313300009545Corn RhizosphereLKQQPGWKVDQLPDGTFRWTTPAGRSYYTEPTRYPI*
Ga0105238_1049337713300009551Corn RhizosphereQADPKWHVDQLPDGTFRWTTPAGRAYDTEPTRYPI*
Ga0105238_1130303613300009551Corn RhizosphereQQPGWTVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0105238_1161322923300009551Corn RhizosphereLKQHPQWTVDQLPDGTFRWTTPSGRSYDTEPTRYPI*
Ga0105238_1197856213300009551Corn RhizosphereKQHPQWTVDQLPDGTFRWTTPSGRSYDTEPTRYPI*
Ga0116125_114328113300009628PeatlandKQHPRWNCEQITPGTFRWTAPSGRQYTTEPTRYPI*
Ga0116216_1013926723300009698Peatlands SoilFDHRVKQDPRWKVEQLPSGEIRWTTPSGRQYVTEPTRYPI*
Ga0126374_1038050113300009792Tropical Forest SoilKQHPKWKVDQLPDGTFRWTTPAGRIYTTEPTRYPI*
Ga0116223_1070852623300009839Peatlands SoilEHRLKQDPRWTVEQLTPATFRWTTPSGRQYTTEPTRYPI*
Ga0126318_1030386323300010152SoilHRLKQHPRWTVDQLPDGTFRWTTPSGRTYTTEPTRYPI*
Ga0126318_1092620413300010152SoilLKQHPKWTVDQLPDGTFRWTTPSGRQYTTEPTRYPT*
Ga0134063_1011376713300010335Grasslands SoilHRLKQHPRWHVDQLPDGTFRWTTPSGRQYATEPTRYPT*
Ga0134063_1027757813300010335Grasslands SoilLKQDPRWTVDQLFDGTFRWTAPTGRQYITEPTRYPV*
Ga0074044_1086622313300010343Bog Forest SoilTCRHDHRLKQHPRWKVEQITPGTFRRTAPSGRQYDTEPTRYPI*
Ga0126376_1142948913300010359Tropical Forest SoilRLKQHPKWKVEQLPDGTFRWTTPVGRTYTTEPTRYPI*
Ga0126376_1236968623300010359Tropical Forest SoilLKQHPKWHVDQLPNGTFRWTTPSGRQYTTEPTRYPV*
Ga0126379_1044140713300010366Tropical Forest SoilKQDPRWKVDQLPDGTFRWTTPAGRTYTTEPTRYPI*
Ga0134125_1042714913300010371Terrestrial SoilKQQPGWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0134125_1065513533300010371Terrestrial SoilKQHPKWKVDQLPDGTFRWTTPSGRTYTTEPTRYPI*
Ga0134125_1124938813300010371Terrestrial SoilKQHPKWKVDQLADGTFRWTTPSGRQYTTEPTRYPM*
Ga0134125_1218740113300010371Terrestrial SoilHRLKQQPGWTVEQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0126381_10076781713300010376Tropical Forest SoilQHPRWKADQLPDGTYRWTTPSGRTYTTEPTRYPI*
Ga0136449_10066452533300010379Peatlands SoilIKQDPRWKVEQITPAVLRWTTPSGRQYETEPTRYPI*
Ga0136449_10212267013300010379Peatlands SoilMPKCRHDHWFKQHPRWKAGQLPGGTFRWTTSSGGQHGTEPAR
Ga0134126_1060963313300010396Terrestrial SoilKQQPGWKVDQLPDGTFRWTTPSGRTYDTEPTRYPV*
Ga0134126_1256577113300010396Terrestrial SoilKQHPRWTVDQLPDGTFRWTTPSGRTYTTEPTRYPI*
Ga0126361_1053172823300010876Boreal Forest SoilRHEHRLKQDPRWTVEQPTPATFRWTTPSGRQYTTEPTRYPI*
Ga0126361_1074975113300010876Boreal Forest SoilQHPRWKAEQLPDGTFQWTTPSGRQYLTEPTRYPI*
Ga0126361_1125829213300010876Boreal Forest SoilEHRLKQDPRWTVEQPTPATFRWTTPSGRQYTTEPTRYPI*
Ga0137365_1055552613300012201Vadose Zone SoilKQQPGWKVEQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0137363_1163468113300012202Vadose Zone SoilHRLKQQPGWTVDQLPDGTFRWTTPAGRSYDTEPTRYPT*
Ga0137381_1045428813300012207Vadose Zone SoilRVKQHPRWTVDQLPDGTFRWTTPSGRAYTTEPTRYPI*
Ga0137381_1053817113300012207Vadose Zone SoilQQPGWKVEQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0137376_1045398233300012208Vadose Zone SoilLKQNPRWHVDQLPDGTFRWTTPSGRQYATEPTRYPT*
Ga0137379_1004023813300012209Vadose Zone SoilLKQQPGWTVEQLPDGTFRWTTPAGRSYDTEPTRYPV*
Ga0137378_1121262823300012210Vadose Zone SoilQHPKWNVDQLPDGTFQWTTPSGRRYTTEPTRYPI*
Ga0137377_1009541513300012211Vadose Zone SoilLKQHPRWKVDQLPDATFRWTTPSGRTYTTEPTRYPI*
Ga0137377_1044102113300012211Vadose Zone SoilQHPGWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0137386_1100877413300012351Vadose Zone SoilKQHPKWTVDQLPDGTFRWTTPADRAYGTEPTRYPI*
Ga0137386_1114573013300012351Vadose Zone SoilQHPKWTVDQLPDGTFRWTTPSGRTYTTEPTRYPI*
Ga0137371_1023460113300012356Vadose Zone SoilRLKQHPKWKVDQLPDSTFQWTTPSGRQYTTEPTRYPT*
Ga0137375_1015993013300012360Vadose Zone SoilHRLKQHPKWTVDQLPDGTFRWITPSRRSYDTEPTRYPI*
Ga0137375_1017770533300012360Vadose Zone SoilYDHRLKQHPKWKVDQLPDSTFQWTTPSGRQYTTEPTRYPT*
Ga0137375_1116290913300012360Vadose Zone SoilHRLKQQPGWTVEQLPDGTFRWTTPAGRSYDTEPTRYPM*
Ga0137373_1005116563300012532Vadose Zone SoilLKQRPRWQVDQLPDGTFRWTTPAGRTYTTEPTRYPI*
Ga0137373_1045357613300012532Vadose Zone SoilHDHRLKQQPGCTVEQLPDGTFRWTTPTGRSYDTEPTRYPI*
Ga0137416_1154035123300012927Vadose Zone SoilKQDPRWTVDQLPDGTFRWTTPTGRQYTTEPTRYPV*
Ga0164299_1016539113300012958SoilKQHPKWKVDQLPDGTFRWTTPAGRTYTTEPTRYPI*
Ga0164302_1021223813300012961SoilLKQHPKRKVDQLPDGTFRWTTPAGRTYTTEPTRYPR*
Ga0134110_1059980913300012975Grasslands SoilKQDPRWTVDQLLDGTFRWTAPTGRQYITEPTRYPV*
Ga0164308_1002549273300012985SoilLKQHPKWTVDQLPDGTFRWTTPSGRTYTTEPTRYPI*
Ga0164307_1107444713300012987SoilQHPKWHVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0157373_1101120123300013100Corn RhizosphereDHKLKQHPKWKVDQLPDGALRWTTPSGGQSTTEPTRYPI*
Ga0157373_1132825013300013100Corn RhizosphereKQHPRWKVEQLPDGTFRWTTPSGRTYTAEPTRCPI*
Ga0157371_1015193013300013102Corn RhizosphereRYDHRLKQHPRWKVDQLPDGTFRWTTPSGRQYTTEPTRYPT*
Ga0157370_1130542913300013104Corn RhizosphereHRLKQQPGWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0157378_1250049813300013297Miscanthus RhizosphereKQHPKWKVDQLPDGTFRWTTPSGRTYITEPTRYPI*
Ga0163162_1344457413300013306Switchgrass RhizosphereQQPGWTVEQLADGTFRWTTPAGRSYDTEPTRYPI*
Ga0157372_1145433313300013307Corn RhizosphereKQQPGWTVDQLPDGTFRWTTPAGRSYDTEPTRYPI*
Ga0120132_107752713300013832PermafrostHRVKQHPRWKVDQLPDGTFRWTTPSGRTYTTEPTRYPI*
Ga0157380_1027225613300014326Switchgrass RhizosphereRLKQHPKWKVDQLPDGTFRWTTPWGRTYATEPTSYPI*
Ga0157380_1067002913300014326Switchgrass RhizosphereQQPGWKVDQLPDGTFRWITPAGRSYDTEPTRYPI*
Ga0182013_1000018213300014492BogRLKQDPRWNVEQITPATFRWTTPSGRQYTTEATRYPI*
Ga0132257_10094720813300015373Arabidopsis RhizosphereHEHRLKQDPRWNVEQHPGGTFTWTTPSGRQYTTEPTEYPI*
Ga0182035_1073699213300016341SoilKQDPRWKADQLPDGTFRWTTPSGRQYTTEPTRYPI
Ga0182032_1043539633300016357SoilDHRLKQDPRWKAEQLPTGEVRWTTPSGRQYVTEPTRYPI
Ga0182032_1050876333300016357SoilRLKQHPKWTVDQLPDGTFRWTTPAGRTYTTEPTRYPI
Ga0182032_1177021913300016357SoilRHDHRIKQDPRWKVEQLPSGEVRWTMPSGRQYVTEPTRYPV
Ga0182037_1216479223300016404SoilLKQDPRWNAEQLPTGQVRWTTPSGRQYTTEPTRYPV
Ga0182039_1122565123300016422SoilHRLKQHPRWNAEQLPDGNIRWTTPSGRQYITEPTRYPI
Ga0182039_1220523323300016422SoilDHRLKQDPRWKAEQLPSGEVRWTTPSGRQFVTEPTRYPI
Ga0187812_109275513300017821Freshwater SedimentPKCRFDRLKQDPRWTAEQLPSGEIRWTTPSGRQYATEPTRYPI
Ga0187812_125109623300017821Freshwater SedimentKQDPRWLAEQLENGSVRWITPSGRQYTTEPTRYPI
Ga0187802_1012519923300017822Freshwater SedimentFDRLKQDPRWTAEQLPSGEIRWTTPSGRQYVTEPTRYPI
Ga0187807_106616233300017926Freshwater SedimentKQHPRWKTEKLAGGGVRWTMPSGRQYVTEPTRYPV
Ga0187806_135360513300017928Freshwater SedimentFDHRLKQDPRWTAEQLPSGHVRWTMPSGRQYTTEPTRYPI
Ga0187814_1017762813300017932Freshwater SedimentRHDHRVKQHPRWHVDQLPDGNVRWTTPAGRQYTKEPARYPI
Ga0187814_1037505333300017932Freshwater SedimentVKQDPRWKCEQLPSGEVRWTTPSGRQYTTEPTRYPI
Ga0187809_1011361023300017937Freshwater SedimentMRTCGRLKQHPKWTVDQLPDGTFRWTAPSGRTYTTEPTRYPI
Ga0187783_1112168233300017970Tropical PeatlandMKQDPRWTAEHLPSGAVRWTTPSGRQYTTEPTRYPI
Ga0187781_1005005033300017972Tropical PeatlandKQDPRWQAEQLPSGDVRWSTPSGRRYTTEPTRYPI
Ga0187777_1056674913300017974Tropical PeatlandHRLKQHPRWKVEQITPATVRWTTPSGRQWTTEPTRYPV
Ga0187782_1014814713300017975Tropical PeatlandHDHRIKQDPRWKVEQLPGGHVLWTTPSGRQYATEPTRYPI
Ga0187823_1004070213300017993Freshwater SedimentKQHSRWKAEQLPGGEVRWTTPSGRQYVVEPTRYPI
Ga0187823_1035804513300017993Freshwater SedimentHRVKQDPRWKAEQLPSGEVRWTTPSGRQYTTEPTRYPI
Ga0187815_1027411713300018001Freshwater SedimentHDHRVKQHPRWQVDQLPDGSVLWTTPAGRQYTTEPTRYPI
Ga0187810_1006945023300018012Freshwater SedimentVKQHPRWHVDQLPDGTVRWTTPAGRQYTKEPTRYPI
Ga0187863_1058744413300018034PeatlandHRLKQHPRWNVEQVTPATFLWTTPAGLQYSTEATRYPI
Ga0187863_1070579423300018034PeatlandLKQHPRWNCEQITPGTFRWTAPSGRQYTTEPTRYPI
Ga0187766_1050952433300018058Tropical PeatlandLKQHPRWKVEQITPDTVRWTTPTGRQYTTEPTCYPI
Ga0187784_1104703623300018062Tropical PeatlandFDHRLKQDPRWKAEQLPSGHVRWTTPSGRQYVTEPTRYPI
Ga0187784_1109311113300018062Tropical PeatlandIKQDPRWKVDQLPDGRLHWTTPSGRRYTTEPTRYPT
Ga0193730_111404213300020002SoilHRLKQQPGWTIDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0210407_1062363623300020579SoilLRQHPRGTVDQLPDGTFRWTTPAGRTYDTEPTRYPI
Ga0210395_1059733323300020582SoilHDHRLKQHPRWNAERLPGGYVRWTMPSGRQYLTEPTRYPV
Ga0210395_1114948123300020582SoilLKQHPRWHVDQLPDGTFRWTTPSGRQYTAEPTRYPL
Ga0210405_1060519713300021171SoilLKQDPRWNAEQLDNGNVRWTTPSGRQHTTEPTRYPI
Ga0210396_1035311223300021180SoilHDHRLKQHPKWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0213881_1011386623300021374Exposed RockKQHPRWHAEQLADGTFQWTAPSGRQYTTEPTRYPI
Ga0213881_1013273933300021374Exposed RockKQHPRWNVEQLASGQFRWVTPSGRQYTTEPTRYPV
Ga0213875_1017173813300021388Plant RootsHRLKQDPRFTVEQPTPGTVVWTAPSGRQYATEPTRYPI
Ga0210397_1061605033300021403SoilRAPLSRWKVEQLPDGTFQWTTPSGRQCLTEPTRYPI
Ga0210397_1081792533300021403SoilKQHPKWKVDQLPDGTFRWTTPAGRTYTTEPTRYPI
Ga0210397_1093580113300021403SoilLKQHPRWNAERLPGGYVRWTTPSGRQYVTEPTRYPV
Ga0210387_1023008713300021405SoilLKQHPKWKVEQLADGTFRWTTPSGRQYTTEPTRYPI
Ga0210383_1033391513300021407SoilHRLKQHPRWKSEHLADGTIQWTMPSGRHHTTEPTRYPI
Ga0210394_1097196823300021420SoilRFDHRMKQDPRWKAEQLPNGDVRWTTPSGRQSVTERTRYPI
Ga0210391_1047586913300021433SoilRMKQDPRWNAEQLPGGYLRWTAPSGRQYLTEPTRYPI
Ga0210391_1123122013300021433SoilRHDHRLKQHPHWNAEQLDNGYIRWTAPWGRQYVTEPTRYPI
Ga0210398_1047581113300021477SoilDHRLKQHPRWKVEQITPGTFRRTAPSGRQYITEPTRYPI
Ga0210398_1066190133300021477SoilRFDHRMKQDPRWKVEQLPSGEVQWTTPSGRQCTTEPTRYPT
Ga0210402_1020842043300021478SoilRLKQHPKWHVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0210402_1155618613300021478SoilLKQQPGWTVAQLSGGTFRWTTPAGRSYDTEPTRYPI
Ga0210410_1017050843300021479SoilHDHRLMQHPKWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0126371_1284818813300021560Tropical Forest SoilKQHPKWQVDQLPDGTFRWTTPSGRSYHTEPTRYPI
Ga0242659_109019113300022522SoilFDHRMKQDPRWKADQLPGGYVRWTAPSGRQYVTEPTRYPI
Ga0242664_102497813300022527SoilRRDHRLKQHPRWNAEQLPGGQVRWTLPSGRQHVTEPTRYPI
Ga0224550_106614323300022873SoilGSCFICHRMKQDPLWKAEQLPGGYIEWTAPSGRQYVTEPTRYPI
Ga0224565_101661313300024176Plant LitterLEHRLKQDPRWNVEQVTPGTFRWTVPSGRQYTTEPTRYPI
Ga0224572_105817113300024225RhizosphereKQHPRWKVEQLTPATFRWTTPSGRQYLTEPTRYPI
Ga0247676_105146213300024249SoilKQHPKWKVDQLADGTFRWTTPSGRQYTTEPTRYPT
Ga0247667_100825113300024290SoilHDHRLKQHPKWTVDQLPDGTFRWTTPAGRQYTTEPTRYPI
Ga0247667_102247533300024290SoilHRLKQHPKWNVDQLPDGTFRWTTPAGRIYTTEPTRYPI
Ga0247666_104475733300024323SoilDHRLKQHPRLNRDQLPDGTFRWTTPAGRIYTTEPTRYPI
Ga0247668_110347723300024331SoilLKQDPRWKVDQLRDGTFRWTTPSGRTYTTEPTRYPI
Ga0207416_105419813300025134Iron-Sulfur Acid SpringHRLKQHPRWNAEQLPDGSVRWITPAGRRYTTEPTRYPV
Ga0207692_1069769813300025898Corn, Switchgrass And Miscanthus RhizosphereHRLKQQPHWNVDQLPDGTFRWTTPSGRDYVTEPTRYPV
Ga0207692_1116825413300025898Corn, Switchgrass And Miscanthus RhizosphereKQQPRWKVDQLPDGTFRWTTPSGRDYITEPTRYPI
Ga0207680_1081755113300025903Switchgrass RhizosphereKQQPGWTVDQLPDGTFRWTTPAGRSYYTEPTRYPI
Ga0207647_1047766013300025904Corn RhizosphereDHRLKQQPGWTVEQLPDGTFRWTTAAGRQYTTEPTRYPI
Ga0207685_1069689013300025905Corn, Switchgrass And Miscanthus RhizosphereHRLKQHPRWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0207699_1119246513300025906Corn, Switchgrass And Miscanthus RhizosphereHDHKLKQHPRWKADQLPDGTFRWTTPSGRQYTTKPTRYPI
Ga0207695_1099582133300025913Corn RhizosphereDHRLKQHPKWNVDQLPDGTFRWTTPAGRIYTTEPTRYPI
Ga0207663_1059125833300025916Corn, Switchgrass And Miscanthus RhizosphereKQQPGWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0207657_1008003443300025919Corn RhizosphereHRLKQHPQWTADQLPNGTFRWTTPSGRSYDTEPTRYPI
Ga0207657_1012580943300025919Corn RhizosphereLKQHPKWRVDQLPDGTFRWTTPSGRSYTTEPTRYPI
Ga0207652_1029225823300025921Corn RhizosphereRLKQQPGWTVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0207646_1017205413300025922Corn, Switchgrass And Miscanthus RhizosphereRLKQHPNWTVDQLPDGSFTWITPAGRTYTTEPTRYPI
Ga0207646_1151256123300025922Corn, Switchgrass And Miscanthus RhizosphereKQQPGWTVDQLPDGTFRWTTPSGRSYDTEPTRYPI
Ga0207700_1074535413300025928Corn, Switchgrass And Miscanthus RhizosphereHDHRLKQHPRWHVDQLPDGTFRWTTPSGRDYITEPTRYPV
Ga0207700_1098551413300025928Corn, Switchgrass And Miscanthus RhizosphereHRLKQHPKWKVEQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0207700_1176605223300025928Corn, Switchgrass And Miscanthus RhizosphereMKQDPRWKVDQLPDGTFRWAAPAGRTYTTEPTRYPN
Ga0207664_1145003923300025929Agricultural SoilRLKQQPGWKVEQFPDGTFRWTTPAGRSYDTEPTRYPI
Ga0207667_1120353413300025949Corn RhizosphereDHRLKQHLRWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0207702_1017122233300026078Corn RhizosphereHRLKQHPRWKVDQLPDGTFRWTTPSGRQYTTEPTRYPT
Ga0207702_1193064813300026078Corn RhizosphereKQQPRWKVEQLPDGTFRWTTPSGRDYITEPTRYPI
Ga0207674_1005449753300026116Corn RhizosphereHRLKQHPKWTVDQLPDGTFRWTTPAGRQYTTEPTRYPI
Ga0209325_101130723300027050Forest SoilKQHPKWKVDQLPDGTFRWTTPTGRQYTTEPTRYPV
Ga0208724_100922213300027064Forest SoilDHRMKQDPRWKAEQLPGGYVRWTTPSGRQYVTELTRYPI
Ga0208488_108082723300027110Forest SoilKQHPGWKVEQITPGTFRRTAPSGRQYTTEPTRYPI
Ga0208725_106393813300027158Forest SoilDHRMKQEPRWQAEQLPSGEVRWTMPSGRQYTTEPTRYPI
Ga0208042_111805313300027568Peatlands SoilHRLKQHPRWHVDQLPDGTFRWTTPAGRQYTAEPTRYPI
Ga0209420_106568113300027648Forest SoilFDHRVKQDPRWQAEQLENGNIRWTMPSGRQYVTEPTRYPT
Ga0207862_126176913300027703Tropical Forest SoilSTLAPKCRHDHRRKQDPRWQADQLPSGEVRWTTLSARQYTAEPTRYHI
Ga0209073_1004945113300027765Agricultural SoilKQHPKWTVDQLPDGTFRWTTPSGRTYTTEPTRYPI
Ga0209655_1004384013300027767Bog Forest SoilKQHPRWNAEQLPGGYVRWTAPSGRQYVTEPTRYPI
Ga0209177_1033404413300027775Agricultural SoilKQQPGWKVDQLPDGTFRWTTPSGRDYLTEPTRYPI
Ga0209167_1041795213300027867Surface SoilHRLKQHPGWTAEHLADGSVRWTMPSGRQYTTEPTRYPI
Ga0209167_1047255023300027867Surface SoilDHRLKQHPGWTAEHLADGSVRWTMPSGRQYTTEPTRYPI
Ga0209488_1004288043300027903Vadose Zone SoilRLKQHPRWKVEQPTPGTIRWTTPSGRHSTTEPTRYPI
Ga0209006_1064634623300027908Forest SoilHRMKQHPRWNAEQIPGGYIRWTAPSGRQYVTEPTRYPI
Ga0302220_1004324313300028742PalsaRLKQDPRWKVEQITPGTFRWTAPSGRQYTTEPTRYPI
Ga0302220_1007552813300028742PalsaRHDHRLKQHPKWKVEQITPGTFRRTPPSGRQYTTEPTRYPI
Ga0302223_1002078443300028781PalsaKQHPKWKVEQITPGTFRRTAPSGRQYTTEPTRYPI
Ga0302223_1004362013300028781PalsaHEHRLKQDPRWKVEQITPATFRWTAPSGRQYTTEPTRYPI
Ga0302223_1006734533300028781PalsaRLKQDPRWKVEQITPGTLRWTAPSGRQYTTEPTRYPI
Ga0302232_1037691523300028789PalsaHDHRLKQHPRWKVEQITPGTYRRTAPSGRQYITEPTRYPI
Ga0307296_1037749613300028819SoilKQQPGWTVDQLPDGTFRWTTPAGRSYHTEPTRYPI
Ga0307310_1003537143300028824SoilKQDPRWTVDQLRDGTFRWTTPSGRTYTTEPTRYPV
Ga0307312_1100333923300028828SoilRLKQDPRWTVDQLPDGTFRWTTPTGRQYTTEPTRYPV
Ga0308309_1063462113300028906SoilRFDHRMKQDPRWNAEQLPNGDVRWTTPSGRRYVTERTRYPL
Ga0308309_1154313113300028906SoilRVKQDSRWQAEQLENGNIRWTMPSGRQYVTEPTRYPT
Ga0311368_1005325363300029882PalsaRLKQHPKWKVEQITPGTFLRTAPSGRQYTTEPTRYPI
Ga0311369_1052809613300029910PalsaLKQDPRWKVEQITPGTLRWTAPSGRQYTTEPTRYPI
Ga0311340_1038210313300029943PalsaHRLKQHPKWKVEQITPGTFRRTAPSGRQYTTEPTRYPI
Ga0311371_1129530713300029951PalsaRHDHRLKQHPKWKVEQITPGTFRRTAPSGRQYTTEPTRYPI
Ga0302302_109121333300029997PalsaRLKQHPKWKVEQITPGTFRRTAPSGRQYTTEPTRYPI
Ga0311339_1138264423300029999PalsaRHDHRLKQHPNWKVEQITPGTFRRTAPSGRQYTTEPTRYPI
Ga0311338_1021950733300030007PalsaRMKQDPRWKAEHLPGGFIEWTMPSGRQHVTEPTRYPI
Ga0302181_1016797513300030056PalsaGTPRHPRWKAEQITPATFRWTTPSGRQYLTEPTRYSI
Ga0302181_1023708923300030056PalsaDHRLKQHPRGKVEQITPGIFRRTAPSGRQYTTEPTRYPI
Ga0302179_1007422533300030058PalsaTCRHDHRLKQHPKWKVEQITPGTFLRTAPSGRQYTTEPTRYPI
Ga0311370_1198789513300030503PalsaRLKQHPRWKVEQITPAIFRWTTPSGRQYLTEPTRYPI
Ga0311372_1017278053300030520PalsaLKQHPRWKVEQITPGTFRRTAPSGRQYTTEPTRYPI
Ga0311372_1107394713300030520PalsaRHEHRLKQHPRWKAEQITPATFRWTTPSGRQYLTEPTRYSI
Ga0311372_1142569833300030520PalsaKQHPKWKVEQITPGTFRRTPPSGRQYTTEPTRYPI
Ga0311372_1275769013300030520PalsaHDHRLKQHPKWKVEQITPGTFRRTAPSGRQYTTEPTRYPI
Ga0311355_1006483343300030580PalsaTCRHDHRLKQHPRWKVEQITPGTYRRTAPSGRQYITEPTRYPI
Ga0311356_1031195823300030617PalsaRLKQHPRWKAEQITPATFRWTTPSGRQYLTEPTRYSI
Ga0311354_1132756123300030618PalsaIKQHPKWKVEQITPGTFRRTAPSGRQYTTEPTSYPN
Ga0302308_1007579553300031027PalsaRHEHRIKQHPRWKVEQITPATFRWTTPSGRQYTTEPTRYPI
Ga0302180_1000919213300031028PalsaEHRLKQHPRWKAEQITPATFRWTTPSGRQYLTEPTRYPI
Ga0307498_1003412313300031170SoilLKQHPKWKVDQLPDGTFRWTTPSGRTYITEPTRYPI
Ga0302325_1011215713300031234PalsaHRLKQHPRWKAEQITPATFRWTTPSGRQYLTEPTRYPI
Ga0302325_1022395113300031234PalsaCHRMKQDPRWKAEQLPSGQVRWTMPSGRQHVTEPTRYPI
Ga0302325_1046048823300031234PalsaVKQDPRWQAEQLENGNIRWTMPSGRQYVTEPTRYPT
Ga0302324_10017061413300031236PalsaHEHRLKQHPRWKAEQITPATFRWTTPSGRQYLTEPTRYSI
Ga0302324_10089113223300031236PalsaKQDPRWKVEQLTPGTFRWTTPSGRQYTTEPTRYPM
Ga0318516_1085045123300031543SoilLKQHPGWNVDQLPDGTFRWTTPAGRSYTTEPTRYPI
Ga0318573_1006643533300031564SoilLKQDPRWSAEQLPTGEVRWTTPSGRQYVTEPTRYPI
Ga0318515_1026837833300031572SoilHDHRLKQQSGWKVDQLPDRTFRWTTPAGRSYDTEPTRYPV
Ga0318555_1015664023300031640SoilLKQHPRWHVEQRADGTFRWTTPAGRSYDTEPTRYPI
Ga0318542_1050374813300031668SoilRLKQRPRWHVEQRADGTFRWTTPAGRSYDTEPTRYPI
Ga0318561_1069253313300031679SoilDHRLKQHPKWKVDQLPDGTFRWTTPAGRTCTTEPTRYPI
Ga0310686_10829835123300031708SoilFDHRVKQDPRWKVEQLPSGQVRWTMPSGRRHVTEPTRYPI
Ga0318496_1033214813300031713SoilLKQHPKWAVVQLPDGTFRWTTPAGRAYTTEPTRYPI
Ga0318496_1072515813300031713SoilHRLKQDPRWQAEQLPNGNVRWTTPAGRQYTTEPTRYPI
Ga0318496_1082941913300031713SoilLKQHPKWTVVQLPDGTFRWTTPAGRSYATEPTRYPV
Ga0307476_1009559713300031715Hardwood Forest SoilKQDPRWNAEQLPGGYVRWTTPSGRQYVTEPTRYPV
Ga0318493_1008575443300031723SoilVKQDPRWQAEQLPNGNVRWTTPAGRQYTTEPTRYPI
Ga0318500_1069518613300031724SoilRFDHRVKQDPRWKAEQLPNGNVRWTTPAGRQYTTEPTRYPI
Ga0306918_1074495823300031744SoilKQNPRWKVEQLPNGDVRWTTPSGRQYTTEPTRYPI
Ga0306918_1128621323300031744SoilKQDPRWKADQLPNGEVRWTTPSGRQYITEPTRYPI
Ga0318502_1016074813300031747SoilHRIKQNPRWKVEQLPNGDVRWTTPSGRQYTTEPTRYPI
Ga0318502_1098951523300031747SoilFKQHPGWKVDQLPDGTFRWTTSSGRTYTTEPTRYPI
Ga0318509_1082298913300031768SoilCRHDHRLKQHPMWHVDQLPDGTFWWTTPPGRQYDTEPTRYSI
Ga0318521_1032416913300031770SoilLKQDPRWNVEQLPTGDVRWTTPSGRQYVTEPTRYPI
Ga0318546_1056432333300031771SoilLKQHPKWNVDQLPDGTFRWTTPAGRSYTTEPTRYPI
Ga0318498_1029866823300031778SoilHRLKQHPRWKADQPSPGVIQWTTPSGRQYTTEPTRYPI
Ga0318566_1010189733300031779SoilRYDHRLKQHPRWKADQPSPGVIQWTTPSGRQYTTEPTRYPI
Ga0318552_1006041413300031782SoilLKQHPRWKVEQLPSAEFRWTTPSGRHYTTEPTRHPV
Ga0318548_1012709423300031793SoilHRVKQDPRWTVEQLENGNVRWTTPSGRQHTTEPTRYPI
Ga0318548_1023111323300031793SoilDHRMKQDPRWQADQLPSGHVRWTTPSGRQYTTEPTRHPI
Ga0318557_1044236823300031795SoilFDHRLKQDPRWKVEQQANAEVRWTTPGGRRYVTEPTRYPI
Ga0318576_1053633723300031796SoilLKQQPGWKVDQLPDGTFRWTTPSGRSYDTEPTRYPI
Ga0318565_1040487613300031799SoilLKQDPRFTVEQPTPGTFRWTAPSGRSYTTEPTRYPI
Ga0318568_1032685313300031819SoilGNPKCRFDHRLKQDPRWKVEQQANAEVRWTTPGGRRYVTEPTRYPI
Ga0318568_1077782523300031819SoilDHRLKQHPKWTVDQLPDGTFRWTTPAGRIYTTEPTRYPI
Ga0318567_1049599023300031821SoilRFDHRLKQDPRWKADQLPNGEVRWTTPSGRQYTTEPTRYPI
Ga0307478_1145299013300031823Hardwood Forest SoilHRLKQDPRWNATQLPGGYVRWTMPTGRQYVTEPTRYPI
Ga0318512_1044408423300031846SoilVKQDPRWKAEQLPNGNVRWTTPAGRQYTTEPTRYPI
Ga0318495_1015694023300031860SoilLKQQPGWTVDQLPDGSFRWTTPSGRSYDTEPTRYPI
Ga0306925_1034018923300031890SoilRLKQCPKWKVDQCPDGTFRWTTPSGRTYTTEPTRYPI
Ga0306923_1053760013300031910SoilKQHPRWHVDQLADGTFRWTTPARRTYTTEPTRYPI
Ga0308174_1090434113300031939SoilMTTSSSSRPRWTVDQLPDGIFRWTTPSGRDYITEPTRTPT
Ga0310912_1044663713300031941SoilKQQPGWKVDQFPDGTFRWTTPAGRSYDTEPTRYPI
Ga0307479_1154806013300031962Hardwood Forest SoilRLKQHPRWKVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0306922_1185528723300032001SoilKQDPRWTSEQLPNGNVRWTNPSGRQYVTEPTRYPI
Ga0318563_1002074213300032009SoilRRFDHRLKQDPRWTAEQLPTGDIRWTTPSGRQYVTEPTRYPI
Ga0318563_1051222713300032009SoilLKQHPKWTVEQLPDGTFRWTTPSGRSYDTEPTRYPV
Ga0318569_1029136613300032010SoilLKQDPRFTVEQLPGGTFRWTAPAGRQYTTEPTRYPI
Ga0318507_1002921913300032025SoilAAMITGLKQQPGWTVDQLPDGTFRWTTPSGRSYDTEPTRYPI
Ga0318507_1015908333300032025SoilLKQHPRWTVDQLPDGTFRWTTPAGRSYTTEPTRYPI
Ga0318556_1061193223300032043SoilVKQDPRWKVEQLPNGQVLWTTPSGRQYSTEPTRYPI
Ga0318556_1065472723300032043SoilCVCDDSPGCRHDHRLKQHPMWHVDQLPDGTFWWTTPPGRQYDTEPTRYSI
Ga0318575_1073213523300032055SoilCRHDHRLKQHPKWHVDQLPDGTFRRTTPSGRQYDTEPTRYPI
Ga0318513_1050846723300032065SoilKQDPRWKVDQLPDGTFRWTTPSGRRYTTEPTRYPI
Ga0318513_1059158323300032065SoilKQDPRWTAEQLPTGDIRWTTPSGRQYVTEPTRYPI
Ga0318514_1008368113300032066SoilRLKQHPRWKAEQPSPGIIVWTTPAGRQYTTEPTRYPI
Ga0318514_1043519723300032066SoilHRLKQHLGWTVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0318524_1013038233300032067SoilLKQRPRWHVEQRADGTFRWTTPAGRSYDTEPTRYPI
Ga0318524_1045411823300032067SoilVTQHPGWTVDQLPGGTFRWTAPSGRQYTKEPTCYPV
Ga0318524_1079090023300032067SoilHRIKQHFRWKVDQLPDGTFRWTTPSGRQYTTEPTRYP
Ga0307471_10374340713300032180Hardwood Forest SoilERAHPKWHVDQLPDGTFRWTTPTGRTHTTEPTRYPT
Ga0307472_10088254113300032205Hardwood Forest SoilKQHPRWTVEQLADGTFRWTTPAGRSYDTEPTRYPI
Ga0335080_1181288813300032828SoilKQHPKWTVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0335083_10005479203300032954SoilHDHRLKQHPRWKVEQLPDGTFRWTTPSGRDYITEPTRYPI
Ga0335083_1012566493300032954SoilKQHPRWKVDQLPDGTFRWTTPSGRTCTTEPTRYPI
Ga0335076_1017544813300032955SoilMAPRLKHPKWTVDQLPDGTFRWTTPAGRTYTAEPTRYPI
Ga0335076_1069779723300032955SoilLKQHPKWTVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0335073_1044428313300033134SoilHRLKQHPRWHAEQLPDGTFRWTTPSGRQYVTETTRYPI
Ga0335073_1170551413300033134SoilHRLKQQPGWNVDQLPDGTFRWTTPAGRSYDTEPTRYPI
Ga0335077_1172095013300033158SoilLKQDRRWTVDLLPDGTVRWIAPSGRSYTKEPTRYPT
Ga0310914_1105526613300033289SoilKQHPRWHVEQHADGTFRWTTPAGRSYDTEPTRYPI
Ga0318519_1005280933300033290SoilHRLKQDPRWSAEQLPTGEVRWTTPSGRQYVTEPTRYPI
Ga0318519_1081409923300033290SoilLKQDPRWKADQLPNGEVRWTTPSGRQYTTEPTRYPI
Ga0370515_0408027_2_1093300034163Untreated Peat SoilKQHPRWKVEQITPATFRRTAPSGRQYTTEPTRYPI
Ga0370515_0432677_430_5553300034163Untreated Peat SoilRHDHRLKQHPRWKVEQITPGTFRRTAPSGRQYTTEPTRYPI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.