Basic Information | |
---|---|
Family ID | F007471 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 350 |
Average Sequence Length | 43 residues |
Representative Sequence | QKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Number of Associated Samples | 275 |
Number of Associated Scaffolds | 350 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 46.86 % |
% of genes near scaffold ends (potentially truncated) | 40.00 % |
% of genes from short scaffolds (< 2000 bps) | 81.14 % |
Associated GOLD sequencing projects | 254 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.714 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.429 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.143 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.286 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.84% β-sheet: 0.00% Coil/Unstructured: 56.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 350 Family Scaffolds |
---|---|---|
PF02627 | CMD | 24.29 |
PF01663 | Phosphodiest | 16.86 |
PF02597 | ThiS | 5.43 |
PF00296 | Bac_luciferase | 4.29 |
PF03243 | MerB | 2.86 |
PF13561 | adh_short_C2 | 2.57 |
PF00144 | Beta-lactamase | 2.29 |
PF02738 | MoCoBD_1 | 2.29 |
PF01042 | Ribonuc_L-PSP | 2.00 |
PF00275 | EPSP_synthase | 1.71 |
PF05638 | T6SS_HCP | 1.71 |
PF02668 | TauD | 1.43 |
PF00501 | AMP-binding | 1.14 |
PF00496 | SBP_bac_5 | 1.14 |
PF13193 | AMP-binding_C | 1.14 |
PF00106 | adh_short | 0.86 |
PF10282 | Lactonase | 0.86 |
PF02335 | Cytochrom_C552 | 0.86 |
PF01979 | Amidohydro_1 | 0.57 |
PF01546 | Peptidase_M20 | 0.57 |
PF00892 | EamA | 0.57 |
PF01522 | Polysacc_deac_1 | 0.57 |
PF13565 | HTH_32 | 0.57 |
PF00230 | MIP | 0.57 |
PF03404 | Mo-co_dimer | 0.57 |
PF00248 | Aldo_ket_red | 0.57 |
PF03328 | HpcH_HpaI | 0.57 |
PF02769 | AIRS_C | 0.57 |
PF10518 | TAT_signal | 0.57 |
PF02515 | CoA_transf_3 | 0.57 |
PF10417 | 1-cysPrx_C | 0.57 |
PF00072 | Response_reg | 0.29 |
PF04392 | ABC_sub_bind | 0.29 |
PF00300 | His_Phos_1 | 0.29 |
PF07859 | Abhydrolase_3 | 0.29 |
PF03480 | DctP | 0.29 |
PF01243 | Putative_PNPOx | 0.29 |
PF00486 | Trans_reg_C | 0.29 |
PF01494 | FAD_binding_3 | 0.29 |
PF07486 | Hydrolase_2 | 0.29 |
PF00211 | Guanylate_cyc | 0.29 |
PF03446 | NAD_binding_2 | 0.29 |
PF07969 | Amidohydro_3 | 0.29 |
PF02776 | TPP_enzyme_N | 0.29 |
PF01894 | UPF0047 | 0.29 |
PF01028 | Topoisom_I | 0.29 |
PF04909 | Amidohydro_2 | 0.29 |
PF00990 | GGDEF | 0.29 |
PF01799 | Fer2_2 | 0.29 |
PF08352 | oligo_HPY | 0.29 |
PF11716 | MDMPI_N | 0.29 |
PF09994 | DUF2235 | 0.29 |
PF14791 | DNA_pol_B_thumb | 0.29 |
PF00753 | Lactamase_B | 0.29 |
PF07690 | MFS_1 | 0.29 |
PF12867 | DinB_2 | 0.29 |
PF01425 | Amidase | 0.29 |
PF12973 | Cupin_7 | 0.29 |
PF02894 | GFO_IDH_MocA_C | 0.29 |
PF08282 | Hydrolase_3 | 0.29 |
PF00561 | Abhydrolase_1 | 0.29 |
COG ID | Name | Functional Category | % Frequency in 350 Family Scaffolds |
---|---|---|---|
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 24.29 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 24.29 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 5.43 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 5.43 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.29 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 2.29 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.29 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 2.29 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 2.00 |
COG3157 | Type VI protein secretion system component Hcp (secreted cytotoxin) | Intracellular trafficking, secretion, and vesicular transport [U] | 1.71 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.43 |
COG3303 | Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit | Inorganic ion transport and metabolism [P] | 0.86 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.57 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.57 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.57 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.57 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.57 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.57 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.57 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.29 |
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.29 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.29 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.29 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.29 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.29 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.29 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.29 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.29 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.29 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.29 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.29 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.29 |
COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 0.29 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.29 |
COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.29 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.71 % |
Unclassified | root | N/A | 2.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_11364671 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101700885 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300000955|JGI1027J12803_109354482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 921 | Open in IMG/M |
3300000956|JGI10216J12902_108077629 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300002561|JGI25384J37096_10114410 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300002561|JGI25384J37096_10249074 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300002886|JGI25612J43240_1013329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1216 | Open in IMG/M |
3300002886|JGI25612J43240_1064233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
3300002909|JGI25388J43891_1014310 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300002914|JGI25617J43924_10167371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
3300004019|Ga0055439_10191833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
3300004024|Ga0055436_10092099 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300004052|Ga0055490_10244871 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300004268|Ga0066398_10160573 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300004463|Ga0063356_100331804 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
3300004463|Ga0063356_102891595 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300004479|Ga0062595_101111423 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300004480|Ga0062592_102056723 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005093|Ga0062594_100195795 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300005093|Ga0062594_102755770 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005180|Ga0066685_10104453 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
3300005205|Ga0068999_10017461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1045 | Open in IMG/M |
3300005206|Ga0068995_10060315 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300005295|Ga0065707_10042339 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300005295|Ga0065707_10478204 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300005328|Ga0070676_10027264 | All Organisms → cellular organisms → Bacteria | 3238 | Open in IMG/M |
3300005332|Ga0066388_100069649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3813 | Open in IMG/M |
3300005332|Ga0066388_100342883 | All Organisms → cellular organisms → Bacteria | 2140 | Open in IMG/M |
3300005332|Ga0066388_103098200 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300005334|Ga0068869_100015229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5154 | Open in IMG/M |
3300005336|Ga0070680_100075032 | All Organisms → cellular organisms → Bacteria | 2783 | Open in IMG/M |
3300005345|Ga0070692_10054669 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
3300005356|Ga0070674_101494483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 607 | Open in IMG/M |
3300005406|Ga0070703_10013859 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
3300005440|Ga0070705_100674988 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300005444|Ga0070694_100562923 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300005445|Ga0070708_100447275 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
3300005445|Ga0070708_102092545 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005467|Ga0070706_101243690 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300005471|Ga0070698_100246214 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
3300005471|Ga0070698_101022798 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300005471|Ga0070698_101704642 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300005518|Ga0070699_100404777 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300005518|Ga0070699_101726865 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005526|Ga0073909_10627934 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005536|Ga0070697_100272857 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
3300005540|Ga0066697_10064434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2096 | Open in IMG/M |
3300005545|Ga0070695_100049288 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
3300005545|Ga0070695_100599073 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300005549|Ga0070704_100627472 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300005553|Ga0066695_10074526 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
3300005568|Ga0066703_10506344 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300005574|Ga0066694_10051645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1872 | Open in IMG/M |
3300005586|Ga0066691_10001062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10259 | Open in IMG/M |
3300005586|Ga0066691_10066132 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1972 | Open in IMG/M |
3300005617|Ga0068859_100077617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3362 | Open in IMG/M |
3300005713|Ga0066905_100058199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2412 | Open in IMG/M |
3300005764|Ga0066903_100160227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3260 | Open in IMG/M |
3300005764|Ga0066903_100549409 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
3300005764|Ga0066903_102902976 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300005764|Ga0066903_103538755 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300005829|Ga0074479_10307350 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300005843|Ga0068860_100655088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1058 | Open in IMG/M |
3300005844|Ga0068862_100191494 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
3300006034|Ga0066656_10068976 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
3300006049|Ga0075417_10076179 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1492 | Open in IMG/M |
3300006049|Ga0075417_10167209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
3300006050|Ga0075028_100096945 | All Organisms → cellular organisms → Bacteria | 1499 | Open in IMG/M |
3300006358|Ga0068871_101897134 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300006806|Ga0079220_11221039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
3300006844|Ga0075428_100018578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7683 | Open in IMG/M |
3300006844|Ga0075428_100627744 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300006845|Ga0075421_100131049 | All Organisms → cellular organisms → Bacteria | 3144 | Open in IMG/M |
3300006845|Ga0075421_100149264 | All Organisms → cellular organisms → Bacteria | 2921 | Open in IMG/M |
3300006845|Ga0075421_101998791 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300006847|Ga0075431_101011420 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300006852|Ga0075433_10914638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 765 | Open in IMG/M |
3300006853|Ga0075420_100297795 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300006854|Ga0075425_100567912 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
3300006880|Ga0075429_101196826 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300006894|Ga0079215_10178936 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300006903|Ga0075426_11531622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
3300006904|Ga0075424_100103556 | All Organisms → cellular organisms → Bacteria | 3002 | Open in IMG/M |
3300006914|Ga0075436_100163100 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300006918|Ga0079216_10239020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
3300006954|Ga0079219_10228823 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300007255|Ga0099791_10138952 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1132 | Open in IMG/M |
3300007265|Ga0099794_10030765 | All Organisms → cellular organisms → Bacteria | 2509 | Open in IMG/M |
3300007265|Ga0099794_10137200 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1237 | Open in IMG/M |
3300009012|Ga0066710_100090758 | All Organisms → cellular organisms → Bacteria | 4037 | Open in IMG/M |
3300009012|Ga0066710_102356453 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300009012|Ga0066710_103581669 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
3300009038|Ga0099829_10337293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1240 | Open in IMG/M |
3300009089|Ga0099828_10004017 | All Organisms → cellular organisms → Bacteria | 10335 | Open in IMG/M |
3300009089|Ga0099828_10565114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1025 | Open in IMG/M |
3300009090|Ga0099827_11249626 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300009100|Ga0075418_11174325 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300009100|Ga0075418_12605134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 552 | Open in IMG/M |
3300009100|Ga0075418_13024951 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
3300009101|Ga0105247_11318511 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300009147|Ga0114129_10034060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7195 | Open in IMG/M |
3300009147|Ga0114129_12387694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
3300009147|Ga0114129_13065148 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 547 | Open in IMG/M |
3300009148|Ga0105243_12373532 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
3300009157|Ga0105092_10633276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 619 | Open in IMG/M |
3300009162|Ga0075423_10103031 | All Organisms → cellular organisms → Bacteria | 2987 | Open in IMG/M |
3300009176|Ga0105242_12793906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
3300009792|Ga0126374_10024591 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
3300009792|Ga0126374_10328464 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1039 | Open in IMG/M |
3300009802|Ga0105073_1010002 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 844 | Open in IMG/M |
3300009804|Ga0105063_1007150 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1116 | Open in IMG/M |
3300009814|Ga0105082_1025250 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 921 | Open in IMG/M |
3300009816|Ga0105076_1075505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 632 | Open in IMG/M |
3300009820|Ga0105085_1005273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2152 | Open in IMG/M |
3300010043|Ga0126380_10103600 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
3300010043|Ga0126380_10363954 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1059 | Open in IMG/M |
3300010046|Ga0126384_10509015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1039 | Open in IMG/M |
3300010046|Ga0126384_10720666 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 886 | Open in IMG/M |
3300010304|Ga0134088_10337523 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 731 | Open in IMG/M |
3300010336|Ga0134071_10216600 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 947 | Open in IMG/M |
3300010358|Ga0126370_10270921 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300010358|Ga0126370_10748752 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 865 | Open in IMG/M |
3300010360|Ga0126372_10100549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2173 | Open in IMG/M |
3300010360|Ga0126372_10162125 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1806 | Open in IMG/M |
3300010361|Ga0126378_11899654 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 678 | Open in IMG/M |
3300010362|Ga0126377_11108643 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 860 | Open in IMG/M |
3300010366|Ga0126379_10090977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2680 | Open in IMG/M |
3300010366|Ga0126379_11404158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 804 | Open in IMG/M |
3300010371|Ga0134125_10882717 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 982 | Open in IMG/M |
3300010376|Ga0126381_101275298 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300010376|Ga0126381_103754336 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 594 | Open in IMG/M |
3300010391|Ga0136847_10247606 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 703 | Open in IMG/M |
3300010399|Ga0134127_10041705 | All Organisms → cellular organisms → Bacteria | 3745 | Open in IMG/M |
3300010400|Ga0134122_11360969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 721 | Open in IMG/M |
3300011414|Ga0137442_1119670 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300011427|Ga0137448_1202908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 550 | Open in IMG/M |
3300011436|Ga0137458_1201976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 604 | Open in IMG/M |
3300011437|Ga0137429_1030181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1559 | Open in IMG/M |
3300012040|Ga0137461_1043189 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1212 | Open in IMG/M |
3300012134|Ga0137330_1062279 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 500 | Open in IMG/M |
3300012164|Ga0137352_1029585 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1048 | Open in IMG/M |
3300012174|Ga0137338_1020768 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1287 | Open in IMG/M |
3300012189|Ga0137388_10977333 | Not Available | 781 | Open in IMG/M |
3300012202|Ga0137363_10948251 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
3300012203|Ga0137399_10862342 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300012203|Ga0137399_11423587 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300012205|Ga0137362_10111107 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2317 | Open in IMG/M |
3300012205|Ga0137362_10142991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2041 | Open in IMG/M |
3300012225|Ga0137434_1059928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 590 | Open in IMG/M |
3300012355|Ga0137369_10952665 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 573 | Open in IMG/M |
3300012361|Ga0137360_10290809 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1354 | Open in IMG/M |
3300012362|Ga0137361_11187892 | Not Available | 685 | Open in IMG/M |
3300012899|Ga0157299_10237895 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 570 | Open in IMG/M |
3300012917|Ga0137395_10964308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 613 | Open in IMG/M |
3300012917|Ga0137395_11068234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 574 | Open in IMG/M |
3300012922|Ga0137394_10106663 | All Organisms → cellular organisms → Bacteria | 2364 | Open in IMG/M |
3300012925|Ga0137419_11267271 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300012927|Ga0137416_11101836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 712 | Open in IMG/M |
3300012929|Ga0137404_10009884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6575 | Open in IMG/M |
3300012929|Ga0137404_10717826 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300012930|Ga0137407_10066776 | All Organisms → cellular organisms → Bacteria | 2981 | Open in IMG/M |
3300012930|Ga0137407_10558041 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1073 | Open in IMG/M |
3300012930|Ga0137407_10608453 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1026 | Open in IMG/M |
3300012930|Ga0137407_11845123 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 576 | Open in IMG/M |
3300012931|Ga0153915_10161733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2434 | Open in IMG/M |
3300012931|Ga0153915_10811906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1085 | Open in IMG/M |
3300012944|Ga0137410_10352325 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1177 | Open in IMG/M |
3300012944|Ga0137410_11800582 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300012948|Ga0126375_12040600 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300012961|Ga0164302_11674021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 532 | Open in IMG/M |
3300012971|Ga0126369_12867963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 564 | Open in IMG/M |
3300012976|Ga0134076_10009691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3260 | Open in IMG/M |
3300012986|Ga0164304_11019841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
3300014326|Ga0157380_11415624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 746 | Open in IMG/M |
3300014867|Ga0180076_1092091 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 558 | Open in IMG/M |
3300014882|Ga0180069_1095005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 706 | Open in IMG/M |
3300014883|Ga0180086_1160651 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 585 | Open in IMG/M |
3300015241|Ga0137418_10091970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2739 | Open in IMG/M |
3300015264|Ga0137403_10131758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2482 | Open in IMG/M |
3300015264|Ga0137403_10198478 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1940 | Open in IMG/M |
3300015264|Ga0137403_10751718 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 833 | Open in IMG/M |
3300015264|Ga0137403_11442432 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 537 | Open in IMG/M |
3300015359|Ga0134085_10027833 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
3300015371|Ga0132258_10685729 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2578 | Open in IMG/M |
3300015371|Ga0132258_12537364 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1282 | Open in IMG/M |
3300017654|Ga0134069_1095040 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 969 | Open in IMG/M |
3300017656|Ga0134112_10027138 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1999 | Open in IMG/M |
3300017930|Ga0187825_10043980 | All Organisms → cellular organisms → Bacteria | 1511 | Open in IMG/M |
3300017966|Ga0187776_10035297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2797 | Open in IMG/M |
3300017993|Ga0187823_10025386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1517 | Open in IMG/M |
3300017994|Ga0187822_10006371 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2689 | Open in IMG/M |
3300017997|Ga0184610_1031496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1490 | Open in IMG/M |
3300018031|Ga0184634_10394704 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 632 | Open in IMG/M |
3300018052|Ga0184638_1183674 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300018053|Ga0184626_10004567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5197 | Open in IMG/M |
3300018053|Ga0184626_10167238 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 934 | Open in IMG/M |
3300018054|Ga0184621_10038746 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
3300018059|Ga0184615_10282724 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 927 | Open in IMG/M |
3300018061|Ga0184619_10144550 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300018063|Ga0184637_10097566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1808 | Open in IMG/M |
3300018074|Ga0184640_10279799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 758 | Open in IMG/M |
3300018076|Ga0184609_10050832 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
3300018076|Ga0184609_10324885 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300018077|Ga0184633_10027582 | All Organisms → cellular organisms → Bacteria | 2832 | Open in IMG/M |
3300018079|Ga0184627_10063970 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1917 | Open in IMG/M |
3300018084|Ga0184629_10209879 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300018089|Ga0187774_10053072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1807 | Open in IMG/M |
3300018422|Ga0190265_10250496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1817 | Open in IMG/M |
3300018422|Ga0190265_10691342 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300018422|Ga0190265_11787126 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 723 | Open in IMG/M |
3300018433|Ga0066667_10040493 | All Organisms → cellular organisms → Bacteria | 2720 | Open in IMG/M |
3300018433|Ga0066667_11421239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 610 | Open in IMG/M |
3300019255|Ga0184643_1246542 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 513 | Open in IMG/M |
3300019458|Ga0187892_10031168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4336 | Open in IMG/M |
3300019458|Ga0187892_10230940 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300019487|Ga0187893_10093974 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2682 | Open in IMG/M |
3300019487|Ga0187893_10438458 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300019487|Ga0187893_10439868 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300019789|Ga0137408_1088551 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1025 | Open in IMG/M |
3300019789|Ga0137408_1299379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 540 | Open in IMG/M |
3300019879|Ga0193723_1031465 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300019881|Ga0193707_1011698 | All Organisms → cellular organisms → Bacteria | 2972 | Open in IMG/M |
3300019881|Ga0193707_1153932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
3300019999|Ga0193718_1020264 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300020004|Ga0193755_1003505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 4989 | Open in IMG/M |
3300020004|Ga0193755_1110556 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300020021|Ga0193726_1149668 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300020065|Ga0180113_1043699 | Not Available | 880 | Open in IMG/M |
3300020067|Ga0180109_1346960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1436 | Open in IMG/M |
3300021073|Ga0210378_10040882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1838 | Open in IMG/M |
3300021086|Ga0179596_10695347 | Not Available | 515 | Open in IMG/M |
3300021088|Ga0210404_10178860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1127 | Open in IMG/M |
3300021445|Ga0182009_10060612 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1631 | Open in IMG/M |
3300021560|Ga0126371_12458274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 630 | Open in IMG/M |
3300021560|Ga0126371_13728661 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 514 | Open in IMG/M |
3300021972|Ga0193737_1007207 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300022534|Ga0224452_1166651 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300024246|Ga0247680_1067813 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300025160|Ga0209109_10229275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 907 | Open in IMG/M |
3300025165|Ga0209108_10165034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1160 | Open in IMG/M |
3300025324|Ga0209640_10513935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 975 | Open in IMG/M |
3300025569|Ga0210073_1141013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
3300025885|Ga0207653_10002075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6382 | Open in IMG/M |
3300025899|Ga0207642_10596505 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 687 | Open in IMG/M |
3300025907|Ga0207645_10021541 | All Organisms → cellular organisms → Bacteria | 4202 | Open in IMG/M |
3300025910|Ga0207684_10051267 | All Organisms → cellular organisms → Bacteria | 3501 | Open in IMG/M |
3300025910|Ga0207684_10084211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2708 | Open in IMG/M |
3300025910|Ga0207684_10347223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1277 | Open in IMG/M |
3300025911|Ga0207654_11306624 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300025912|Ga0207707_10128642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2215 | Open in IMG/M |
3300025912|Ga0207707_11077624 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 656 | Open in IMG/M |
3300025912|Ga0207707_11207469 | Not Available | 612 | Open in IMG/M |
3300025916|Ga0207663_10269879 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
3300025917|Ga0207660_10405808 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1098 | Open in IMG/M |
3300025922|Ga0207646_11040943 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300025923|Ga0207681_10533696 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 964 | Open in IMG/M |
3300025923|Ga0207681_10999838 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300025925|Ga0207650_10034266 | All Organisms → cellular organisms → Bacteria | 3682 | Open in IMG/M |
3300025930|Ga0207701_10769650 | Not Available | 812 | Open in IMG/M |
3300025934|Ga0207686_10117776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1803 | Open in IMG/M |
3300025945|Ga0207679_10042783 | All Organisms → cellular organisms → Bacteria | 3257 | Open in IMG/M |
3300025957|Ga0210089_1024041 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 726 | Open in IMG/M |
3300025962|Ga0210070_1004350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1475 | Open in IMG/M |
3300025971|Ga0210102_1042097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
3300026048|Ga0208915_1031476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 503 | Open in IMG/M |
3300026298|Ga0209236_1149521 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 988 | Open in IMG/M |
3300026309|Ga0209055_1046915 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
3300026333|Ga0209158_1124839 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 961 | Open in IMG/M |
3300026333|Ga0209158_1191000 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 723 | Open in IMG/M |
3300026334|Ga0209377_1347673 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300026351|Ga0257170_1020177 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300026355|Ga0257149_1015901 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300026358|Ga0257166_1002656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1839 | Open in IMG/M |
3300026361|Ga0257176_1085971 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 515 | Open in IMG/M |
3300026371|Ga0257179_1002118 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1561 | Open in IMG/M |
3300026480|Ga0257177_1052140 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 635 | Open in IMG/M |
3300026508|Ga0257161_1012941 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
3300026540|Ga0209376_1111813 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
3300026548|Ga0209161_10063002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2362 | Open in IMG/M |
3300026551|Ga0209648_10003569 | All Organisms → cellular organisms → Bacteria | 13088 | Open in IMG/M |
3300027068|Ga0209898_1011634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1062 | Open in IMG/M |
3300027511|Ga0209843_1095856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 501 | Open in IMG/M |
3300027562|Ga0209735_1068611 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 766 | Open in IMG/M |
3300027577|Ga0209874_1006179 | All Organisms → cellular organisms → Bacteria | 3602 | Open in IMG/M |
3300027671|Ga0209588_1067682 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1154 | Open in IMG/M |
3300027681|Ga0208991_1125457 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 764 | Open in IMG/M |
3300027761|Ga0209462_10170893 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300027775|Ga0209177_10098358 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300027846|Ga0209180_10296445 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 927 | Open in IMG/M |
3300027862|Ga0209701_10104810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1764 | Open in IMG/M |
3300027873|Ga0209814_10087849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1314 | Open in IMG/M |
3300027880|Ga0209481_10142468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1179 | Open in IMG/M |
3300027880|Ga0209481_10351903 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 751 | Open in IMG/M |
3300027886|Ga0209486_10365626 | Not Available | 866 | Open in IMG/M |
3300027907|Ga0207428_10125601 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1965 | Open in IMG/M |
3300027909|Ga0209382_10223043 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2151 | Open in IMG/M |
3300027909|Ga0209382_11490599 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300027909|Ga0209382_11556744 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 656 | Open in IMG/M |
3300027947|Ga0209868_1012991 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 823 | Open in IMG/M |
3300027952|Ga0209889_1079164 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 668 | Open in IMG/M |
3300028047|Ga0209526_10332117 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300028381|Ga0268264_10880308 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 898 | Open in IMG/M |
3300028792|Ga0307504_10311708 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 595 | Open in IMG/M |
3300028799|Ga0307284_10424563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 542 | Open in IMG/M |
3300028803|Ga0307281_10036211 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1502 | Open in IMG/M |
3300028828|Ga0307312_11009625 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
3300028878|Ga0307278_10091727 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1367 | Open in IMG/M |
3300030620|Ga0302046_10711090 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300031229|Ga0299913_11715389 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031421|Ga0308194_10401504 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 500 | Open in IMG/M |
3300031548|Ga0307408_100055562 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
3300031548|Ga0307408_100306803 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1332 | Open in IMG/M |
3300031716|Ga0310813_10012920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5464 | Open in IMG/M |
3300031720|Ga0307469_10082684 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
3300031731|Ga0307405_10280133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1255 | Open in IMG/M |
3300031731|Ga0307405_10854416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
3300031736|Ga0318501_10121612 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
3300031740|Ga0307468_101135961 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 699 | Open in IMG/M |
3300031832|Ga0318499_10220945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 738 | Open in IMG/M |
3300031834|Ga0315290_10498552 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1063 | Open in IMG/M |
3300031854|Ga0310904_11279800 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 531 | Open in IMG/M |
3300031892|Ga0310893_10524463 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 534 | Open in IMG/M |
3300031965|Ga0326597_11215276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 743 | Open in IMG/M |
3300032000|Ga0310903_10526061 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300032075|Ga0310890_11415904 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 571 | Open in IMG/M |
3300032174|Ga0307470_10039686 | All Organisms → cellular organisms → Bacteria | 2321 | Open in IMG/M |
3300032174|Ga0307470_11507824 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 559 | Open in IMG/M |
3300032205|Ga0307472_100677483 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300032205|Ga0307472_101881146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 596 | Open in IMG/M |
3300032770|Ga0335085_10010878 | All Organisms → cellular organisms → Bacteria | 13552 | Open in IMG/M |
3300032770|Ga0335085_10575952 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1271 | Open in IMG/M |
3300032954|Ga0335083_10862494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 721 | Open in IMG/M |
3300033004|Ga0335084_11587901 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
3300033158|Ga0335077_11254213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
3300033432|Ga0326729_1064946 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300033433|Ga0326726_10610257 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300033480|Ga0316620_12120350 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 559 | Open in IMG/M |
3300033501|Ga0326732_1017905 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300033513|Ga0316628_100123598 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
3300033550|Ga0247829_10185911 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1643 | Open in IMG/M |
3300033550|Ga0247829_10285683 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1336 | Open in IMG/M |
3300033807|Ga0314866_070310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 598 | Open in IMG/M |
3300033811|Ga0364924_038134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1001 | Open in IMG/M |
3300033812|Ga0364926_110472 | Not Available | 572 | Open in IMG/M |
3300033814|Ga0364930_0305131 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 535 | Open in IMG/M |
3300034164|Ga0364940_0202429 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 581 | Open in IMG/M |
3300034165|Ga0364942_0030239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1730 | Open in IMG/M |
3300034176|Ga0364931_0080213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1017 | Open in IMG/M |
3300034177|Ga0364932_0371700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
3300034818|Ga0373950_0072174 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.43% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.14% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.71% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.14% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.86% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.57% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.71% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.43% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.14% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.86% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.86% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.86% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.57% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.57% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.57% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.57% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.57% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.29% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.29% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.29% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.29% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.29% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.29% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.29% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.29% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.29% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.29% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.29% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.29% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.29% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
3300005206 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009802 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 | Environmental | Open in IMG/M |
3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014867 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT433_16_10D | Environmental | Open in IMG/M |
3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025962 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026048 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027068 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027947 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033501 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF12FN SIP fraction | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_113646712 | 3300000363 | Soil | VDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVG |
INPhiseqgaiiFebDRAFT_1017008852 | 3300000364 | Soil | VDHHKVDDALWAELRKHFSEADLIELTMHTTLYIGLGRFNEIVGLDPA* |
JGI1027J12803_1093544823 | 3300000955 | Soil | EMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
JGI10216J12902_1080776291 | 3300000956 | Soil | KIDDALWTEMRSQFTEPEVIELVAHTTLYIGFGRFNEIIGLDPA* |
JGI25384J37096_101144102 | 3300002561 | Grasslands Soil | DALWSELRGHFSEAEIIELVANATLFIGWGRFNAIXGLDPS* |
JGI25384J37096_102490741 | 3300002561 | Grasslands Soil | KVDDALWSELRGHFSEAEIIELVANATLFIGWGRFNAIVGLDPS* |
JGI25612J43240_10133292 | 3300002886 | Grasslands Soil | VDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
JGI25612J43240_10642331 | 3300002886 | Grasslands Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
JGI25388J43891_10143101 | 3300002909 | Grasslands Soil | DDALWSEVRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA* |
JGI25617J43924_101673712 | 3300002914 | Grasslands Soil | VDHQKVDEALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0055439_101918331 | 3300004019 | Natural And Restored Wetlands | AVDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA* |
Ga0055436_100920993 | 3300004024 | Natural And Restored Wetlands | ALWSEMRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0055490_102448712 | 3300004052 | Natural And Restored Wetlands | VDHQKVDDRLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0066398_101605731 | 3300004268 | Tropical Forest Soil | VDEALWSELREHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA* |
Ga0063356_1003318043 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ALWAEVRAQFSEAEVIELVAHTTLFIGFGRFNEIVGIEPA* |
Ga0063356_1028915952 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VDDALWADLRAQFSEAEIIELTMHTMVFIGMGRFNEIIGL* |
Ga0062595_1011114232 | 3300004479 | Soil | LWAELRQHFSEAEIIELTAHTTLYIGFGRFNEIVGLDPA* |
Ga0062592_1020567232 | 3300004480 | Soil | VDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0062594_1001957953 | 3300005093 | Soil | VDHHKVDEPQWAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0062594_1027557702 | 3300005093 | Soil | VDDALWTDLRAQFSEAEIIELTMHAMVFIGMGRFNEIVGLDPV* |
Ga0066685_101044533 | 3300005180 | Soil | HRKVDDALWAELRGHFSEAEIIELVASATLFIGWGRFNEIIGIDPA* |
Ga0068999_100174612 | 3300005205 | Natural And Restored Wetlands | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPG* |
Ga0068995_100603151 | 3300005206 | Natural And Restored Wetlands | VDHQKVDDTLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGI |
Ga0065707_100423391 | 3300005295 | Switchgrass Rhizosphere | VDHXKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0065707_104782042 | 3300005295 | Switchgrass Rhizosphere | VDHQKVDDALWAEVREQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0070676_100272644 | 3300005328 | Miscanthus Rhizosphere | VDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA* |
Ga0066388_1000696495 | 3300005332 | Tropical Forest Soil | VDHQKIDDVLWTELRRQFTEAELIELAAHTTLYIGFGRFNEVVGLDPA* |
Ga0066388_1003428834 | 3300005332 | Tropical Forest Soil | VDDELWAELRAQFSEAEIIELVAHTTLYIGYGRFNEILGIDPA* |
Ga0066388_1030982002 | 3300005332 | Tropical Forest Soil | VDEALWSELREHLSEAEIIELVAHTTLYIGWGRFNEIVGIDPA* |
Ga0068869_1000152294 | 3300005334 | Miscanthus Rhizosphere | VDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0070680_1000750323 | 3300005336 | Corn Rhizosphere | VDHNKVDDALWAEVRAQFSEAEVIELVAHTTLFIGFGRFNEIVGIEPA* |
Ga0070692_100546691 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHQKVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLD |
Ga0070674_1014944832 | 3300005356 | Miscanthus Rhizosphere | VDHHKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0070703_100138593 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHQKVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0070705_1006749882 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHQKVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0070694_1005629232 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDALWSDVRHHLSEAEVIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0070708_1004472751 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHHKVDDTLWAEMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0070708_1020925451 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHQKIDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0070706_1012436901 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AQWAELRSHFSDAEVIELVAHTTLYIGFGRFNEIVGLDPS* |
Ga0070698_1002462142 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHQKVDEALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVRIDPA* |
Ga0070698_1010227982 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDALWSELREHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPATPTDA* |
Ga0070698_1017046422 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA* |
Ga0070699_1004047774 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MWAEMRSHFSEAEIIELVAHTTLFIGFGRFNEIVGLEPA* |
Ga0070699_1017268651 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DAFWQELRSHFTEAEIIELTAHTTIYIGWGRFNDVVGIDVD* |
Ga0073909_106279342 | 3300005526 | Surface Soil | VDHEKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0070697_1002728571 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHQKVDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIVGIEPA* |
Ga0066697_100644343 | 3300005540 | Soil | MRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0070695_1000492883 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA* |
Ga0070695_1005990731 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHQKVDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIV |
Ga0070704_1006274722 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VDETLWSELRSHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA* |
Ga0066695_100745262 | 3300005553 | Soil | VRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0066703_105063442 | 3300005568 | Soil | LAVDHHKVDDALWSEVRRHFSEAEIIELVAHTTLYIGFGRFNEIVGVDPA* |
Ga0066694_100516451 | 3300005574 | Soil | EMRRHFTEAEIVELVAHATLYIGFGRFNEIVGIEPA* |
Ga0066691_100010626 | 3300005586 | Soil | MRRHFTEAEIVELVAHATLYIGFGRFNEIVGIEPA* |
Ga0066691_100661324 | 3300005586 | Soil | LRSHFSEADIIELVAHTTLFIGFGRFNEIVGLEPA* |
Ga0068859_1000776173 | 3300005617 | Switchgrass Rhizosphere | MRRHFSEAEIIELTAHTTLYIGFGRFNEIVGLDPA* |
Ga0066905_1000581994 | 3300005713 | Tropical Forest Soil | VDHQKIDDALWTELRSQFTESELIELAAHTTLYIGFGRFNEIVGLDPA* |
Ga0066903_1001602273 | 3300005764 | Tropical Forest Soil | MQWEEMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLEPA* |
Ga0066903_1005494094 | 3300005764 | Tropical Forest Soil | VDHQKIDDVLWTDLRRQFTEAELIELAALTTLYIGFGRFNEVVGLDPA* |
Ga0066903_1029029762 | 3300005764 | Tropical Forest Soil | VDHHKVDDALWAEMRKHFSEAEIIELVAHTTLFIGFGRFNEIVGLDPA* |
Ga0066903_1035387553 | 3300005764 | Tropical Forest Soil | VDEAVWSELREHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA* |
Ga0074479_103073502 | 3300005829 | Sediment (Intertidal) | VDHQKVDDGLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPG* |
Ga0068860_1006550883 | 3300005843 | Switchgrass Rhizosphere | MRAHFSEAEIIELVAHTTLYIGFGRFNEIVGLEPPA* |
Ga0068862_1001914941 | 3300005844 | Switchgrass Rhizosphere | AVDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0066656_100689761 | 3300006034 | Soil | VDDALWAELRGHFSEAEIIELVANATLFIGWGRFNEIIGIDPA* |
Ga0075417_100761792 | 3300006049 | Populus Rhizosphere | VDESLWSELREHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA* |
Ga0075417_101672091 | 3300006049 | Populus Rhizosphere | VDHQKVDDALWAELRANFSEAEIIELAAHTTLFIGLGRFNEILG |
Ga0075028_1000969452 | 3300006050 | Watersheds | VDHQKVDDALWAEVRAQFSEAEVIELAAHTTLYIGLGRFNEIVGIDPA* |
Ga0068871_1018971341 | 3300006358 | Miscanthus Rhizosphere | VDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0079220_112210391 | 3300006806 | Agricultural Soil | VDHRKVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0075428_1000185787 | 3300006844 | Populus Rhizosphere | VDEALWSELRGHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPS* |
Ga0075428_1006277443 | 3300006844 | Populus Rhizosphere | VDHQKVDDDLWAEVRAHFSEAELIELVAHTTLYIGFGRFNEIVGLDPS* |
Ga0075421_1001310495 | 3300006845 | Populus Rhizosphere | WAAMRQQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA* |
Ga0075421_1001492644 | 3300006845 | Populus Rhizosphere | VDDRAWAELRAQFSEAEVIELTMHATLYIGLGRFNEVIGLDPNDLG* |
Ga0075421_1019987912 | 3300006845 | Populus Rhizosphere | VRRHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0075431_1010114203 | 3300006847 | Populus Rhizosphere | WSDVRHHLSEAEVIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0075433_109146381 | 3300006852 | Populus Rhizosphere | AELREHFSEAEIVELAANITVNLGLGRFNHVVGIEP* |
Ga0075420_1002977953 | 3300006853 | Populus Rhizosphere | WSELRTHFSEADIIELTMHTTLYIGLGRFNEVVGLDPA* |
Ga0075425_1005679122 | 3300006854 | Populus Rhizosphere | LWAELRSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPA* |
Ga0075429_1011968261 | 3300006880 | Populus Rhizosphere | DDRAWGELRAQFSEAEVIELTMHATLYIGLGRFNEVIGLDPNDLG* |
Ga0079215_101789362 | 3300006894 | Agricultural Soil | VDHHKVDDSLWAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0075426_115316221 | 3300006903 | Populus Rhizosphere | AVDHRKVDDVLWAEVRTHFSEAEIIELTAHTTLYIGFGRFNEIIGL* |
Ga0075424_1001035563 | 3300006904 | Populus Rhizosphere | VDHHKVDDTQWTETRRHFTEAEIIELVAHTTLYIGFGRFNEIVGVDPA* |
Ga0075436_1001631001 | 3300006914 | Populus Rhizosphere | VRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA* |
Ga0079216_102390201 | 3300006918 | Agricultural Soil | VDDALWADLRAQFTEAEIIELTMHAMVFIGMGRFNEIIGL* |
Ga0079219_102288233 | 3300006954 | Agricultural Soil | DHHKVDDELWAELCRHFTQAEIIELTAHTTLFIGFGRFNEIVGLDPA* |
Ga0099791_101389522 | 3300007255 | Vadose Zone Soil | RSHFSEAEIVELVAHATLYIGFGRFNEIVRVDPA* |
Ga0099794_100307653 | 3300007265 | Vadose Zone Soil | VRAHFSEAEIIELVAHTTLYIGFGRFNAIVGLDPA* |
Ga0099794_101372002 | 3300007265 | Vadose Zone Soil | VDHQKVDEVLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0066710_1000907584 | 3300009012 | Grasslands Soil | DDTLWAELRRHFSEAEIIELAAHTTLFIGFGRFNEIVGLDLA |
Ga0066710_1023564531 | 3300009012 | Grasslands Soil | TLAVDHHKVDDALWSEVRRHFSEAEIIELVAHTTLYIGFGRFNEIVGVDPA |
Ga0066710_1035816692 | 3300009012 | Grasslands Soil | ALWSEVRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0099829_103372932 | 3300009038 | Vadose Zone Soil | RRHFSEAEIIELAAHTTLFIGFGRFNEIVGLDPA* |
Ga0099828_1000401710 | 3300009089 | Vadose Zone Soil | VDHQKVDDALWAEVHAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0099828_105651142 | 3300009089 | Vadose Zone Soil | VDHHKVDDTLWAEMRRHFSEAEIIELVAHTTLYVGFGRFNEIVGLDPA* |
Ga0099827_112496262 | 3300009090 | Vadose Zone Soil | WAELRRHFSEGEIVELVAHTTIYIGFGRFNDIVGIDPA* |
Ga0075418_111743252 | 3300009100 | Populus Rhizosphere | LWADLRAQLSEAEIIELVAHTTLYIGFGRFNDIIGLGPVEGGRS* |
Ga0075418_126051342 | 3300009100 | Populus Rhizosphere | VDDTLWAEVRAQFSEAEVIELATHTTLYIGFGRLNEIIGIEPA* |
Ga0075418_130249511 | 3300009100 | Populus Rhizosphere | SDMRAQFSEADIVVLVAHATPYIGFGRFNEIVGVDPASQ* |
Ga0105247_113185111 | 3300009101 | Switchgrass Rhizosphere | MRGQFSEAEVIELVAHTTLYIGFGRFNEIIGLDPA* |
Ga0114129_100340604 | 3300009147 | Populus Rhizosphere | VDHQKVDDALWAEVRAEFSEAEVIELVAHATLYIGFGRFNEIVGIDPA* |
Ga0114129_123876941 | 3300009147 | Populus Rhizosphere | LWAELRRHFSEAEIIELVANATLFIGWGRFNEIIGIDPA* |
Ga0114129_130651482 | 3300009147 | Populus Rhizosphere | VDDALWSDVRHHLSEAEVIKLVAHTTLYIGFGRLNEIVGLDPA* |
Ga0105243_123735322 | 3300009148 | Miscanthus Rhizosphere | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVG |
Ga0105092_106332762 | 3300009157 | Freshwater Sediment | VWAELRQHLSEAEVIELVAHTTLYIGFGRFNEIVGLEPR* |
Ga0075423_101030311 | 3300009162 | Populus Rhizosphere | QKVDDALWDEVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA* |
Ga0105242_127939061 | 3300009176 | Miscanthus Rhizosphere | MRRQFTEAEIIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0126374_100245911 | 3300009792 | Tropical Forest Soil | VDHQKIDDALWTELRSQFTEAELIELAAHTTLYIGFGRFNEVVGLDPA* |
Ga0126374_103284641 | 3300009792 | Tropical Forest Soil | VDHQKIDDVLWTELRRQFTEAELIELAALTTLYIGFGRFNEVVGLDPA* |
Ga0105073_10100023 | 3300009802 | Groundwater Sand | MRSHFSEAEIIELVAHATLYIGLGRFNEIVGLDPA* |
Ga0105063_10071502 | 3300009804 | Groundwater Sand | MRSQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0105082_10252503 | 3300009814 | Groundwater Sand | VRHHFSEAEVIELVAHTTVYIGFGRFNAIVGLDPA* |
Ga0105076_10755052 | 3300009816 | Groundwater Sand | VRDHFSEAEVIELVAHATLYIGFGRFNEILGIEPA* |
Ga0105085_10052732 | 3300009820 | Groundwater Sand | VDHQKVDDALWAELRGQFSEAEIIELVAHTTIYIGFGRFNEIVGIDPA* |
Ga0126380_101036001 | 3300010043 | Tropical Forest Soil | VDHQKIDDVLWAELRSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPS* |
Ga0126380_103639542 | 3300010043 | Tropical Forest Soil | VDHQKIDDTLWTELRSQFTEAELIELAAHTTLYIGFGRFNEIVGLDPA* |
Ga0126384_105090153 | 3300010046 | Tropical Forest Soil | VDHQKIDDALWTELRSQFTESELIELAAHTTLYIGFGRFNEVVGLDPA* |
Ga0126384_107206661 | 3300010046 | Tropical Forest Soil | DHQKIDDALWAELRSHFTEAELIELVAHTTLYIGFGRFNEIIGLDLS* |
Ga0134088_103375232 | 3300010304 | Grasslands Soil | MRSLFTEAEVIELVAHTTLYIGFGRFNEIIGLDPA* |
Ga0134071_102166001 | 3300010336 | Grasslands Soil | VDHHKVDDALWSELRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0126370_102709214 | 3300010358 | Tropical Forest Soil | WAELRSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPS* |
Ga0126370_107487523 | 3300010358 | Tropical Forest Soil | VDDELWAALRAQFSEAEIIELVAHTTLYIGYGRFNEILGIDPA* |
Ga0126372_101005494 | 3300010360 | Tropical Forest Soil | VDDELWVELRAQFSEAEIIELVAHTTLYIGYGRFNEILGIDPA* |
Ga0126372_101621252 | 3300010360 | Tropical Forest Soil | VDHQKIDDVLWTDLRRQFTEAELIELAAHTTLYIGFGRFNEVVGLDPA* |
Ga0126378_118996542 | 3300010361 | Tropical Forest Soil | VDDALWAEMRQHFSEAEIIELVAHTTLYIGWGRFNEILGLDPA* |
Ga0126377_111086433 | 3300010362 | Tropical Forest Soil | AELRSQFTDAELIELAAHTTLYIGFGRFNEIIGLEPA* |
Ga0126379_100909775 | 3300010366 | Tropical Forest Soil | VDHQKIDDVLWTELRRQFTEAELIELAAHITLYIGFGRFNEVVGLDPA* |
Ga0126379_114041582 | 3300010366 | Tropical Forest Soil | VDHQKIDDALWAEFRRQFTEAELIELAAHTTLYIGFGRFNEIVGLDPA* |
Ga0134125_108827173 | 3300010371 | Terrestrial Soil | VDHHKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA* |
Ga0126381_1012752981 | 3300010376 | Tropical Forest Soil | IDDAQWAELRSSFSEAEIIELVAHTTLFIGWGRFNEIVGIDPA* |
Ga0126381_1037543362 | 3300010376 | Tropical Forest Soil | HQKIDDVLWAELRSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPS* |
Ga0136847_102476061 | 3300010391 | Freshwater Sediment | MRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0134127_100417052 | 3300010399 | Terrestrial Soil | VDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA* |
Ga0134122_113609691 | 3300010400 | Terrestrial Soil | VDHQKVDDGLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA* |
Ga0137442_11196702 | 3300011414 | Soil | VDHRKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0137448_12029081 | 3300011427 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDP |
Ga0137458_12019762 | 3300011436 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID* |
Ga0137429_10301812 | 3300011437 | Soil | VDHQKVDDALWVEMRREFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0137461_10431893 | 3300012040 | Soil | LRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0137330_10622791 | 3300012134 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRISENVGPDPAKHLHEVRPGHVA |
Ga0137352_10295853 | 3300012164 | Soil | VDHQKVDDALWAELRAQFSEAEVIELAAHTTLYIGFGRFNEIVGLDPA* |
Ga0137338_10207682 | 3300012174 | Soil | VDHQKVDDALWAELRAQFSEAEVIELAAHTTLYIGFGRFNEIVGIEPA* |
Ga0137388_109773331 | 3300012189 | Vadose Zone Soil | FWSEMRSHFSEAEIIELVAHATLYIGFGRFNEIVGVDPA* |
Ga0137363_109482511 | 3300012202 | Vadose Zone Soil | RRHFSEAEIVELVAHTTIYIGFGRFNDVVGIDPL* |
Ga0137399_108623422 | 3300012203 | Vadose Zone Soil | VDHNNVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0137399_114235871 | 3300012203 | Vadose Zone Soil | VDHQKVDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0137362_101111072 | 3300012205 | Vadose Zone Soil | VDHQKVDDDLWAVLRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0137362_101429911 | 3300012205 | Vadose Zone Soil | VDDALWAEMRRHFSEAEIIELVAHTTLYIGFGRFNEIIGLEPS* |
Ga0137434_10599282 | 3300012225 | Soil | VDDGLWADLRAQFSEAEIIELTMHTMVFIGMGRFNEIIGLDPV* |
Ga0137369_109526652 | 3300012355 | Vadose Zone Soil | VDHQKVDDALWSEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGIDPV* |
Ga0137360_102908094 | 3300012361 | Vadose Zone Soil | MRRHFSEAEIIELVAHTTLDIGFGRVNEIVGLDPA* |
Ga0137361_111878921 | 3300012362 | Vadose Zone Soil | AFWSEMRSHFSEAEIIELVAHATLYIGFGRFNEMVGVDPA* |
Ga0157299_102378952 | 3300012899 | Soil | VRTHFSEAEVIELVAHTTLYIGFGRFNEVIRLDPS* |
Ga0137395_109643082 | 3300012917 | Vadose Zone Soil | AADHHKVDDALWAEMRRHFSEAEIIELEAHTTLYIGFGRFNEIIGLEPS* |
Ga0137395_110682341 | 3300012917 | Vadose Zone Soil | EMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0137394_101066632 | 3300012922 | Vadose Zone Soil | LWAELRLHFSEAEVIELTAHTTLYIGFGRFNEIVGLDPA* |
Ga0137419_112672711 | 3300012925 | Vadose Zone Soil | DDELWAEMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0137416_111018361 | 3300012927 | Vadose Zone Soil | DALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0137404_100098843 | 3300012929 | Vadose Zone Soil | VDHQKVDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA* |
Ga0137404_107178262 | 3300012929 | Vadose Zone Soil | ALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGID* |
Ga0137407_100667761 | 3300012930 | Vadose Zone Soil | DDTLWAELSRHFSEAEIIELAAHMTLFIGFGRFNEIVGLDPA* |
Ga0137407_105580411 | 3300012930 | Vadose Zone Soil | VDHNKVDDALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGID* |
Ga0137407_106084531 | 3300012930 | Vadose Zone Soil | VDHQKVDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGID* |
Ga0137407_118451232 | 3300012930 | Vadose Zone Soil | WSEMRSHFSEAEIIELVAHATLYIGFGRFNEIIGIEPA* |
Ga0153915_101617332 | 3300012931 | Freshwater Wetlands | VDHQKVDDALWAEVRAQFSEGEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0153915_108119062 | 3300012931 | Freshwater Wetlands | MRTHFSEAEIIELVAHTTLYIGFGRFNEIVGLEPA* |
Ga0137410_103523252 | 3300012944 | Vadose Zone Soil | WSEMRSHFSEAEIVELVAHATLYIGFGRFNEIVGVDPA* |
Ga0137410_118005822 | 3300012944 | Vadose Zone Soil | LWAEMRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0126375_120406001 | 3300012948 | Tropical Forest Soil | KIDDVLWTELRRQFTEAELIELAAHTTLYIGFGRFNEVVGLDPA* |
Ga0164302_116740212 | 3300012961 | Soil | VDHQKVDDDLWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGID* |
Ga0126369_128679631 | 3300012971 | Tropical Forest Soil | RSQFTEAELIELVAHTTLYIGFGRFNEIIGLDPS* |
Ga0134076_100096914 | 3300012976 | Grasslands Soil | VDEALWSELRGHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA* |
Ga0164304_110198412 | 3300012986 | Soil | VDHQRVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0157380_114156241 | 3300014326 | Switchgrass Rhizosphere | VDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIDP |
Ga0180076_10920912 | 3300014867 | Soil | VDHHKVDDTEWADMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA* |
Ga0180069_10950052 | 3300014882 | Soil | MRQHFSEAEIIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0180086_11606511 | 3300014883 | Soil | MRQHFSEAEIIELVAHTTLYIGFGRFNEIIGLDPA* |
Ga0137418_100919705 | 3300015241 | Vadose Zone Soil | MRAHFSEAEIVELVAHATLYIGFGRFNEILGVEPASR* |
Ga0137403_101317581 | 3300015264 | Vadose Zone Soil | RRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPI* |
Ga0137403_101984784 | 3300015264 | Vadose Zone Soil | VDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEI |
Ga0137403_107517182 | 3300015264 | Vadose Zone Soil | VDDALWSELRHHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPS* |
Ga0137403_114424321 | 3300015264 | Vadose Zone Soil | QKVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0134085_100278334 | 3300015359 | Grasslands Soil | VRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPV* |
Ga0132258_106857292 | 3300015371 | Arabidopsis Rhizosphere | VDHQKIDDALWAELRSQFTDAELIELAAHTTLYIGFGRFNEIVGLDPA* |
Ga0132258_125373643 | 3300015371 | Arabidopsis Rhizosphere | VDDAQWAKLRRHFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA* |
Ga0134069_10950403 | 3300017654 | Grasslands Soil | VRRHFSEAEIVELVAHATLYIGFGRFNEIVGIEPA |
Ga0134112_100271385 | 3300017656 | Grasslands Soil | VDEALWSELRGHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA |
Ga0187825_100439802 | 3300017930 | Freshwater Sediment | VDHQKVDDDLWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGIDPA |
Ga0187776_100352974 | 3300017966 | Tropical Peatland | VRAQFSEAEVIELVAHTTLYIGFGRFNEILGIEPA |
Ga0187823_100253863 | 3300017993 | Freshwater Sediment | VDHRKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0187822_100063713 | 3300017994 | Freshwater Sediment | VDHRKVDDDLWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGIDPA |
Ga0184610_10314964 | 3300017997 | Groundwater Sediment | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRF |
Ga0184634_103947041 | 3300018031 | Groundwater Sediment | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFSEIVGIDPA |
Ga0184638_11836742 | 3300018052 | Groundwater Sediment | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIMGIDPA |
Ga0184626_100045677 | 3300018053 | Groundwater Sediment | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0184626_101672382 | 3300018053 | Groundwater Sediment | VRDHFSEAEVIELVAHATLYIGFGRFNEILGVEPA |
Ga0184621_100387462 | 3300018054 | Groundwater Sediment | VDHQKVDDALWAEVRAEFSEAEVIELVAHATLYIGFGRFNEIVGIDPA |
Ga0184615_102827243 | 3300018059 | Groundwater Sediment | MRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPG |
Ga0184619_101445502 | 3300018061 | Groundwater Sediment | VDHQKVDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0184637_100975662 | 3300018063 | Groundwater Sediment | VRFREEVRGRPQKVRDALWAEMRGQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0184640_102797992 | 3300018074 | Groundwater Sediment | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA |
Ga0184609_100508321 | 3300018076 | Groundwater Sediment | KVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIMGIDPA |
Ga0184609_103248852 | 3300018076 | Groundwater Sediment | WAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0184633_100275823 | 3300018077 | Groundwater Sediment | MRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0184627_100639703 | 3300018079 | Groundwater Sediment | MRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLEPA |
Ga0184629_102098791 | 3300018084 | Groundwater Sediment | LWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0187774_100530724 | 3300018089 | Tropical Peatland | VRAQFSEAEVIALVAHTTLYIGFGRFNEILGIEPA |
Ga0190265_102504962 | 3300018422 | Soil | VDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0190265_106913422 | 3300018422 | Soil | VDHQKVDDTLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0190265_117871262 | 3300018422 | Soil | VEDAQWAELRRHFSEAEVIELVAHTTLYIGFGRFNEIVGIEAI |
Ga0066667_100404934 | 3300018433 | Grasslands Soil | VRAHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0066667_114212392 | 3300018433 | Grasslands Soil | WAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPS |
Ga0184643_12465422 | 3300019255 | Groundwater Sediment | VDHQKVDDALWSEMRRQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA |
Ga0187892_100311682 | 3300019458 | Bio-Ooze | VDHQKVDDALWAEVRGQFSEAEIIELVAHTTLYIGFGRFNEIIGIEPA |
Ga0187892_102309401 | 3300019458 | Bio-Ooze | DALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA |
Ga0187893_100939743 | 3300019487 | Microbial Mat On Rocks | VDHQKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPA |
Ga0187893_104384581 | 3300019487 | Microbial Mat On Rocks | DEALWSQLRSHFSEAEIIELVAHTTLYIGFGRFNAIVGLDPA |
Ga0187893_104398681 | 3300019487 | Microbial Mat On Rocks | EALWSELRSHFSEAEIIELVAHTTLYIGFGRFNTIVGLDPA |
Ga0137408_10885513 | 3300019789 | Vadose Zone Soil | MRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0137408_12993791 | 3300019789 | Vadose Zone Soil | MRRHFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0193723_10314654 | 3300019879 | Soil | VDHHKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0193707_10116983 | 3300019881 | Soil | VDHQKVDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGID |
Ga0193707_11539322 | 3300019881 | Soil | ALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0193718_10202644 | 3300019999 | Soil | VDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDP |
Ga0193755_10035057 | 3300020004 | Soil | VDHQKVDDALWSELRRLFTEAEIIELVAHTTLFIGFGRFNEIVGLDPV |
Ga0193755_11105562 | 3300020004 | Soil | VDDALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGIDPA |
Ga0193726_11496681 | 3300020021 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGIDPA |
Ga0180113_10436991 | 3300020065 | Groundwater Sediment | DALWVEMRREFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0180109_13469602 | 3300020067 | Groundwater Sediment | VDHQKVDDALWAELRAQFSEAEVIELAAHTTLYIGFGRFNEIVGIEPA |
Ga0210378_100408821 | 3300021073 | Groundwater Sediment | LWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIMGIDPA |
Ga0179596_106953471 | 3300021086 | Vadose Zone Soil | HHKVDDALWAEMRRHFSEAAIIELVAHTTLYIGFGRFNEIIGLEPS |
Ga0210404_101788604 | 3300021088 | Soil | VDHQKVDDALWAELRAQFSEGEIIELAAHTTLFIGLGRFNEILGIDPV |
Ga0182009_100606121 | 3300021445 | Soil | VDDALWAKVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA |
Ga0126371_124582742 | 3300021560 | Tropical Forest Soil | WAELRSHFTEAELIELVAHTTLYIGFGRFNEIIGLEPA |
Ga0126371_137286612 | 3300021560 | Tropical Forest Soil | VDDELWAALRAQFSEAEIIELVAHTTLYIGYGRFNEILGIDPA |
Ga0193737_10072072 | 3300021972 | Soil | VDHNKVDDALWAEVRAQFSEAEVIELVAHATLYIGFGRFNEIVGID |
Ga0224452_11666511 | 3300022534 | Groundwater Sediment | DALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0247680_10678132 | 3300024246 | Soil | VDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0209109_102292752 | 3300025160 | Soil | VDHQKVDDALWAELRGQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0209108_101650341 | 3300025165 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHATLFIGFGRFNEIVGIEPA |
Ga0209640_105139352 | 3300025324 | Soil | VDDAQWAELRAHFSEAELIELVAHTALYIGFGRFNDIIGLEPA |
Ga0210073_11410132 | 3300025569 | Natural And Restored Wetlands | GDAQWAELRSHFSEAEIIELVAHTTLYIGLGRFNEIVGLEPV |
Ga0207653_100020756 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHQKVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0207642_105965052 | 3300025899 | Miscanthus Rhizosphere | VDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA |
Ga0207645_100215412 | 3300025907 | Miscanthus Rhizosphere | VDHHKVDDALWAEVRGQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0207684_100512671 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | DDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0207684_100842114 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VDHQKIDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0207684_103472233 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRGQFSEAEVIELVAHTTLYIGFGRFNEIIGLDPA |
Ga0207654_113066242 | 3300025911 | Corn Rhizosphere | VDHNKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA |
Ga0207707_101286423 | 3300025912 | Corn Rhizosphere | MRRHFSEAEIIELTAHTTLYIGFGRFNEIVGLDPA |
Ga0207707_110776242 | 3300025912 | Corn Rhizosphere | VDHHKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEVVGIDPA |
Ga0207707_112074692 | 3300025912 | Corn Rhizosphere | DALWAEVRAQFSEAEVIELVAHTTLFIGFGRFNEIVGIEPA |
Ga0207663_102698791 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GVRSQFTEAEVIELVAHTTLYIGFGRFNEIIGLDPA |
Ga0207660_104058082 | 3300025917 | Corn Rhizosphere | VDHNKVDDALWAEVRAQFSEAEVIELVAHTTLFIGFGRFNEIVGIEPA |
Ga0207646_110409431 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0207681_105336962 | 3300025923 | Switchgrass Rhizosphere | VRTHFSEAEVIELVAHTTLYIGFGRFNEVIRLDPS |
Ga0207681_109998381 | 3300025923 | Switchgrass Rhizosphere | HQKIDDTLWTEVRSQFTEAEVIELVAHTTLYIGFGRFNEIIGL |
Ga0207650_100342664 | 3300025925 | Switchgrass Rhizosphere | DHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA |
Ga0207701_107696501 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0207686_101177761 | 3300025934 | Miscanthus Rhizosphere | KLAVDHQKVDDALWAEMRRQFTEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0207679_100427831 | 3300025945 | Corn Rhizosphere | VRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA |
Ga0210089_10240413 | 3300025957 | Natural And Restored Wetlands | TLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0210070_10043501 | 3300025962 | Natural And Restored Wetlands | VDHQKVDDTLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID |
Ga0210102_10420972 | 3300025971 | Natural And Restored Wetlands | VDHQKVDDRLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0208915_10314761 | 3300026048 | Natural And Restored Wetlands | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIEPG |
Ga0209236_11495213 | 3300026298 | Grasslands Soil | MRRHFTEAEIVELVAHATLYIGFGRFNEIVGIEPA |
Ga0209055_10469154 | 3300026309 | Soil | FADKLAVDQHKVDEALWAELRSHFSEADIIELVAHTTLFIGFGRFNEIVGLEPA |
Ga0209158_11248391 | 3300026333 | Soil | LRRHFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA |
Ga0209158_11910003 | 3300026333 | Soil | VRRHFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA |
Ga0209377_13476731 | 3300026334 | Soil | HHKVDDALWSELRGHFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA |
Ga0257170_10201772 | 3300026351 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGVDPA |
Ga0257149_10159014 | 3300026355 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELAAHTTLYIGLGRFNEIVGIDPA |
Ga0257166_10026561 | 3300026358 | Soil | AQWAELRSHFSDAEIIELVAHTTLYIGFGRFNEIVGLDPS |
Ga0257176_10859711 | 3300026361 | Soil | ELGSHFSDAEIIELVAHTTLYIGFGRFNEIVGLDPS |
Ga0257179_10021184 | 3300026371 | Soil | VDQQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0257177_10521402 | 3300026480 | Soil | VDHQKVDEVLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0257161_10129411 | 3300026508 | Soil | EVRAQFSEAEVIELAAHTTLYIGLGRFNEIVGIDPA |
Ga0209376_11118131 | 3300026540 | Soil | HRKVDDALWAELRGHFSEAEIIELVASATLFIGWGRFNEIIGIDPA |
Ga0209161_100630023 | 3300026548 | Soil | VDDELWAELRRHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0209648_1000356910 | 3300026551 | Grasslands Soil | VRAHFSEAEIIELVAHTTLYIGFGRFNAIVGLDPA |
Ga0209898_10116342 | 3300027068 | Groundwater Sand | AFWSELRAHFSEAEVIELVAHATLYIGFGRLNEILGLDPA |
Ga0209843_10958561 | 3300027511 | Groundwater Sand | VDHQKVDDALWAELRGQFSEAEIIELVAHTTIYIGFGRFNEIVGIDPA |
Ga0209735_10686112 | 3300027562 | Forest Soil | MRQHFSEAEIIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0209874_10061791 | 3300027577 | Groundwater Sand | FWSEMRSHFSEAEIVELVAHATLYIGLGRFNEIVGLDPA |
Ga0209588_10676822 | 3300027671 | Vadose Zone Soil | MRRHFSESEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0208991_11254571 | 3300027681 | Forest Soil | VDDALWAEVRAEFSEAEVIELVAHTTLYIGFGRFNEIVGID |
Ga0209462_101708932 | 3300027761 | Agave | DDAAWAELRDQFSESEIIELALHVTLFIGLGRFNEVVGLEV |
Ga0209177_100983582 | 3300027775 | Agricultural Soil | AEKLAVDHHKVDDELWAELCRHFTQAEIIELTAHTTLFIGFGRFNEIVGLDPA |
Ga0209180_102964453 | 3300027846 | Vadose Zone Soil | QKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0209701_101048103 | 3300027862 | Vadose Zone Soil | LWSELRQRFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA |
Ga0209814_100878494 | 3300027873 | Populus Rhizosphere | VDESLWSELREHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPA |
Ga0209481_101424681 | 3300027880 | Populus Rhizosphere | VDEALWSELRGHFSEAEIIELVAHTTLYIGWGRFNEIVGIDPS |
Ga0209481_103519032 | 3300027880 | Populus Rhizosphere | VDHHKVDEPQWAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0209486_103656262 | 3300027886 | Agricultural Soil | MRQQFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA |
Ga0207428_101256012 | 3300027907 | Populus Rhizosphere | VDHQKVDDDLWAEVRAHFSEAELIELVAHTTLYIGFGRFNEIVGLDPS |
Ga0209382_102230433 | 3300027909 | Populus Rhizosphere | VDDRAWAELRAQFSEAEVIELTMHATLYIGLGRFNEVIGLDPNDLG |
Ga0209382_114905992 | 3300027909 | Populus Rhizosphere | VDHHKVDDTLWSEMRAQFTEAEIIELVAHTTLFIGFGRFNEIVGIEPPE |
Ga0209382_115567442 | 3300027909 | Populus Rhizosphere | VRRHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0209868_10129912 | 3300027947 | Groundwater Sand | DALWAEMRSQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0209889_10791641 | 3300027952 | Groundwater Sand | VDHHKVDDTLWAEMRSLFSEAEIIELAAHTTLFIGFGRFNEIVGLEPA |
Ga0209526_103321171 | 3300028047 | Forest Soil | VDHHKVDDTLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0268264_108803082 | 3300028381 | Switchgrass Rhizosphere | VDHQKVDDALWAEMRREFTEAEIIELVAHTTLFIGFGRFNEIVGLDPA |
Ga0307504_103117082 | 3300028792 | Soil | VDHQKVDDALWAELRGQFSEAEIIELVAHATLYIGFGRFNEIIGI |
Ga0307284_104245631 | 3300028799 | Soil | VDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID |
Ga0307281_100362111 | 3300028803 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNE |
Ga0307312_110096251 | 3300028828 | Soil | MRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPARSGP |
Ga0307278_100917272 | 3300028878 | Soil | MRSHFSQAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0302046_107110902 | 3300030620 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID |
Ga0299913_117153891 | 3300031229 | Soil | TLWAELRSHLSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0308194_104015042 | 3300031421 | Soil | VDHNKVDDAFWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEI |
Ga0307408_1000555624 | 3300031548 | Rhizosphere | LWADLRAEFSEAEIIELVAHTTLYIGFGRFNDIIGLQPVAASRS |
Ga0307408_1003068032 | 3300031548 | Rhizosphere | VRRHFSEAEVIELVAHTTLYIGFGRLNEIIGLDLA |
Ga0310813_100129205 | 3300031716 | Soil | VLWAELSRHFTEAEIIELTAHTTLFIGFGRFNEIVGLDPA |
Ga0307469_100826843 | 3300031720 | Hardwood Forest Soil | VDDALWAELRAQFSEAEIIELAAHTTLFIGLGRFNEILGIDPV |
Ga0307405_102801333 | 3300031731 | Rhizosphere | DDALWRELRSHYSEAEIIELTVHLTLYIGMGRFNEVIGLDPA |
Ga0307405_108544161 | 3300031731 | Rhizosphere | WAELRERFSESEIIELALHVTLFIGLGRFNTVIGLEV |
Ga0318501_101216124 | 3300031736 | Soil | QKIDDALWAELRSHFTEAELIELVAHTTLYIGFGRFNEIIGLEPA |
Ga0307468_1011359611 | 3300031740 | Hardwood Forest Soil | EVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0318499_102209453 | 3300031832 | Soil | LWAELRSHFTEAELIELVAHTTLYIGFGRFNEIIGLEPA |
Ga0315290_104985522 | 3300031834 | Sediment | MRQHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPV |
Ga0310904_112798002 | 3300031854 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGWGRFNEIVGIEPA |
Ga0310893_105244631 | 3300031892 | Soil | VDDAQWAKLRRHFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0326597_112152762 | 3300031965 | Soil | MRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0310903_105260612 | 3300032000 | Soil | VDHQKVDDDLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0310890_114159042 | 3300032075 | Soil | VDHHKVDDSLWAEMRSHFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0307470_100396864 | 3300032174 | Hardwood Forest Soil | VDHSKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGID |
Ga0307470_115078241 | 3300032174 | Hardwood Forest Soil | MELRDNFSESELIELTMHTTLYIGMGRFNEVIGLDPA |
Ga0307472_1006774831 | 3300032205 | Hardwood Forest Soil | DLWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0307472_1018811462 | 3300032205 | Hardwood Forest Soil | VDHHKVDDALWAEMRRHFSEAEIIELVAHTTLYIGFGRFNDIVGLDPV |
Ga0335085_100108789 | 3300032770 | Soil | VDHQKVDDALWAEVRAQFSEAEVIELAAHTTLYIGFGRFNEIVGIDPA |
Ga0335085_105759523 | 3300032770 | Soil | VDHQKIDDALWAELRSQFTEAELIELTAHTTLYIGFGRFNEIVGLDPA |
Ga0335083_108624942 | 3300032954 | Soil | DHQKIDDALWAELRSQFTEAELIELTAHTTLYIGFGRFNEIVGLDPA |
Ga0335084_115879012 | 3300033004 | Soil | LRTHFSESDVIELAMHTTLYIGLGRFNEVVGLDPA |
Ga0335077_112542131 | 3300033158 | Soil | DDVLWAELRKHFSESDIIELAMHTTLYIGLGRFNEVVGLDPA |
Ga0326729_10649462 | 3300033432 | Peat Soil | VDHRKVDDALWAEVRARFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0326726_106102571 | 3300033433 | Peat Soil | AEKLAVDHRKVDDALWAEVRARFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0316620_121203502 | 3300033480 | Soil | VDHQKVDDALWAEVRARFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0326732_10179052 | 3300033501 | Peat Soil | VDHRKVDDALWSEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0316628_1001235983 | 3300033513 | Soil | VDHQKVDDALWAEVRAQFSEGEVIELVAHTTLYIGFGRFNEIVGIDPA |
Ga0247829_101859112 | 3300033550 | Soil | VRRHFSEAEMIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0247829_102856833 | 3300033550 | Soil | VDDALWSDVRHHLSEAEVIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0314866_070310_77_223 | 3300033807 | Peatland | VDHRKIDDTLWAELRRHFSDAELIELTAHTTLYIGFGRFNEIVGLDPA |
Ga0364924_038134_35_181 | 3300033811 | Sediment | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIVGLEPA |
Ga0364926_110472_456_563 | 3300033812 | Sediment | MRSHFSEAEIVELVAHATLYIGFGRFNEIVGVDPA |
Ga0364930_0305131_46_153 | 3300033814 | Sediment | VRARFSEAEVIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0364940_0202429_452_580 | 3300034164 | Sediment | VDHQKVDDALWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEIV |
Ga0364942_0030239_88_195 | 3300034165 | Sediment | MRSHFSEAEIIELVAHTTLYIGLGRFNEIVGLDPA |
Ga0364931_0080213_906_1013 | 3300034176 | Sediment | VRDRFSEAEIIELVAHATLYIGFGRFNEIVGVEPA |
Ga0364932_0371700_421_537 | 3300034177 | Sediment | WSELRRQFSEAEIIELVAHTTLYIGFGRFNEIVGLDPA |
Ga0373950_0072174_2_145 | 3300034818 | Rhizosphere Soil | VDHQKVDDELWAEVRAQFSEAEVIELVAHTTLYIGFGRFNEMVGIDPA |
⦗Top⦘ |