Basic Information | |
---|---|
Family ID | F007383 |
Family Type | Metagenome |
Number of Sequences | 352 |
Average Sequence Length | 42 residues |
Representative Sequence | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG |
Number of Associated Samples | 172 |
Number of Associated Scaffolds | 352 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 81.14 % |
% of genes near scaffold ends (potentially truncated) | 21.59 % |
% of genes from short scaffolds (< 2000 bps) | 77.84 % |
Associated GOLD sequencing projects | 155 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.466 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (42.614 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.739 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.273 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.42% β-sheet: 0.00% Coil/Unstructured: 83.58% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 352 Family Scaffolds |
---|---|---|
PF11431 | Transport_MerF | 12.22 |
PF13411 | MerR_1 | 4.26 |
PF09278 | MerR-DNA-bind | 1.70 |
PF11604 | CusF_Ec | 1.70 |
PF03243 | MerB | 1.42 |
PF00403 | HMA | 1.14 |
PF00496 | SBP_bac_5 | 1.14 |
PF00581 | Rhodanese | 1.14 |
PF00578 | AhpC-TSA | 1.14 |
PF00072 | Response_reg | 0.85 |
PF13847 | Methyltransf_31 | 0.85 |
PF00440 | TetR_N | 0.85 |
PF03476 | MOSC_N | 0.85 |
PF13442 | Cytochrome_CBB3 | 0.85 |
PF00376 | MerR | 0.85 |
PF01545 | Cation_efflux | 0.85 |
PF13458 | Peripla_BP_6 | 0.57 |
PF04392 | ABC_sub_bind | 0.57 |
PF04542 | Sigma70_r2 | 0.57 |
PF07681 | DoxX | 0.57 |
PF02683 | DsbD | 0.57 |
PF00239 | Resolvase | 0.57 |
PF13649 | Methyltransf_25 | 0.57 |
PF00462 | Glutaredoxin | 0.57 |
PF02585 | PIG-L | 0.28 |
PF00106 | adh_short | 0.28 |
PF05708 | Peptidase_C92 | 0.28 |
PF02627 | CMD | 0.28 |
PF06941 | NT5C | 0.28 |
PF01794 | Ferric_reduct | 0.28 |
PF03795 | YCII | 0.28 |
PF00140 | Sigma70_r1_2 | 0.28 |
PF08281 | Sigma70_r4_2 | 0.28 |
PF00571 | CBS | 0.28 |
PF00107 | ADH_zinc_N | 0.28 |
PF09423 | PhoD | 0.28 |
PF00892 | EamA | 0.28 |
PF09084 | NMT1 | 0.28 |
PF13565 | HTH_32 | 0.28 |
PF02566 | OsmC | 0.28 |
PF03150 | CCP_MauG | 0.28 |
PF00389 | 2-Hacid_dh | 0.28 |
PF00266 | Aminotran_5 | 0.28 |
PF11838 | ERAP1_C | 0.28 |
PF16916 | ZT_dimer | 0.28 |
PF01497 | Peripla_BP_2 | 0.28 |
PF13192 | Thioredoxin_3 | 0.28 |
PF13416 | SBP_bac_8 | 0.28 |
PF11666 | DUF2933 | 0.28 |
PF00158 | Sigma54_activat | 0.28 |
PF06468 | Spond_N | 0.28 |
PF07589 | PEP-CTERM | 0.28 |
PF13683 | rve_3 | 0.28 |
PF12840 | HTH_20 | 0.28 |
PF12911 | OppC_N | 0.28 |
PF09594 | GT87 | 0.28 |
PF00866 | Ring_hydroxyl_B | 0.28 |
PF07883 | Cupin_2 | 0.28 |
PF00881 | Nitroreductase | 0.28 |
PF09250 | Prim-Pol | 0.28 |
PF04545 | Sigma70_r4 | 0.28 |
PF01206 | TusA | 0.28 |
PF02867 | Ribonuc_red_lgC | 0.28 |
PF13365 | Trypsin_2 | 0.28 |
PF08282 | Hydrolase_3 | 0.28 |
PF00561 | Abhydrolase_1 | 0.28 |
COG ID | Name | Functional Category | % Frequency in 352 Family Scaffolds |
---|---|---|---|
COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 1.70 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.42 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 1.14 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.85 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.85 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.85 |
COG3217 | N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domain | Defense mechanisms [V] | 0.85 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.85 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.57 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.57 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.57 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.57 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.57 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.57 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.57 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.57 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.28 |
COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.28 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.28 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.28 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.28 |
COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.28 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.28 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.28 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.28 |
COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.28 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.28 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.28 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.28 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.28 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.28 |
COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.28 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.28 |
COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.28 |
COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.28 |
COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.28 |
COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.28 |
COG5517 | 3-phenylpropionate/cinnamic acid dioxygenase, small subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.28 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.75 % |
Unclassified | root | N/A | 6.25 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_100967221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
3300002120|C687J26616_10138782 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300002121|C687J26615_10009344 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
3300002123|C687J26634_10189694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
3300002124|C687J26631_10192976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 678 | Open in IMG/M |
3300002908|JGI25382J43887_10069423 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1905 | Open in IMG/M |
3300002908|JGI25382J43887_10339648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
3300002908|JGI25382J43887_10351286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 625 | Open in IMG/M |
3300002908|JGI25382J43887_10490270 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300003324|soilH2_10030028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8495 | Open in IMG/M |
3300005172|Ga0066683_10410225 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300005172|Ga0066683_10769185 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300005174|Ga0066680_10133094 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1546 | Open in IMG/M |
3300005176|Ga0066679_10361060 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300005178|Ga0066688_10171132 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300005180|Ga0066685_10370235 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300005181|Ga0066678_10066422 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2099 | Open in IMG/M |
3300005181|Ga0066678_10523206 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300005186|Ga0066676_10171027 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300005186|Ga0066676_10412569 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300005186|Ga0066676_10588304 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300005332|Ga0066388_103414629 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300005445|Ga0070708_100002489 | All Organisms → cellular organisms → Bacteria | 14221 | Open in IMG/M |
3300005445|Ga0070708_100012453 | All Organisms → cellular organisms → Bacteria | 6943 | Open in IMG/M |
3300005445|Ga0070708_100264951 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
3300005445|Ga0070708_100412469 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300005445|Ga0070708_101295254 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300005447|Ga0066689_10146762 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300005451|Ga0066681_10982837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
3300005467|Ga0070706_100051302 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
3300005467|Ga0070706_100288188 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
3300005467|Ga0070706_100463173 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300005467|Ga0070706_100584202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1038 | Open in IMG/M |
3300005467|Ga0070706_100666525 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300005467|Ga0070706_101543155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
3300005468|Ga0070707_100356033 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1422 | Open in IMG/M |
3300005468|Ga0070707_100647124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
3300005468|Ga0070707_100650420 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300005518|Ga0070699_100035960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4283 | Open in IMG/M |
3300005518|Ga0070699_100704697 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300005518|Ga0070699_102087595 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005529|Ga0070741_10016357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12382 | Open in IMG/M |
3300005529|Ga0070741_10347925 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1376 | Open in IMG/M |
3300005540|Ga0066697_10123659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1518 | Open in IMG/M |
3300005552|Ga0066701_10012339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3962 | Open in IMG/M |
3300005552|Ga0066701_10058480 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
3300005554|Ga0066661_10031163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2944 | Open in IMG/M |
3300005556|Ga0066707_10189741 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300005557|Ga0066704_10128618 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
3300005586|Ga0066691_10010766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4252 | Open in IMG/M |
3300005586|Ga0066691_10060399 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300005598|Ga0066706_10139830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1809 | Open in IMG/M |
3300005598|Ga0066706_10367564 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300005713|Ga0066905_100736672 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300005713|Ga0066905_102098843 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005764|Ga0066903_104487466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 745 | Open in IMG/M |
3300005876|Ga0075300_1059432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
3300005879|Ga0075295_1059083 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
3300006049|Ga0075417_10132312 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300006173|Ga0070716_100011248 | All Organisms → cellular organisms → Bacteria | 4506 | Open in IMG/M |
3300006796|Ga0066665_10323519 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300006796|Ga0066665_11535982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Paucidesulfovibrio → Paucidesulfovibrio longus | 521 | Open in IMG/M |
3300006806|Ga0079220_11721046 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300006852|Ga0075433_10042742 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3933 | Open in IMG/M |
3300006904|Ga0075424_100339802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1599 | Open in IMG/M |
3300006904|Ga0075424_100430448 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
3300007255|Ga0099791_10371771 | Not Available | 686 | Open in IMG/M |
3300007255|Ga0099791_10380751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 678 | Open in IMG/M |
3300007255|Ga0099791_10543570 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300007265|Ga0099794_10260908 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300009012|Ga0066710_100064824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4643 | Open in IMG/M |
3300009012|Ga0066710_100305541 | All Organisms → cellular organisms → Bacteria | 2332 | Open in IMG/M |
3300009012|Ga0066710_101076028 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1243 | Open in IMG/M |
3300009012|Ga0066710_101956664 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300009012|Ga0066710_102383870 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300009012|Ga0066710_102534777 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300009038|Ga0099829_10009761 | All Organisms → cellular organisms → Bacteria | 6170 | Open in IMG/M |
3300009038|Ga0099829_10021279 | All Organisms → cellular organisms → Bacteria | 4458 | Open in IMG/M |
3300009038|Ga0099829_10081281 | All Organisms → cellular organisms → Bacteria | 2482 | Open in IMG/M |
3300009038|Ga0099829_10136166 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1948 | Open in IMG/M |
3300009038|Ga0099829_10233687 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
3300009038|Ga0099829_10549635 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300009038|Ga0099829_10682407 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300009038|Ga0099829_10835502 | Not Available | 765 | Open in IMG/M |
3300009038|Ga0099829_10838354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
3300009038|Ga0099829_10875357 | Not Available | 745 | Open in IMG/M |
3300009038|Ga0099829_11080174 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300009088|Ga0099830_10143929 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
3300009088|Ga0099830_10358445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYMSc13B | 1174 | Open in IMG/M |
3300009088|Ga0099830_10805490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 775 | Open in IMG/M |
3300009088|Ga0099830_10828655 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300009088|Ga0099830_10887476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 737 | Open in IMG/M |
3300009088|Ga0099830_10939897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 715 | Open in IMG/M |
3300009088|Ga0099830_11576432 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300009089|Ga0099828_10000905 | All Organisms → cellular organisms → Bacteria | 19013 | Open in IMG/M |
3300009089|Ga0099828_10051273 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3426 | Open in IMG/M |
3300009089|Ga0099828_10309140 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300009089|Ga0099828_10499260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
3300009089|Ga0099828_10502300 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300009089|Ga0099828_10544477 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300009089|Ga0099828_10634574 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300009089|Ga0099828_10661316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 939 | Open in IMG/M |
3300009089|Ga0099828_10735660 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300009089|Ga0099828_10853517 | Not Available | 814 | Open in IMG/M |
3300009089|Ga0099828_11098748 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300009089|Ga0099828_11567982 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300009089|Ga0099828_11671083 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300009089|Ga0099828_11721304 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 551 | Open in IMG/M |
3300009090|Ga0099827_10067920 | All Organisms → cellular organisms → Bacteria | 2741 | Open in IMG/M |
3300009090|Ga0099827_10312887 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300009090|Ga0099827_10330055 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
3300009090|Ga0099827_11090205 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300009090|Ga0099827_11193614 | Not Available | 661 | Open in IMG/M |
3300009090|Ga0099827_11392527 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 610 | Open in IMG/M |
3300009090|Ga0099827_11483080 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
3300009090|Ga0099827_11488408 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300009137|Ga0066709_100471446 | All Organisms → cellular organisms → Bacteria | 1761 | Open in IMG/M |
3300009137|Ga0066709_100545575 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
3300009137|Ga0066709_101946191 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300009137|Ga0066709_104576327 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300009143|Ga0099792_10389728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 850 | Open in IMG/M |
3300009147|Ga0114129_10329173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2029 | Open in IMG/M |
3300009444|Ga0114945_10007168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6056 | Open in IMG/M |
3300009444|Ga0114945_10069437 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
3300009444|Ga0114945_10329779 | Not Available | 902 | Open in IMG/M |
3300009444|Ga0114945_10391074 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 828 | Open in IMG/M |
3300009777|Ga0105164_10016738 | All Organisms → cellular organisms → Bacteria | 4165 | Open in IMG/M |
3300009814|Ga0105082_1119984 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 511 | Open in IMG/M |
3300009816|Ga0105076_1023489 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
3300009820|Ga0105085_1082282 | Not Available | 613 | Open in IMG/M |
3300009820|Ga0105085_1100959 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
3300010043|Ga0126380_11209058 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300010046|Ga0126384_10056324 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
3300010046|Ga0126384_12326599 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
3300010047|Ga0126382_11793301 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
3300010304|Ga0134088_10470450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 617 | Open in IMG/M |
3300010335|Ga0134063_10632355 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
3300010336|Ga0134071_10535844 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
3300010336|Ga0134071_10581548 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300010336|Ga0134071_10704059 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
3300010336|Ga0134071_10798932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
3300010359|Ga0126376_12215608 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
3300010391|Ga0136847_10361054 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
3300010391|Ga0136847_11194467 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300010391|Ga0136847_11803834 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
3300010391|Ga0136847_12627177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
3300010391|Ga0136847_13180216 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300010938|Ga0137716_10203426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1197 | Open in IMG/M |
3300011269|Ga0137392_10380860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1170 | Open in IMG/M |
3300011269|Ga0137392_10426712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1101 | Open in IMG/M |
3300011269|Ga0137392_10526167 | Not Available | 982 | Open in IMG/M |
3300011270|Ga0137391_10039827 | All Organisms → cellular organisms → Bacteria | 3980 | Open in IMG/M |
3300011270|Ga0137391_10065635 | All Organisms → cellular organisms → Bacteria | 3112 | Open in IMG/M |
3300011270|Ga0137391_10942509 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300011270|Ga0137391_11208222 | Not Available | 604 | Open in IMG/M |
3300011270|Ga0137391_11381477 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300011271|Ga0137393_10244678 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1521 | Open in IMG/M |
3300011271|Ga0137393_10527865 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300011271|Ga0137393_11431873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 580 | Open in IMG/M |
3300011271|Ga0137393_11625988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
3300012096|Ga0137389_10022858 | All Organisms → cellular organisms → Bacteria | 4427 | Open in IMG/M |
3300012096|Ga0137389_10032752 | All Organisms → cellular organisms → Bacteria | 3787 | Open in IMG/M |
3300012096|Ga0137389_10033876 | All Organisms → cellular organisms → Bacteria | 3732 | Open in IMG/M |
3300012096|Ga0137389_10482003 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300012096|Ga0137389_10629880 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300012096|Ga0137389_11172595 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300012189|Ga0137388_10116699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2319 | Open in IMG/M |
3300012189|Ga0137388_10254613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1599 | Open in IMG/M |
3300012189|Ga0137388_10672400 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300012189|Ga0137388_11314452 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300012189|Ga0137388_11624336 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300012202|Ga0137363_10246826 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
3300012202|Ga0137363_10632691 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300012202|Ga0137363_10962527 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 725 | Open in IMG/M |
3300012202|Ga0137363_11578802 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
3300012204|Ga0137374_10013074 | All Organisms → cellular organisms → Bacteria | 9643 | Open in IMG/M |
3300012204|Ga0137374_10052237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4195 | Open in IMG/M |
3300012204|Ga0137374_10059729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3841 | Open in IMG/M |
3300012204|Ga0137374_10124129 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
3300012205|Ga0137362_10081225 | All Organisms → cellular organisms → Bacteria | 2703 | Open in IMG/M |
3300012205|Ga0137362_10591034 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300012205|Ga0137362_10762004 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300012205|Ga0137362_10837357 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300012205|Ga0137362_11679908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 522 | Open in IMG/M |
3300012207|Ga0137381_10195424 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1752 | Open in IMG/M |
3300012207|Ga0137381_10831027 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300012209|Ga0137379_11541872 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 564 | Open in IMG/M |
3300012210|Ga0137378_10762524 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300012211|Ga0137377_10022883 | All Organisms → cellular organisms → Bacteria | 5555 | Open in IMG/M |
3300012349|Ga0137387_10520923 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300012350|Ga0137372_10158424 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1843 | Open in IMG/M |
3300012351|Ga0137386_10690681 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300012351|Ga0137386_11100465 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300012351|Ga0137386_11200837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300012353|Ga0137367_10074602 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
3300012354|Ga0137366_10554634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 827 | Open in IMG/M |
3300012356|Ga0137371_10321189 | Not Available | 1205 | Open in IMG/M |
3300012357|Ga0137384_11407900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
3300012358|Ga0137368_10053251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3413 | Open in IMG/M |
3300012359|Ga0137385_10969720 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300012360|Ga0137375_10357223 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300012361|Ga0137360_10033542 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3575 | Open in IMG/M |
3300012361|Ga0137360_10103850 | All Organisms → cellular organisms → Bacteria | 2180 | Open in IMG/M |
3300012361|Ga0137360_10156032 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300012361|Ga0137360_10484561 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
3300012362|Ga0137361_10448074 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
3300012362|Ga0137361_11356627 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300012363|Ga0137390_10012362 | All Organisms → cellular organisms → Bacteria | 7637 | Open in IMG/M |
3300012363|Ga0137390_10199984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1985 | Open in IMG/M |
3300012363|Ga0137390_10258649 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300012363|Ga0137390_10308935 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
3300012363|Ga0137390_10805891 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 897 | Open in IMG/M |
3300012363|Ga0137390_11737469 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
3300012363|Ga0137390_11794185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300012532|Ga0137373_10225029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1529 | Open in IMG/M |
3300012685|Ga0137397_10804924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 697 | Open in IMG/M |
3300012927|Ga0137416_11599735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 593 | Open in IMG/M |
3300012929|Ga0137404_10307887 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1376 | Open in IMG/M |
3300012929|Ga0137404_10536738 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300012929|Ga0137404_11013555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 760 | Open in IMG/M |
3300012929|Ga0137404_11214459 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300012929|Ga0137404_12115339 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 526 | Open in IMG/M |
3300012930|Ga0137407_10042104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3655 | Open in IMG/M |
3300012944|Ga0137410_10308520 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300012960|Ga0164301_10199477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1274 | Open in IMG/M |
3300012972|Ga0134077_10446951 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
3300012976|Ga0134076_10239974 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300014262|Ga0075301_1070561 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300015245|Ga0137409_10312203 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
3300015358|Ga0134089_10093799 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
3300016404|Ga0182037_11239994 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300017656|Ga0134112_10165207 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300017659|Ga0134083_10093002 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300017659|Ga0134083_10098182 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300017659|Ga0134083_10582371 | Not Available | 510 | Open in IMG/M |
3300017997|Ga0184610_1027446 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
3300017997|Ga0184610_1196048 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
3300018031|Ga0184634_10178469 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 961 | Open in IMG/M |
3300018056|Ga0184623_10002174 | All Organisms → cellular organisms → Bacteria | 8453 | Open in IMG/M |
3300018056|Ga0184623_10384178 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300018063|Ga0184637_10132638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1536 | Open in IMG/M |
3300018063|Ga0184637_10281633 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300018074|Ga0184640_10498000 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 537 | Open in IMG/M |
3300018079|Ga0184627_10142155 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1272 | Open in IMG/M |
3300018082|Ga0184639_10098693 | Not Available | 1543 | Open in IMG/M |
3300018431|Ga0066655_10671582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 701 | Open in IMG/M |
3300018431|Ga0066655_11432412 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300018468|Ga0066662_10558597 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300018468|Ga0066662_10644891 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300018468|Ga0066662_11263019 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300018468|Ga0066662_11776446 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300019360|Ga0187894_10026607 | All Organisms → cellular organisms → Bacteria | 3859 | Open in IMG/M |
3300019458|Ga0187892_10000155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 172693 | Open in IMG/M |
3300019458|Ga0187892_10003726 | All Organisms → cellular organisms → Bacteria | 27195 | Open in IMG/M |
3300019458|Ga0187892_10005550 | All Organisms → cellular organisms → Bacteria | 19717 | Open in IMG/M |
3300019458|Ga0187892_10279557 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 842 | Open in IMG/M |
3300019789|Ga0137408_1110229 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300019789|Ga0137408_1231892 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
3300019789|Ga0137408_1293893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 628 | Open in IMG/M |
3300021086|Ga0179596_10423387 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300021437|Ga0213917_1018705 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300021560|Ga0126371_10213298 | Not Available | 2031 | Open in IMG/M |
3300022563|Ga0212128_10010438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5969 | Open in IMG/M |
3300022563|Ga0212128_10112570 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
3300022563|Ga0212128_10387544 | Not Available | 867 | Open in IMG/M |
3300022563|Ga0212128_10394358 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300022563|Ga0212128_10768700 | Not Available | 574 | Open in IMG/M |
3300025002|Ga0209001_1042872 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300025155|Ga0209320_10003223 | All Organisms → cellular organisms → Bacteria | 8191 | Open in IMG/M |
3300025157|Ga0209399_10007323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4824 | Open in IMG/M |
3300025159|Ga0209619_10027345 | All Organisms → cellular organisms → Bacteria | 3718 | Open in IMG/M |
3300025160|Ga0209109_10014145 | All Organisms → cellular organisms → Bacteria | 4295 | Open in IMG/M |
3300025173|Ga0209824_10007826 | All Organisms → cellular organisms → Bacteria | 4806 | Open in IMG/M |
3300025289|Ga0209002_10344099 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 864 | Open in IMG/M |
3300025311|Ga0209343_10505245 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 754 | Open in IMG/M |
3300025312|Ga0209321_10011723 | All Organisms → cellular organisms → Bacteria | 5558 | Open in IMG/M |
3300025318|Ga0209519_10232010 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1082 | Open in IMG/M |
3300025324|Ga0209640_10232106 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1560 | Open in IMG/M |
3300025885|Ga0207653_10163965 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300025905|Ga0207685_10020565 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
3300025910|Ga0207684_10001545 | All Organisms → cellular organisms → Bacteria | 24619 | Open in IMG/M |
3300025910|Ga0207684_10050799 | All Organisms → cellular organisms → Bacteria | 3518 | Open in IMG/M |
3300025910|Ga0207684_10149629 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
3300025910|Ga0207684_11672038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
3300025922|Ga0207646_10037640 | All Organisms → cellular organisms → Bacteria | 4361 | Open in IMG/M |
3300025922|Ga0207646_10048523 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3806 | Open in IMG/M |
3300025922|Ga0207646_10324322 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1391 | Open in IMG/M |
3300025922|Ga0207646_10490280 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1108 | Open in IMG/M |
3300025922|Ga0207646_10541459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1047 | Open in IMG/M |
3300025971|Ga0210102_1099159 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300026309|Ga0209055_1123660 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 975 | Open in IMG/M |
3300026313|Ga0209761_1316405 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300026320|Ga0209131_1088498 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
3300026333|Ga0209158_1068240 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
3300026334|Ga0209377_1338009 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 506 | Open in IMG/M |
3300026371|Ga0257179_1027653 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300026514|Ga0257168_1069310 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300026535|Ga0256867_10100978 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300026538|Ga0209056_10324932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1037 | Open in IMG/M |
3300026551|Ga0209648_10175627 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
3300026551|Ga0209648_10680199 | Not Available | 562 | Open in IMG/M |
3300027651|Ga0209217_1037681 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
3300027846|Ga0209180_10030791 | All Organisms → cellular organisms → Bacteria | 2889 | Open in IMG/M |
3300027846|Ga0209180_10084841 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
3300027846|Ga0209180_10095549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1689 | Open in IMG/M |
3300027846|Ga0209180_10138761 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
3300027846|Ga0209180_10163887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1282 | Open in IMG/M |
3300027846|Ga0209180_10356550 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300027846|Ga0209180_10423385 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300027846|Ga0209180_10449536 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300027846|Ga0209180_10526113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 660 | Open in IMG/M |
3300027846|Ga0209180_10626710 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300027862|Ga0209701_10139476 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300027862|Ga0209701_10226618 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300027862|Ga0209701_10544483 | Not Available | 624 | Open in IMG/M |
3300027875|Ga0209283_10569791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300027875|Ga0209283_10975147 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300027875|Ga0209283_10993397 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
3300027882|Ga0209590_10264082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium RIFCSPLOWO2_02_FULL_68_19 | 1100 | Open in IMG/M |
3300027882|Ga0209590_10268264 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300027882|Ga0209590_10700800 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300027882|Ga0209590_10893103 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300027882|Ga0209590_11062848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_4_65_12 | 502 | Open in IMG/M |
3300027903|Ga0209488_10091223 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
3300027952|Ga0209889_1049829 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300027957|Ga0209857_1021489 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300028047|Ga0209526_10038290 | All Organisms → cellular organisms → Bacteria | 3374 | Open in IMG/M |
3300028536|Ga0137415_10982129 | Not Available | 655 | Open in IMG/M |
3300030606|Ga0299906_11058415 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
3300030620|Ga0302046_10130084 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
3300031229|Ga0299913_10763415 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300031229|Ga0299913_11701597 | Not Available | 581 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1193906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 512 | Open in IMG/M |
3300031561|Ga0318528_10003769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6338 | Open in IMG/M |
3300031561|Ga0318528_10265088 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 922 | Open in IMG/M |
3300031834|Ga0315290_10036371 | All Organisms → cellular organisms → Bacteria | 3936 | Open in IMG/M |
3300031949|Ga0214473_10013468 | All Organisms → cellular organisms → Bacteria | 9575 | Open in IMG/M |
3300031949|Ga0214473_11644481 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300032025|Ga0318507_10287992 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300032163|Ga0315281_10225177 | All Organisms → cellular organisms → Bacteria | 2080 | Open in IMG/M |
3300032174|Ga0307470_10603283 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300032180|Ga0307471_101719160 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
3300032180|Ga0307471_103931881 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
3300033233|Ga0334722_10298834 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
3300033417|Ga0214471_10005512 | All Organisms → cellular organisms → Bacteria | 9781 | Open in IMG/M |
3300033417|Ga0214471_10249207 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1452 | Open in IMG/M |
3300033417|Ga0214471_10505989 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
3300034165|Ga0364942_0018683 | All Organisms → cellular organisms → Bacteria | 2190 | Open in IMG/M |
3300034177|Ga0364932_0389670 | Not Available | 525 | Open in IMG/M |
3300034178|Ga0364934_0006379 | All Organisms → cellular organisms → Bacteria | 4113 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 42.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.24% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.69% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 2.84% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.99% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.70% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.70% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.42% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.42% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.14% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 1.14% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.85% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.85% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.57% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.57% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.57% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.57% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.28% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.28% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.28% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.28% |
Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.28% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.28% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.28% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.28% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.28% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.28% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
3300002123 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3 | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021437 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300025002 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2 (SPAdes) | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027957 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1009672213 | 3300000956 | Soil | VSRADVNFRDREARVTFDPAQVGVDQLVEAVTRAGFRASLKRNGA* |
C687J26616_101387821 | 3300002120 | Soil | VQKADVSFRDKQARVTFDPDRVGVEQMIDAVSRIGFRASLKAAEPTR* |
C687J26615_100093444 | 3300002121 | Soil | VQKADVSFRDKQARVTFDPDRVGVEQMIDAVNRIGFRASLKATEPAR* |
C687J26634_101896941 | 3300002123 | Soil | VQKADVSFRDKQARVTFDPDRVGVEQMIDAVSRIGFRTSLKAAEPTR* |
C687J26631_101929762 | 3300002124 | Soil | VQRAEVSFRYKQARVTFDPSQVSVGQLIDAVNRLGFRASARTVEPMK* |
JGI25382J43887_100694232 | 3300002908 | Grasslands Soil | VSFRDKEARVTFDPAQVTVEQLIEAVNRAGFRAALKAGDAN* |
JGI25382J43887_103396481 | 3300002908 | Grasslands Soil | VSFRDKEARVVFDPGLVTVEEMIAAVGRAGFRAALKRQGE* |
JGI25382J43887_103512862 | 3300002908 | Grasslands Soil | VSFRDKEARVVFDPGLVTVEEMTAAVGRAGFRAALKRQDE* |
JGI25382J43887_104902701 | 3300002908 | Grasslands Soil | VHRADVSFRDRQARVTFDPDQVTVEQLIGAINKAGFRAEL |
soilH2_100300286 | 3300003324 | Sugarcane Root And Bulk Soil | VSFREKEARVAFDPGQVAVEQLIDAVNRFGFRASLKAAK* |
Ga0066683_104102251 | 3300005172 | Soil | MGVNRADVSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASRKGSPR* |
Ga0066683_107691851 | 3300005172 | Soil | VSFRNKEARVTFDPARVTPEQLIQAVDKLGFRAFLKAGG* |
Ga0066680_101330943 | 3300005174 | Soil | VSFRDKEARVVYDATQVTVEQMVTAVNGAGFRASVKRQGE* |
Ga0066679_103610602 | 3300005176 | Soil | VSFRDKEARVTFDPARVGVEQLIQAVKGAGFRAFVKGGD* |
Ga0066688_101711321 | 3300005178 | Soil | GVQRADVSFRDKEARVTFDPARVTSDQRIQAVDQLGFHASLKAGG* |
Ga0066685_103702351 | 3300005180 | Soil | VSRADVSFRDKEARVVYDATQVTVEQMVTAVNGAGFRASVKRQGE* |
Ga0066678_100664222 | 3300005181 | Soil | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0066678_105232063 | 3300005181 | Soil | RNKEARVTFDPAEVSLVQLAEAVNKIGFRAALKAGDAPK* |
Ga0066676_101710273 | 3300005186 | Soil | VSFRDKEARVTFDLTQVTVEQLIEAVNKAGFRAALKAGGAAN* |
Ga0066676_104125691 | 3300005186 | Soil | GVQRADVSFRDKEARVTFDPARVTTDQLIQAVGKLGFRASLKAGG* |
Ga0066676_105883042 | 3300005186 | Soil | VSRADVSLKDKEARVTFDPAEVSLAQLAEAVNTIGFRAALKAGDVPK* |
Ga0066388_1034146292 | 3300005332 | Tropical Forest Soil | VSFREREARVTFESTQIGVDQLIAAVTRAGFLASLKPADAK* |
Ga0070708_1000024898 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRADVSFRDKEARVTLDPTRVTTDQLIEAVDKLGFRASLKAGR* |
Ga0070708_1000124537 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRADVSFRDKEARVTFDPARVTTDQLIQAVGKLGFRASLKAGG* |
Ga0070708_1002649511 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRADVSFRDKEARVTFDPARVTTDQIIQAIDKLGFRASVKAGG* |
Ga0070708_1004124691 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVNRADVSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASRKGSPQ* |
Ga0070708_1012952541 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRADVSFKDKEARVTFDPAEVSIAQLAEAVNKIGLRAALKAGDAPK* |
Ga0066689_101467623 | 3300005447 | Soil | VSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASLKSSPR* |
Ga0066681_109828371 | 3300005451 | Soil | VSFRDKEARVIFDPVRVTTDQLIQAVGKLGFRASLKAGG* |
Ga0070706_1000513022 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFRDKEARVTFDPARVTTDQLIQAVGKLGFRASLKAGG* |
Ga0070706_1002881881 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LPGVQRAEVNFRDKEARVIFDPARVSVDQLIRAVKDAGFRASLKGRT* |
Ga0070706_1004631731 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFRDKEARVTFDRARVGVEQLIQAVKGAGFRASVKGGD* |
Ga0070706_1005842024 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RAEVSFRDKEARVTFDPARVGVEQLIQAVKGAGFRAFVKGGD* |
Ga0070706_1006665252 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVSFRDKQARVTFDRDQVSVEQLIDAVNRLGFRASLKAAEPAK* |
Ga0070706_1015431551 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | RAEVSFRDKEARVTFDPARVGVEQLIQAVKGAGFRAFVKG* |
Ga0070707_1003560332 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFRDKEARVTFDPARVGVDQLIQAVKDAGFRASLKGGG* |
Ga0070707_1006471241 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVSFRDKQARVTFDRDQVSVEQLIDAVNRLGFRASLKAAEPAR* |
Ga0070707_1006504202 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VNFRDKEARVRFDPAQVAVDQLIEAVTRAGFRASLKRTGA* |
Ga0070699_1000359604 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFRDKEARVTLDPTRVTTDQLIEAVDKLGFRASLKAGR* |
Ga0070699_1007046973 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVSFRDKEARVTFDPARVGVDQLIQAVKDAGFRASLK |
Ga0070699_1020875951 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVNFRDKEARVIFDPARVSVDQLIRAVKDAGFRASLKGR |
Ga0070741_100163578 | 3300005529 | Surface Soil | VSRADVSFKDKEARVTFDPAQVGIVQLAEAVNKIGFRATLKAGDAPK* |
Ga0070741_103479251 | 3300005529 | Surface Soil | VSRADVSFRDKEARVTFDPAQVDVARLAEAVNKIGFRATLKVGDAPK* |
Ga0066697_101236593 | 3300005540 | Soil | VSFRDKEARVTFDPARVTTDELIQAIDKLGFRASLKGGG* |
Ga0066701_100123396 | 3300005552 | Soil | GVQRADVSFRDKEARVTFDPARVTTDELIQAIDKLGFRASLKGGG* |
Ga0066701_100584803 | 3300005552 | Soil | VARADVSFRDKEARVVYEPGQVTVAQMIAAVNGAGFRASVKRQGE* |
Ga0066661_100311634 | 3300005554 | Soil | VQRADVSFRDKEVRVTFDPARVTSDQLIQAVDQLGFHASLKAGG* |
Ga0066707_101897414 | 3300005556 | Soil | MGVNRADVSFRDKEARVTFDPALVAVDQLIDAVKKAGFSASLKGSPR* |
Ga0066704_101286182 | 3300005557 | Soil | VSRADVSFRDKEARVVYDATQVTVEQMVTAVNGAGFRASVKRRGE* |
Ga0066691_100107662 | 3300005586 | Soil | VSFRDKEVRVTFDPARVTSDQLIQAVDQLGFHASLKAGG* |
Ga0066691_100603995 | 3300005586 | Soil | VSFRDKEARVTFDQAQVTVEQLIVAVNRAGFQAALKAR* |
Ga0066706_101398301 | 3300005598 | Soil | RDFQSPRPRWLPGVQRADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0066706_103675644 | 3300005598 | Soil | VQRAEVSFRDKEARVTFDPARVTPEQLIQAIDKLGFRVFLKAGG* |
Ga0066905_1007366723 | 3300005713 | Tropical Forest Soil | VARADVSFRDREARVAYDPAQVTVEQMIAAVSGAGFRASLKREGDGTPSPR* |
Ga0066905_1020988431 | 3300005713 | Tropical Forest Soil | VSFRDKEARVTFEPAQVSVDQLIAAVTRAGFRASLKASDA |
Ga0066903_1044874661 | 3300005764 | Tropical Forest Soil | VSFHDKEARVIFDPSRVTVEQMVEAVSRAGFRASLKR* |
Ga0075300_10594321 | 3300005876 | Rice Paddy Soil | EGLTGVQKADVSFRDKQARVTFDPDRISVEQMIAAVNRIGFRASLKAAESTR* |
Ga0075295_10590831 | 3300005879 | Rice Paddy Soil | VSRADVSFRDKDARVTFDPAQVSVDQLIEAVQRAGFRASQKASAK* |
Ga0075417_101323122 | 3300006049 | Populus Rhizosphere | VSFRDKEARVTFDPARVGVEQLIQAVKGVGFRAFVKGGD* |
Ga0070716_1000112485 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVNFRDKEARVIFDPARVSVDQLIRAVNDAGFRASLKGRS* |
Ga0066665_103235191 | 3300006796 | Soil | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFHASLKAGG* |
Ga0066665_115359821 | 3300006796 | Soil | VQRADVSFRDKEARVTFDPARVTSDQRIQAVDQLGFHASLKAGG* |
Ga0079220_117210461 | 3300006806 | Agricultural Soil | AEVSFRDKEARVTFDPARVGVEQLIQAVKGVGFRAFVKGGD* |
Ga0075433_100427423 | 3300006852 | Populus Rhizosphere | VSFRDKEARVTFDPARVGVEQLIQAVKGVGFRAFVKGRD* |
Ga0075424_1003398022 | 3300006904 | Populus Rhizosphere | VSFRDKEVRVTFDPARVTIDQLIRTVDKLGFHASLKAGG* |
Ga0075424_1004304483 | 3300006904 | Populus Rhizosphere | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGR* |
Ga0099791_103717713 | 3300007255 | Vadose Zone Soil | VSFGDKEARVTFDMAQVTVDQLIEGVTRAGFRASPKHKE* |
Ga0099791_103807512 | 3300007255 | Vadose Zone Soil | VQRAEVSFRDKEAKVTFDPARVSVDQLIQAVKDAGFRASLKGRS* |
Ga0099791_105435701 | 3300007255 | Vadose Zone Soil | VSFRDKEARVVYDPGQVTVEQMIAAVNGAGFRASAKRQGE* |
Ga0099794_102609082 | 3300007265 | Vadose Zone Soil | VSFRDKEARVTFDPARVASDQRIQAVDQLGFHASLKAGG* |
Ga0066710_1000648241 | 3300009012 | Grasslands Soil | EVSFRDKEARVTFDQAQVTVEQLIEAVNRAGFRAALKARGTN |
Ga0066710_1003055411 | 3300009012 | Grasslands Soil | VSRADVSFRDKEARVVYDATQVTVEQMVTAVNGAGFRASVKRQGE |
Ga0066710_1010760284 | 3300009012 | Grasslands Soil | VSFRDKEARVTFDPARVTSDQRIQAVDQLGFHASLKAGG |
Ga0066710_1019566644 | 3300009012 | Grasslands Soil | VSFRNKDARVVFDPAHVTVEQLIEAVGRAGFHASLKATVPAKYCASLTPPSH |
Ga0066710_1023838701 | 3300009012 | Grasslands Soil | VSRADVSLRNKEARVTFDPAEVSLAQLAEAVNTIGFRAALKAGDAPK |
Ga0066710_1025347771 | 3300009012 | Grasslands Soil | VARADVSFRDKEARVVYDPGQVTVAQMIAAVNGAGFRASVKRQGE |
Ga0099829_100097615 | 3300009038 | Vadose Zone Soil | VQRAEVSFRDKEARVTFDPARVGVDQLIQAVKDAGFRASLKGGG* |
Ga0099829_100212798 | 3300009038 | Vadose Zone Soil | VSFRDKEARVVYDPGQVTVEQMIAAVNGAGFRASVRRQGE* |
Ga0099829_100812815 | 3300009038 | Vadose Zone Soil | VSFRDKAAKVTFDPARVSVDQLIQAVKDAGFRASLKAGG* |
Ga0099829_101361661 | 3300009038 | Vadose Zone Soil | ADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0099829_102336874 | 3300009038 | Vadose Zone Soil | VSFRDKAAKVTFDPARVGIDQLIQAVKDAGFRASLKGGS* |
Ga0099829_105496351 | 3300009038 | Vadose Zone Soil | VSFRDKQARVTFDRDQVSVEQLIDAVNRLGFRASLKVAEPVR* |
Ga0099829_106824072 | 3300009038 | Vadose Zone Soil | VSFRDKEARVTFDPALVGVDQLIDAVKKVGFSASLKSSPR* |
Ga0099829_108355021 | 3300009038 | Vadose Zone Soil | KQVWVTFDGERVSVERLIDTANRLGFHVSLKATEPNR* |
Ga0099829_108383542 | 3300009038 | Vadose Zone Soil | VARADVSFRNKEARVVYDPGQVTVEQMIAAVNGAGFRASVKRQGE* |
Ga0099829_108753572 | 3300009038 | Vadose Zone Soil | VSFRNKEARVTFDPARVTPEQLIQAVDKLGFRASVKAGG* |
Ga0099829_110801743 | 3300009038 | Vadose Zone Soil | VSFRDKEARVIFDPARVTTDQLIQAVDKLGFRASLKGGG* |
Ga0099830_101439293 | 3300009088 | Vadose Zone Soil | VSFRDKEARVVYDPGQVTVEQMIAAVNGAGFRASVKRQG* |
Ga0099830_103584452 | 3300009088 | Vadose Zone Soil | QASVTFDPSQVSVEQLIDAVNRLGFRASLKAAEPAR* |
Ga0099830_108054903 | 3300009088 | Vadose Zone Soil | VSFRDKEARITFDQAQVTVEQLIEAVNRAGFRAALKARRTN* |
Ga0099830_108286551 | 3300009088 | Vadose Zone Soil | VSFRHKDARVVFDPAHVTVEQLIEAVGRAGFHASLKA |
Ga0099830_108874761 | 3300009088 | Vadose Zone Soil | VQRAEVSFRYKAAKVTFDPAQIRVDQLIQALKDAGFRASLKDGG* |
Ga0099830_109398972 | 3300009088 | Vadose Zone Soil | VSFRDKQARVTFDRDQVSVEQLIDAVNRLGFRASLKAAEPAR* |
Ga0099830_115764321 | 3300009088 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIKAIDNLGFRGSLKAGG* |
Ga0099828_100009058 | 3300009089 | Vadose Zone Soil | VSFRKKEARVTFDPAQVTVEQLIEAVNRAGFRAALKAGGAT* |
Ga0099828_100512736 | 3300009089 | Vadose Zone Soil | LTGVQRADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0099828_103091401 | 3300009089 | Vadose Zone Soil | VSFREKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0099828_104992602 | 3300009089 | Vadose Zone Soil | VSFRDKAAKVTFDPARVGIDQLIQAVKDTGFRASLKGGS* |
Ga0099828_105023002 | 3300009089 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIQAVDKIGFRASLKAGG* |
Ga0099828_105444771 | 3300009089 | Vadose Zone Soil | VSRVEVSFRDKEARVTFDPAQVTVEQLIDAVNRAGFRAALKAGGVN* |
Ga0099828_106345741 | 3300009089 | Vadose Zone Soil | VSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASLKGSPR* |
Ga0099828_106613163 | 3300009089 | Vadose Zone Soil | VSFRNKEARVSFDPARVTVEQMIEAVGRAGFHASLKATKPTK* |
Ga0099828_107356602 | 3300009089 | Vadose Zone Soil | VSFRDKEARVTFDPAQVTVDQLVEAVTRAGFRASLKRGAE* |
Ga0099828_108535171 | 3300009089 | Vadose Zone Soil | LTGVQRADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRAPLKAGR* |
Ga0099828_110987481 | 3300009089 | Vadose Zone Soil | KAAKVTFDPARVSVDQLIQAVKDAGFRASLKAGG* |
Ga0099828_115679821 | 3300009089 | Vadose Zone Soil | VSFRNKDARVVFDPAHVTVEQLIEAVGRAGFHASLKATEPAK* |
Ga0099828_116710831 | 3300009089 | Vadose Zone Soil | DVSFRDKEARVVYDPGQVTVEQMIAAVTGAGFRASVKQQGE* |
Ga0099828_117213041 | 3300009089 | Vadose Zone Soil | VQRAEVSFRDKEAKVTFDPARVSVDQLIQAVKDAGFRASLKGGG* |
Ga0099827_100679202 | 3300009090 | Vadose Zone Soil | VSFRDKQARVTFDPSRVSVEQLIDAVDRLGFHASLKAAEPAR* |
Ga0099827_103128872 | 3300009090 | Vadose Zone Soil | VSFRNRDARVVFDPAHVTVEQLIEAVGRAGFHASLKATEPAK* |
Ga0099827_103300552 | 3300009090 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIKAIDNLGFRASLKAGG* |
Ga0099827_110902053 | 3300009090 | Vadose Zone Soil | VGFRAKEARVTFDPAQVTVDQLIEAVKRAGFRASPKASAE* |
Ga0099827_111936141 | 3300009090 | Vadose Zone Soil | VSFREKEARVVYDPAQVSVEQMIETVNRAGFRAALKASGAK* |
Ga0099827_113925272 | 3300009090 | Vadose Zone Soil | FRDKEARVVFDPGQVTVEQMIAAVNGAGFRASVKRQGE* |
Ga0099827_114830802 | 3300009090 | Vadose Zone Soil | VSRVEVSFRDKEARVAFDPAQVTVEQLIDAVNRAGFRAALKAGGAN* |
Ga0099827_114884083 | 3300009090 | Vadose Zone Soil | VVRADVSFRDKEARVVYDSGQVTVEQMIAAVNGSGFRASVKREGE* |
Ga0066709_1004714461 | 3300009137 | Grasslands Soil | VGFRDKEARVTFDPARVTTDQLIQAVDKLGFHASLKAGG* |
Ga0066709_1005455753 | 3300009137 | Grasslands Soil | VSLKDKEARVTFDPAEVSLAQLAEAVNKIGFRAALKAGDAPK* |
Ga0066709_1019461911 | 3300009137 | Grasslands Soil | RALEALKGVSRAAVSFRDKEARVVFDPGLVTVEEMIAAVGRAGFRAALKRQGE* |
Ga0066709_1045763273 | 3300009137 | Grasslands Soil | VSFRDKEARVTFDPAQVSVDQLIEAVQRAGFRASQKASAE* |
Ga0099792_103897283 | 3300009143 | Vadose Zone Soil | VSFRDKEARITFDQAQVTVEQLIEAVNRAGFRAVLKARGTN* |
Ga0114129_103291734 | 3300009147 | Populus Rhizosphere | VSFKDKEARVTFDPAEVSIAQLAEAVNKIGFRAALKAGNVPK* |
Ga0114945_100071689 | 3300009444 | Thermal Springs | VSFRDKQARVTFDPARVIVEQLIDAVNRIGFRATLKRSREPNVR* |
Ga0114945_100694375 | 3300009444 | Thermal Springs | VRFRDQEARVAYDPAQVTVEQMIAAVNGAGFRASVKQRGE* |
Ga0114945_103297793 | 3300009444 | Thermal Springs | VTRADVSLRDKEARVVYDPGQVTLEQMIAAVDRAGFRASVKRQGG* |
Ga0114945_103910743 | 3300009444 | Thermal Springs | VSFRDKQARVTFDPARVSVEQLIDAVNRIGFRATLKRSTEPKVR* |
Ga0105164_100167389 | 3300009777 | Wastewater | VSFRDKEAVVVFDPARVTVEQMVEAVNRLGFKASPK* |
Ga0105082_11199841 | 3300009814 | Groundwater Sand | VSFRDKEARVVYDPGQVTVEQMIAAVNGAGFRASVKRQGE* |
Ga0105076_10234893 | 3300009816 | Groundwater Sand | VSFRDKEARVVYDPGQVTVEQMIAAVTGAGFRASVKRQGAE* |
Ga0105085_10822821 | 3300009820 | Groundwater Sand | SFRDKEARVAYDPARVTVEQLIAAVNGAGFRASVKRQGAE* |
Ga0105085_11009593 | 3300009820 | Groundwater Sand | VARADVSFRDKEARVVYDPGQVTVEQMIAAVTGAGFRASVKAAG* |
Ga0126380_112090583 | 3300010043 | Tropical Forest Soil | VSFRDEEARVTFDPTQVSVDQLIAAMTRAGFRASLKSSDAK* |
Ga0126384_100563244 | 3300010046 | Tropical Forest Soil | VSFREKQAVVTFDPARVTVEQLIEAVNRIGFKASLKAPAG* |
Ga0126384_123265993 | 3300010046 | Tropical Forest Soil | VSFRDKEARVTLDPARVTTDQLIKAIDKLGFRASLKAGG* |
Ga0126382_117933012 | 3300010047 | Tropical Forest Soil | VSFRDKEARVTFDPARVTTDQLIKAIDNLGFHASLKAGG* |
Ga0134088_104704503 | 3300010304 | Grasslands Soil | VSFRDKEARIAFDQAQVTVEQLIQAVNRAGFRAALKARGTN* |
Ga0134063_106323553 | 3300010335 | Grasslands Soil | VSFRDKEARVTFDPAQVTVEQLIEALNRAGFRAALKAGGAAN* |
Ga0134071_105358443 | 3300010336 | Grasslands Soil | VARADVSFRDKEARVVFDPGQVTVEQMIAAVNGAGFRASVKRQGE* |
Ga0134071_105815482 | 3300010336 | Grasslands Soil | VSFRDKEARITFDQAQVTVEQLIEAVNWAGFRAALKARGTN* |
Ga0134071_107040592 | 3300010336 | Grasslands Soil | VSFRDREARVTFDPAQVTVDQLIEAVNRAGFRAALKARGTN* |
Ga0134071_107989321 | 3300010336 | Grasslands Soil | VARADVSFRDKEARVVYDPGQVTVAQMIAAVNGAGFRASVKRQGE* |
Ga0126376_122156082 | 3300010359 | Tropical Forest Soil | VSFRDKEARVIFDPSHVTVEQMIEAVNRAGFRASLKR* |
Ga0136847_103610542 | 3300010391 | Freshwater Sediment | VQRADVSFRDKEARVTFDPARVTTDQLIQAIDKLGFRASLKGGG* |
Ga0136847_111944673 | 3300010391 | Freshwater Sediment | VSFRDKEARVTFDPARVSVEQLIEAVKKIGFRASLKRQAE* |
Ga0136847_118038342 | 3300010391 | Freshwater Sediment | VVRADVSFRDKAARVVYDPGQVTVEQMITAVNGAGFRASVKRQGE* |
Ga0136847_126271771 | 3300010391 | Freshwater Sediment | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRAAVKARG* |
Ga0136847_131802162 | 3300010391 | Freshwater Sediment | VSFRDKQARVTFDPGQVSVDQLIDAVDRLGFRASARTVEPMK* |
Ga0137716_102034261 | 3300010938 | Hot Spring Fe-Si Sediment | VSFRDRQATVTFEPGQVTVEQLIEAVNRIGFKASVKSPPG* |
Ga0137392_103808601 | 3300011269 | Vadose Zone Soil | VSFRDKEARVTFDPAHVITDQLIQAIDKLGFHASLKAGG* |
Ga0137392_104267121 | 3300011269 | Vadose Zone Soil | GVQRADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0137392_105261672 | 3300011269 | Vadose Zone Soil | VQRAEVSFRDKEARVTFDPARVTTDQLIQAIDKLGFRASLKAGG* |
Ga0137391_100398271 | 3300011270 | Vadose Zone Soil | VARADVSFRNKEARVVYDPGQVTVEQMIAAVNGAGFRASVRRQGE* |
Ga0137391_100656354 | 3300011270 | Vadose Zone Soil | VQRAEVNFRDKEARVIFDPARVSVDQLIRAVKDAGFRASLKGRS* |
Ga0137391_109425093 | 3300011270 | Vadose Zone Soil | VQRAEVSFRNKAAKVTFDPARVGVDQLIRAVKDAGFRASLKGGS |
Ga0137391_112082222 | 3300011270 | Vadose Zone Soil | SFRDKEARVVYDPGQVTVEQMIAAVNGAGFRASVRRQGE* |
Ga0137391_113814773 | 3300011270 | Vadose Zone Soil | VSFRDKEARVTFDPALVGVDQLIDAVKKVGFSASLKSS |
Ga0137393_102446783 | 3300011271 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKSGG* |
Ga0137393_105278653 | 3300011271 | Vadose Zone Soil | VARADVSFRDKAARVVFDPGQVTVEQMIAAVNGAGFRASVKRQGE* |
Ga0137393_114318733 | 3300011271 | Vadose Zone Soil | VSFRDKEARVTFDPARVGVDQLIQAVKDAGFRASLKGGS |
Ga0137393_116259881 | 3300011271 | Vadose Zone Soil | GLPGVQRADVSFRDKEARVTFDPGRVTTDQLIQAVDKLGFRATLKAGG* |
Ga0137389_100228582 | 3300012096 | Vadose Zone Soil | VSFRDKEARVTFDPARVGVDQLIQAVKDAGFRASLKGGS* |
Ga0137389_100327528 | 3300012096 | Vadose Zone Soil | VQRADVNFRDKEARVLFDPARVSVDQLIRAVKDAGFRASLKGRS* |
Ga0137389_100338761 | 3300012096 | Vadose Zone Soil | VSFREKEARVTFDPARVTTDQLIQAIDKLGFRASLKAGG* |
Ga0137389_104820033 | 3300012096 | Vadose Zone Soil | VSFRDKEARVTFDSAQVTVDQLVEAVTRAGFRASLKRGAE* |
Ga0137389_106298801 | 3300012096 | Vadose Zone Soil | VSFRDKEARVVYDAMQVTVEQMVTAVNGAGFRASVKRQGE* |
Ga0137389_111725953 | 3300012096 | Vadose Zone Soil | VARADVSFRDKEARVVYDPGQVTVEQMIAAVTGAGFRASVKQQGE* |
Ga0137388_101166991 | 3300012189 | Vadose Zone Soil | RADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0137388_102546133 | 3300012189 | Vadose Zone Soil | VQRADVSFRDKEVRVTFDPARVTTDQLIQAVDKLGFRASVKAGG* |
Ga0137388_106724001 | 3300012189 | Vadose Zone Soil | VSFRAKEARVTFDPAQVTVDQLVEAVKRAGFRASPKARPE* |
Ga0137388_113144523 | 3300012189 | Vadose Zone Soil | VSFRAKEARVTFDPALVTVDQLIEAVTRAGFRASPKHKE* |
Ga0137388_116243363 | 3300012189 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKA |
Ga0137363_102468265 | 3300012202 | Vadose Zone Soil | VSFRDKEARVTFDQAQVTVEQLIEAVNRAGFRATLKARGTN* |
Ga0137363_106326912 | 3300012202 | Vadose Zone Soil | MGVNRADVSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASLKGSPR* |
Ga0137363_109625272 | 3300012202 | Vadose Zone Soil | VQRAEVSFRDKEASVMFDPARVSVDQLIQAVKDAGFRASLKGRS* |
Ga0137363_115788021 | 3300012202 | Vadose Zone Soil | VQRAEVSFREKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0137374_1001307415 | 3300012204 | Vadose Zone Soil | VSFRDKEARVTFDSEHVTTDQLIRAVDKLGFRASLKAGG* |
Ga0137374_100522379 | 3300012204 | Vadose Zone Soil | NRADVSFRDKEARVTFDPALVGVGQLIDAVKKAGFLASLKSSPR* |
Ga0137374_100597293 | 3300012204 | Vadose Zone Soil | VQRADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0137374_101241297 | 3300012204 | Vadose Zone Soil | VSFRAKEARVTFDPAVVTVDQLIEAVTRAGFRASPKHKE* |
Ga0137362_100812251 | 3300012205 | Vadose Zone Soil | VSFRDKEARVVYDATQVTVEQMVTAVNGAGFRASVKRRGE* |
Ga0137362_105910343 | 3300012205 | Vadose Zone Soil | VSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASRKGSPR* |
Ga0137362_107620043 | 3300012205 | Vadose Zone Soil | VQRADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKNRG* |
Ga0137362_108373571 | 3300012205 | Vadose Zone Soil | MGVQRAEVSFRDKEARVTFDPARVSVAQLIQAVTDAGF |
Ga0137362_116799082 | 3300012205 | Vadose Zone Soil | SEVSFREKEARVTFDPAQVTVEHLIEAVNRAGFRAALKAGGAN* |
Ga0137381_101954242 | 3300012207 | Vadose Zone Soil | VQRADVSFRDKEARVTFDPARVTTDQLIKAIDNLGFRGSLKAGG* |
Ga0137381_108310272 | 3300012207 | Vadose Zone Soil | VQRADVSFRDKEARVTFDSARVTTDQLIRAVDKLGFRATLKAGG* |
Ga0137379_115418722 | 3300012209 | Vadose Zone Soil | RDKEARVTFDPARVTTDQLIQAVDKLGFRATLKAGG* |
Ga0137378_107625241 | 3300012210 | Vadose Zone Soil | VQRADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRATLKAGG* |
Ga0137377_100228831 | 3300012211 | Vadose Zone Soil | VSFRDKEARVVYDATQVTVEQMVTAVNGAGFHASVKRQGE* |
Ga0137387_105209233 | 3300012349 | Vadose Zone Soil | VDVSFRNKEVRVTFDPARVTPEQLIQAVDKLGFRAFLKAGG* |
Ga0137372_101584244 | 3300012350 | Vadose Zone Soil | VNRADASFRDKEARVTFDPALVGVDQLIAAVKKAGFSASLKGSPR* |
Ga0137386_106906813 | 3300012351 | Vadose Zone Soil | VQRAEVSFREKEARVTFDPARVTTDQLIQAVDKLGFHASLK |
Ga0137386_111004651 | 3300012351 | Vadose Zone Soil | VHRADVSFRDRQARVTFDPDQVTVEQLIGAINKAGFRAELKGGKGAEPSN* |
Ga0137386_112008371 | 3300012351 | Vadose Zone Soil | VSFRDREARVTFDATQVSVDQLIEAVKRAGFRASPKPRAE* |
Ga0137367_100746021 | 3300012353 | Vadose Zone Soil | VSFRDKEARVTFDSEHVTTDQLIQAVDKLGFRASLKAGG* |
Ga0137366_105546341 | 3300012354 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIKAIAKLGFRASLKAGG* |
Ga0137371_103211892 | 3300012356 | Vadose Zone Soil | VQRADVSFRDKEARVTFDPARVTTDQLIQAVDQLGFHASLKAGG* |
Ga0137384_114079001 | 3300012357 | Vadose Zone Soil | VSFRDKEARVTFDSARVTTDQLIRAVDKLGFRATLKAGG* |
Ga0137368_100532514 | 3300012358 | Vadose Zone Soil | VNRADASFRDKEARVTFDPALVGVDQLIAAVKKAGFSASLKSSPR* |
Ga0137385_109697203 | 3300012359 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFHASLKA |
Ga0137375_103572232 | 3300012360 | Vadose Zone Soil | VQRAEVSFGDKEARVAFDPAQVTVEQLVEAVKKIGFRASLKRQAE* |
Ga0137360_100335428 | 3300012361 | Vadose Zone Soil | VQRAEVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG* |
Ga0137360_101038501 | 3300012361 | Vadose Zone Soil | GLPGVQRADVSFRDKEARVTFDPARVSTDQLIQAVDKLGFRASLKAGG* |
Ga0137360_101560324 | 3300012361 | Vadose Zone Soil | VQRAEVSFRDKEVSVMFDPARVSVDQLIQAVKDAGFRASLKGRS* |
Ga0137360_104845611 | 3300012361 | Vadose Zone Soil | VSFRDKEARITFDQAQVTVEQLIEAVNRAGFRAALKARGTN* |
Ga0137361_104480743 | 3300012362 | Vadose Zone Soil | VQRADVSFRDKEARVTLDPARVTTDQLIQAVDKLGFHASLKAGG* |
Ga0137361_113566271 | 3300012362 | Vadose Zone Soil | VSFRDKEVSVMFDPARVSVDQLIQAVKDAGFRASLKGRS* |
Ga0137390_100123624 | 3300012363 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIKAIDKLGFRASLKAGG* |
Ga0137390_101999842 | 3300012363 | Vadose Zone Soil | VQRAEVSFRDKEARVTFDPARVGVDQLIQAVKDAGFRASLKGGS* |
Ga0137390_102586497 | 3300012363 | Vadose Zone Soil | VARADVSFRDKEARVVFDPGQVTVEQMIAAVNGAGFRASVKRQG* |
Ga0137390_103089353 | 3300012363 | Vadose Zone Soil | VQRAEVSFRDKEAKVTFDPARVSVDQLIQAVKSAGFRASVKAGG* |
Ga0137390_108058911 | 3300012363 | Vadose Zone Soil | RDREARVTFDPARVTTDQLIQAVDKLGFRATLKAGG* |
Ga0137390_117374692 | 3300012363 | Vadose Zone Soil | VTRADVSFRNKEARVVYDPGQVTVEQMIAAVNGAGFRASVKRQGE* |
Ga0137390_117941852 | 3300012363 | Vadose Zone Soil | FRDKEARVMFDPVRVTTDQLIQAVDKLGFHASLKAGG* |
Ga0137390_118715153 | 3300012363 | Vadose Zone Soil | VSFAAKEAVVVFDPARVTVEQMVEAVNRAGFKASPKG |
Ga0137373_102250292 | 3300012532 | Vadose Zone Soil | VSFRDKEARVTFEPAEVTVDQLIDAVNRSGFRASVKPAK* |
Ga0137397_108049243 | 3300012685 | Vadose Zone Soil | VSFRDKEARVTFDQAQVTVEQLIEAVNRAGFRAALKARGTN* |
Ga0137416_115997352 | 3300012927 | Vadose Zone Soil | VSFRDKEARVTFDPARVTIDQLIQVVDKLGFHASVKGGG* |
Ga0137404_103078872 | 3300012929 | Vadose Zone Soil | MQRADVSFRDKEARVTFDPARVASDQRIQAVDQLGFHASLKAGG* |
Ga0137404_105367385 | 3300012929 | Vadose Zone Soil | VSFRDKEARVTFDPAQVTVEQLIEAVNRAGFRAALKAGGAN* |
Ga0137404_110135551 | 3300012929 | Vadose Zone Soil | VQRADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKGGG* |
Ga0137404_112144593 | 3300012929 | Vadose Zone Soil | AEVSFRDKEARVTFDQAQVTVEQLIEAVNRAGFRATLKARGTN* |
Ga0137404_121153391 | 3300012929 | Vadose Zone Soil | KGVSRTEVSFRDREARVTFDPAQVTVDQLIEAVNRAGFRAALKSGSAN* |
Ga0137407_100421048 | 3300012930 | Vadose Zone Soil | ADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFHASLKAGG* |
Ga0137410_103085202 | 3300012944 | Vadose Zone Soil | VSFRDKEAQVTFDPARVTTDQLIQAVDKLGFHASLKAGG* |
Ga0164301_101994772 | 3300012960 | Soil | DKEARVTFDPARVGVEQLIQAVKGAGFRAFVKGGD* |
Ga0134077_104469511 | 3300012972 | Grasslands Soil | VARADVRFRDKEARVVFDPGQVTVEQMIAAVNGAGFRASVKRQGE* |
Ga0134076_102399742 | 3300012976 | Grasslands Soil | VSFRDKEARVTFDQAQVTVEQLIEAVNRAGFGAAFKAGGTN* |
Ga0075301_10705613 | 3300014262 | Natural And Restored Wetlands | VSRAEVSFRDKEARVTFDPARVSVAQLVEAVGKLGFSAAVKR |
Ga0137409_103122034 | 3300015245 | Vadose Zone Soil | VQRADVSFRDKEARVTFDPARVTTDQLIQAVDKLGFHASLKAGG* |
Ga0134089_100937994 | 3300015358 | Grasslands Soil | VSFRDKEARVTFDPAQVTVEQLIEALNRAGFRAALKAGDAN* |
Ga0182037_112399941 | 3300016404 | Soil | VSFRDKEARVAYDPARVTVEQMVAAVNEAGFRASVKR |
Ga0134112_101652074 | 3300017656 | Grasslands Soil | MGVNRADVSFRDKEARVTFDPALVGVDQLIDAVKKAGFSAS |
Ga0134083_100930023 | 3300017659 | Grasslands Soil | VSRADVSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASRKGSPR |
Ga0134083_100981823 | 3300017659 | Grasslands Soil | VSFRDKEARVTFDPAQVTVEQLIEALNRAGFRAALKAGDAN |
Ga0134083_105823713 | 3300017659 | Grasslands Soil | VSFRDKEARVTFDQAQVTVEQLIEAVNRAGFRAALKAGSAN |
Ga0184610_10274463 | 3300017997 | Groundwater Sediment | VSFRDKEARVSFEPTQVSVDQLIEAVNRSGFRASRKGRD |
Ga0184610_11960482 | 3300017997 | Groundwater Sediment | VARADVSFRDKEARVVYDPTQVTVEQMIAAVNGAGFRASVKRQGE |
Ga0184634_101784692 | 3300018031 | Groundwater Sediment | VSFRDKEARVVFDPGQVTVEEMIAAVSRAGFRAALKRQGE |
Ga0184623_100021741 | 3300018056 | Groundwater Sediment | VSFRDKEARVVYDPGQVTVEQMIAAVNGAGFRASVKRQG |
Ga0184623_103841781 | 3300018056 | Groundwater Sediment | RAMEGLSGVSLTDVSFRDKEARVVFDPSHVTVEQMVEAVNRAGFRAALKP |
Ga0184637_101326381 | 3300018063 | Groundwater Sediment | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRAAVKAGG |
Ga0184637_102816333 | 3300018063 | Groundwater Sediment | VQRADVSFRDKEARVTFDPARVTTVQLIQAIDKLGFRAAVKAGG |
Ga0184640_104980003 | 3300018074 | Groundwater Sediment | VSFRDKEARVTFDPARVTTDQLIQAIDKLGFRASLKGGG |
Ga0184627_101421553 | 3300018079 | Groundwater Sediment | VSFRQKQARVTFDGERVSVEQMIDAVNRLGFHASLKATVPNR |
Ga0184639_100986932 | 3300018082 | Groundwater Sediment | VQRADVSLRDKEARVTFDPERVSVDQLIQAVNGIGFRASLKRGG |
Ga0066655_106715823 | 3300018431 | Grasslands Soil | VSFRDKEARVTFDPTQVTVEQLIEAVNKAGFRAALKAGGAAN |
Ga0066655_114324123 | 3300018431 | Grasslands Soil | MGVNRADVSFRDKEARVTFDPALVGVDQLIDAVKKAGF |
Ga0066662_105585974 | 3300018468 | Grasslands Soil | VSFRDKEARVTFDPALVAVDQLIDAVKKAGFSASLKGSPR |
Ga0066662_106448911 | 3300018468 | Grasslands Soil | VSFRNKEARLTFDPARVTPEQLIQAVDKVGFRAFLKAGG |
Ga0066662_112630193 | 3300018468 | Grasslands Soil | VSFRDKEARVVYDATQVTVEQMVTAVSGAGFRASVKRRGE |
Ga0066662_117764461 | 3300018468 | Grasslands Soil | VAVKRALEGLPGVQRADVSFRDKEQRLTFDPARVTTNALIQAIDKLRFRASLKGGG |
Ga0187894_100266078 | 3300019360 | Microbial Mat On Rocks | VSRADVSFRDKEARVTFDPIQVTIDQLIESVRRAGFRAAPKNAE |
Ga0187892_10000155141 | 3300019458 | Bio-Ooze | VSRAEVSFREKEARVTFDAAQVSVDQLVETVGRLGFRATVKRSAE |
Ga0187892_1000372620 | 3300019458 | Bio-Ooze | VSRAEVSFRDKEARVTFDPARVTVAQLTEAVTRVGFRASLKRRLD |
Ga0187892_100055507 | 3300019458 | Bio-Ooze | VARADVSFRDKEARVAYDAAQVTIEQMIAAVNGAGFRASVKRQGE |
Ga0187892_102795571 | 3300019458 | Bio-Ooze | VSRANVSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASLKGTPR |
Ga0137408_11102291 | 3300019789 | Vadose Zone Soil | GLMGVNRADVSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASRKGSPR |
Ga0137408_12318923 | 3300019789 | Vadose Zone Soil | MGVNRADVSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASRKGSPR |
Ga0137408_12938933 | 3300019789 | Vadose Zone Soil | VSFRDKEARVTFDQAQVTVEQLIEAVNRAGFRAALKARGTN |
Ga0179596_104233871 | 3300021086 | Vadose Zone Soil | MGVQRAEVSFRDKEASVMFDPARVSVDQLIQAVKNAGFRASLKGRS |
Ga0213917_10187052 | 3300021437 | Freshwater | VSFRDKEARVTFDPAQVGVEQLIGAVKKIGFRASLKRQGE |
Ga0126371_102132981 | 3300021560 | Tropical Forest Soil | VSFRDKEARVTFEPTQVGVDQLIAAVTRAGFRAFVKAPNAK |
Ga0212128_100104381 | 3300022563 | Thermal Springs | QARVTFDPARVSVEQLIDAVNRIGFRATLKRSREPNVR |
Ga0212128_101125706 | 3300022563 | Thermal Springs | VARADVRFRDQEARVAYDPAQVTVEQMIAAVNGAGFRASVKQRGE |
Ga0212128_103875443 | 3300022563 | Thermal Springs | QARVTFDPARVSVEQLIDAVNRIGFRATLKRSTEPKVR |
Ga0212128_103943584 | 3300022563 | Thermal Springs | VSRADVSFRDKQARVTFDPARVSVEQLIDAVNRIGFRATLKRS |
Ga0212128_107687003 | 3300022563 | Thermal Springs | VSFREEQAVVTFDPAQVGVEQLIEAVNRIGFRASLKPRAGS |
Ga0209001_10428723 | 3300025002 | Soil | VQKADVSFRDKQARVTFDPDRVGVEQMIDAVSRIGFRASLKAAEPTR |
Ga0209320_100032237 | 3300025155 | Soil | VQKADVSFRDKQARVTFDPDRVGVEQMIDAVNRIGFRASLKATEPAR |
Ga0209399_100073235 | 3300025157 | Thermal Springs | VSFRDKQARVTFDPARVSVEQLIDAVNRIGFRATLKRSREPNVR |
Ga0209619_100273454 | 3300025159 | Soil | VQKADVSFRDKQARVTFDPDRVGVEQMIDAVSRIGFRTSLKAAEPTR |
Ga0209109_100141451 | 3300025160 | Soil | VSFRYKQARVTFDPGQVSVDQLIDAVNRLGFRASARTVEPMK |
Ga0209824_100078267 | 3300025173 | Wastewater | VSFRDKEAVVVFDPARVTVEQMVEAVNRLGFKASPK |
Ga0209002_103440992 | 3300025289 | Soil | VQRAEVSFRYKQARVTFDPSQVSVGQLIDAVNRLGFRASARTVEPMK |
Ga0209343_105052452 | 3300025311 | Groundwater | MRADVSFRDKEARVVYDPAQVTVEQLIAAVNGAGFRASIKRQGE |
Ga0209321_100117234 | 3300025312 | Soil | VQKADVSFRDKQARVTFDPDRVGVEQMIDAVSRIGFRASLKATEPAR |
Ga0209519_102320101 | 3300025318 | Soil | GVQKADVSFRDKQARVTFDPDRVGVEQMIDAVNRIGFRASLKATEPAR |
Ga0209640_102321063 | 3300025324 | Soil | VQKADVSFRDKHARVTFDPERVSVEQMIDAVNRIGFRASLKAAEPNR |
Ga0207653_101639652 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVSFRDKEARVTFDPAQVGVDQLIQAVKDAGFRASLKGGG |
Ga0207685_100205656 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVNFRDKEARVIFDPARVSVDQLIRAVNDAGFRASLKGRS |
Ga0207684_1000154527 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCLGPGGLKGVHRAEVSFRNTEAWVTFDPAPVNVDQLIQAVDKLGFRASLKRGG |
Ga0207684_100507996 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVSFRDKQARVTFDRDQVSVEQLIDAVNRLGFRASLKAAEPAK |
Ga0207684_101496292 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRADVSFRDKEARVTLDPTRVTTDQLIEAVDKLGFRASLKAGR |
Ga0207684_116720382 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVSFRDKEAKVTFDPARVSVDQLIQAVKGAGFHASVKAGV |
Ga0207646_100376405 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRAEVSFRDKQARVTFDRDQVSVEQLIDAVNRLGFRASLKAAEPAR |
Ga0207646_100485235 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSNCLGPGGLKGVHRAEVSFRNTEAWVTFDPAPVNVDQLIQAVDKLGFRASLKRVG |
Ga0207646_103243223 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFRDKEARVTFDPARVGVDQLIQAVKDAGFRASLKGGG |
Ga0207646_104902802 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRADVTFRDKEARVTFDPARVTTDQIIQAIDKLGFRASVKAGG |
Ga0207646_105414591 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VSFRDKEARVTFDPARVTTDQLIQAVGKLGFRASLKAGG |
Ga0210102_10991591 | 3300025971 | Natural And Restored Wetlands | VQKADVSFRGKEARVAFDPGQVAVEQLIDAVNRLGFRA |
Ga0209055_11236603 | 3300026309 | Soil | VQRADVSFRDKEVRVTFDPARVTSDQLIQAVDQLGFHASLKAGG |
Ga0209761_13164051 | 3300026313 | Grasslands Soil | VHRADVSFRDRQARVTFDPDQVTVEQLIGAINKAGFRAELKGGKGAEPS |
Ga0209131_10884986 | 3300026320 | Grasslands Soil | VQRAEVSFRDKEARVIFDPARMSVDELIRAVKDAGFRATLK |
Ga0209158_10682404 | 3300026333 | Soil | VSFRDKEARVTFDQAQVTVEQLIVAVNRAGFQAALKAR |
Ga0209377_13380091 | 3300026334 | Soil | VARADVSFRDKEARVVYEPGQVTVAQMIAAVNGAGFRASVKRQGE |
Ga0257179_10276533 | 3300026371 | Soil | VSFRDKAAKVTFDPARVSVDQLIQAVKDAGFRASLKAGG |
Ga0257168_10693103 | 3300026514 | Soil | VQRAEVSFRYKAAKVTFDPAEIRVDQLIQALKDAGFRASLKDGG |
Ga0256867_101009783 | 3300026535 | Soil | VHKADVSFREKEARVTFDPGRIAVEQLIDAVTRLGFRASWKATR |
Ga0209056_103249322 | 3300026538 | Soil | VQRADVSFRDKEARVTFDPARVTTDQLIQAVEKLGFRASLKAGG |
Ga0209648_101756276 | 3300026551 | Grasslands Soil | VQRAEVSFRYKAAKVTFDPAQIRVDQLIQALKDAGFRASLKDGG |
Ga0209648_106801992 | 3300026551 | Grasslands Soil | RDKEAKVTFDPARVSVDQLIQAVKSAGFRASVKAAG |
Ga0209217_10376812 | 3300027651 | Forest Soil | REKEARVIFDPVRVDVDQLIRAVKDAGFRASVKGGR |
Ga0209515_100623157 | 3300027835 | Groundwater | VSFRDKEAVVVFDPAQVSVEQMVEAVNRLGFKASLK |
Ga0209180_100307913 | 3300027846 | Vadose Zone Soil | VQRAEVSFRDKEARVTFDPARVGVDQLIQAVKDAGFRASLKGGG |
Ga0209180_100848412 | 3300027846 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGR |
Ga0209180_100955493 | 3300027846 | Vadose Zone Soil | VSRADVSFRDKEARVTFDPALVGVDQLIDAVKKVGFSASLKSSPR |
Ga0209180_101387612 | 3300027846 | Vadose Zone Soil | VSFRDKAAKVTFDPARVGIDQLIQAVKDAGFRASLKGGS |
Ga0209180_101638871 | 3300027846 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRASLKAGG |
Ga0209180_103565504 | 3300027846 | Vadose Zone Soil | VQRADVSFRNKEARVTFDPTRATTDQLIQAVDKLGFRA |
Ga0209180_104233851 | 3300027846 | Vadose Zone Soil | VSFRDKEARVVYDPGQVTVEQMIAAVNGAGFRASVRRQGE |
Ga0209180_104495363 | 3300027846 | Vadose Zone Soil | VSFRDKEARVIFDPARVTTDQLIQAVDKLGFRASLKGGG |
Ga0209180_105261131 | 3300027846 | Vadose Zone Soil | RALEGLKGVIRADVSFRAKEARVIFDPAQVSEEALVVAVNRLGFRASVKRNEAVE |
Ga0209180_106267103 | 3300027846 | Vadose Zone Soil | VQRAEVSFRDKQARVTFDPYQVSVEQLIDAVNRLGFRASLKVAEPVR |
Ga0209701_101394761 | 3300027862 | Vadose Zone Soil | VSFRDKAAKVTFDPARVSVDQLIQAVKDAGFRASLKGGG |
Ga0209701_102266183 | 3300027862 | Vadose Zone Soil | VSFRDKQARVTFDRDQVSVEQLIDAVNRLGFRASLKVAEPAR |
Ga0209701_105444833 | 3300027862 | Vadose Zone Soil | VSFRKKEARVTFDPAQVTVEQLIEAVNRAGFRAALKAGGAT |
Ga0209283_105697913 | 3300027875 | Vadose Zone Soil | VQRAEVSFRDKEARVTFDPARVGVDQLIQAVKDAGFRASLKAGG |
Ga0209283_109751473 | 3300027875 | Vadose Zone Soil | VSRADVSFRDKEARVTFDPALVGVDQLIDAVKKAGFSASLKGSPR |
Ga0209283_109933972 | 3300027875 | Vadose Zone Soil | VARADVSFRNKEARVSFDPARVTVEQMIEAVGRAGFHASLKATKPTK |
Ga0209590_102640822 | 3300027882 | Vadose Zone Soil | VSFRNKEARVTFDPARVTPEQLIQAVDKLGFRAFLKAGG |
Ga0209590_102682645 | 3300027882 | Vadose Zone Soil | VSFRDKQARVTFDPSRVSVEQLIDAVDRLGFHASLKAAEPAR |
Ga0209590_107008003 | 3300027882 | Vadose Zone Soil | VSFRDKEARVTFDPARVTTDQLIQAIDKLGFRASLKAGG |
Ga0209590_108931031 | 3300027882 | Vadose Zone Soil | VSRADVSFREKEARVVYDPAQVSVEQMIETVNRAGFRAALKASGAK |
Ga0209590_110628482 | 3300027882 | Vadose Zone Soil | VSFRNKEARVTFDPAQVTVEQLIEAVNRAGFRAALKAGGAT |
Ga0209488_100912233 | 3300027903 | Vadose Zone Soil | VQRAEVNFRDKEARVIFDPARVSVDQLIRAVKDAGFRASLKGRS |
Ga0209889_10498293 | 3300027952 | Groundwater Sand | VSFRDKEARVVYDPGQVTVEQMIAAVTGAGFRASVKAAG |
Ga0209857_10214893 | 3300027957 | Groundwater Sand | VSFRAKEARVTFDPAVVTVDQLIEAVTRAGFRASPKHKE |
Ga0209526_100382903 | 3300028047 | Forest Soil | VSFRDKEARATFDPARVTTDQLIQAIDKLGFRASLKAGG |
Ga0137415_109821291 | 3300028536 | Vadose Zone Soil | SFRDKEARVTFESTVVSVNQLIEAVNRGGFRAAMKREH |
Ga0299906_110584152 | 3300030606 | Soil | VQKADVSFRDKQARVTFDPDRVSVEQMIDAVNRIGFRASLKAAEPTR |
Ga0302046_101300842 | 3300030620 | Soil | VSRAEVSFRDKEARVAFDPAQVRVEQLIEAVNRLGFRASLKRPAE |
Ga0299913_107634153 | 3300031229 | Soil | VHKADVSFREKEARVTFDPGRIAVEQLIDAVNRLGFRASWKATR |
Ga0299913_117015972 | 3300031229 | Soil | VSFRKKEAVVVFDPTQVSVEGMVEAVNRLGFRASLKRAAESVPVVPRP |
(restricted) Ga0255312_11939061 | 3300031248 | Sandy Soil | LEGLPGVQKADVSFREKEARVAFDPGQVAVEQLIDAVNRFGFRASLKAAK |
Ga0318528_100037698 | 3300031561 | Soil | VSFRDKEARVIFDPSHVTVEQMIEAVNRAGFRASLKR |
Ga0318528_102650882 | 3300031561 | Soil | VSFRDREARVTFDATKVGVDQLIAAVTRAGFRASVKPAGVK |
Ga0315290_100363717 | 3300031834 | Sediment | VSFRDKEARVTFDPAQVNADQLIEAVKRAGFRASPKASTE |
Ga0214473_100134683 | 3300031949 | Soil | VQKADVSFGDKRARVTYDPDRVGMERMIEAVNRIGFRASLKAAEPTR |
Ga0214473_116444811 | 3300031949 | Soil | VQKADVSFRDKQARVTFDPDRVGVEQMIEAVNRIGFRASLKAAEPTR |
Ga0318507_102879921 | 3300032025 | Soil | DRADVSFRDKEARVIFDPSHVTVEQMVEAVNRAGFRASLKR |
Ga0315281_102251772 | 3300032163 | Sediment | VQKADVSFRDKEARVTFDPDRVGVEQMIDAVNRIGFRASLKAAEPTR |
Ga0307470_106032833 | 3300032174 | Hardwood Forest Soil | VSFRDKEARVTFDRARVGVEQLIQAVKGAGFRASVKGGD |
Ga0307471_1017191602 | 3300032180 | Hardwood Forest Soil | VSFRDKEARITFDMSQVTVDQLIEAVKHAGFSASVKGSSR |
Ga0307471_1039318812 | 3300032180 | Hardwood Forest Soil | VSFRDKEARVTFDSAQVTVDQLVETVTRAGFRASLKRGAE |
Ga0334722_102988342 | 3300033233 | Sediment | VSRADVSFKDKQARVTFDPSQVSIAQLAEAVNKIGFRAALKTGDAPK |
Ga0214471_100055123 | 3300033417 | Soil | MGVQRSEVSFRDKEARVTFESTVVSVNQLIEAVNRGGFRAVMKRQQ |
Ga0214471_102492072 | 3300033417 | Soil | VQKADVSFRDKQARVTFDPDRVSVEQMIDAVNRIGFRASLKTAEPTR |
Ga0214471_105059893 | 3300033417 | Soil | VSRAEVSFREKEARVTFDPAQVSVVQLVEAVGRLGFRASEKRRAE |
Ga0364942_0018683_1373_1501 | 3300034165 | Sediment | VSFRYKQAQVTFDPGQVSVDQLIDAVNRLGFRASARTVEPMK |
Ga0364932_0389670_284_403 | 3300034177 | Sediment | VSFRDKEARVTFDPARVTTDQLIQAVDKLGFRAAVKAGA |
Ga0364934_0006379_3111_3230 | 3300034178 | Sediment | VSFRDKEARVTFEPTEVTLEQIIGAVNRSGFRASVKRPD |
⦗Top⦘ |