Basic Information | |
---|---|
Family ID | F006789 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 364 |
Average Sequence Length | 39 residues |
Representative Sequence | MALTDEDKAFLIKIGQELPVEVKETKPKETPTEKDEA |
Number of Associated Samples | 213 |
Number of Associated Scaffolds | 364 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 85.71 % |
% of genes near scaffold ends (potentially truncated) | 16.48 % |
% of genes from short scaffolds (< 2000 bps) | 80.77 % |
Associated GOLD sequencing projects | 194 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (86.813 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.527 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.418 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.187 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.23% β-sheet: 0.00% Coil/Unstructured: 70.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 364 Family Scaffolds |
---|---|---|
PF04586 | Peptidase_S78 | 3.57 |
PF05065 | Phage_capsid | 1.92 |
PF03354 | TerL_ATPase | 1.65 |
PF04860 | Phage_portal | 1.65 |
PF13539 | Peptidase_M15_4 | 1.37 |
PF00145 | DNA_methylase | 0.27 |
PF03237 | Terminase_6N | 0.27 |
PF12728 | HTH_17 | 0.27 |
PF05869 | Dam | 0.27 |
COG ID | Name | Functional Category | % Frequency in 364 Family Scaffolds |
---|---|---|---|
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 3.57 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.92 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 1.65 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.27 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.86 % |
Unclassified | root | N/A | 7.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352003|2199768618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300000756|JGI12421J11937_10000483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15440 | Open in IMG/M |
3300000756|JGI12421J11937_10150808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300002141|M3t6BS1_1463038 | Not Available | 517 | Open in IMG/M |
3300002198|metazooDRAFT_1246044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1331 | Open in IMG/M |
3300002408|B570J29032_109041217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300002408|B570J29032_109371536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300002465|LO132_10045839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1781 | Open in IMG/M |
3300002835|B570J40625_100582590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
3300002835|B570J40625_100589264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
3300003277|JGI25908J49247_10050548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1089 | Open in IMG/M |
3300003388|JGI25910J50241_10170868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300003499|JGI25930J51415_1008176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2160 | Open in IMG/M |
3300003684|Ga0005851_1027540 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1054 | Open in IMG/M |
3300004282|Ga0066599_101313556 | Not Available | 546 | Open in IMG/M |
3300004797|Ga0007764_11725099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300005517|Ga0070374_10006132 | All Organisms → cellular organisms → Bacteria | 5664 | Open in IMG/M |
3300005517|Ga0070374_10016858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3676 | Open in IMG/M |
3300005517|Ga0070374_10020324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3377 | Open in IMG/M |
3300005517|Ga0070374_10064534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1908 | Open in IMG/M |
3300005517|Ga0070374_10113300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1412 | Open in IMG/M |
3300005517|Ga0070374_10479678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300005517|Ga0070374_10648730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300005580|Ga0049083_10085573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1098 | Open in IMG/M |
3300005580|Ga0049083_10165528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 757 | Open in IMG/M |
3300005580|Ga0049083_10193150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300005581|Ga0049081_10002271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7250 | Open in IMG/M |
3300005581|Ga0049081_10011419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3358 | Open in IMG/M |
3300005581|Ga0049081_10019109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2601 | Open in IMG/M |
3300005581|Ga0049081_10057687 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
3300005581|Ga0049081_10079224 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
3300005581|Ga0049081_10162184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300005581|Ga0049081_10207599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300005581|Ga0049081_10256348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300005583|Ga0049085_10001182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10317 | Open in IMG/M |
3300005583|Ga0049085_10043821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1626 | Open in IMG/M |
3300005583|Ga0049085_10058229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
3300005583|Ga0049085_10126981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300005583|Ga0049085_10135279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300005583|Ga0049085_10158266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300005583|Ga0049085_10260411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300005583|Ga0049085_10262792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300005584|Ga0049082_10019651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2334 | Open in IMG/M |
3300005584|Ga0049082_10037269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1704 | Open in IMG/M |
3300005585|Ga0049084_10136954 | Not Available | 860 | Open in IMG/M |
3300005662|Ga0078894_11025393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300005940|Ga0073913_10011706 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
3300006030|Ga0075470_10248707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300006037|Ga0075465_10132711 | Not Available | 563 | Open in IMG/M |
3300006037|Ga0075465_10153650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300006484|Ga0070744_10033044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
3300006484|Ga0070744_10058928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
3300006484|Ga0070744_10089974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
3300006484|Ga0070744_10126558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300006484|Ga0070744_10147328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300006484|Ga0070744_10151752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300006484|Ga0070744_10154582 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300006637|Ga0075461_10010328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3086 | Open in IMG/M |
3300006637|Ga0075461_10067828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
3300006802|Ga0070749_10006956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7399 | Open in IMG/M |
3300006802|Ga0070749_10588188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300006803|Ga0075467_10684954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300006805|Ga0075464_10001634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10137 | Open in IMG/M |
3300006805|Ga0075464_10390555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
3300006805|Ga0075464_10395558 | Not Available | 839 | Open in IMG/M |
3300006805|Ga0075464_10545679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300006805|Ga0075464_10824367 | Not Available | 577 | Open in IMG/M |
3300006875|Ga0075473_10065198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
3300006920|Ga0070748_1143811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300006920|Ga0070748_1190174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300006920|Ga0070748_1372371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300007538|Ga0099851_1051771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1611 | Open in IMG/M |
3300007538|Ga0099851_1320279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300007540|Ga0099847_1062587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1159 | Open in IMG/M |
3300007541|Ga0099848_1257470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300007555|Ga0102817_1095627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300007559|Ga0102828_1005186 | All Organisms → Viruses → Predicted Viral | 2531 | Open in IMG/M |
3300007559|Ga0102828_1068365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300007559|Ga0102828_1094025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300007559|Ga0102828_1161629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300007559|Ga0102828_1199784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300007636|Ga0102856_1060795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300007708|Ga0102859_1225432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300007708|Ga0102859_1244537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300007734|Ga0104986_1441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15053 | Open in IMG/M |
3300007734|Ga0104986_1485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15755 | Open in IMG/M |
3300007734|Ga0104986_1627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20213 | Open in IMG/M |
3300007735|Ga0104988_10447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15393 | Open in IMG/M |
3300007860|Ga0105735_1110505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300007861|Ga0105736_1127596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300007960|Ga0099850_1034820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2186 | Open in IMG/M |
3300007973|Ga0105746_1252747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300008055|Ga0108970_11183547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
3300008114|Ga0114347_1090855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1202 | Open in IMG/M |
3300008117|Ga0114351_1014291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9896 | Open in IMG/M |
3300008266|Ga0114363_1050833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1650 | Open in IMG/M |
3300008267|Ga0114364_1170183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300009026|Ga0102829_1048106 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
3300009026|Ga0102829_1164600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300009039|Ga0105152_10076174 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
3300009039|Ga0105152_10464758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300009039|Ga0105152_10475768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300009059|Ga0102830_1050915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
3300009080|Ga0102815_10255252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 967 | Open in IMG/M |
3300009149|Ga0114918_10298454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300009149|Ga0114918_10363821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300009149|Ga0114918_10464085 | Not Available | 682 | Open in IMG/M |
3300009152|Ga0114980_10002439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13088 | Open in IMG/M |
3300009152|Ga0114980_10106524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1675 | Open in IMG/M |
3300009152|Ga0114980_10354302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
3300009155|Ga0114968_10146949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1402 | Open in IMG/M |
3300009155|Ga0114968_10202277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
3300009155|Ga0114968_10283348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300009155|Ga0114968_10375657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300009158|Ga0114977_10122309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1567 | Open in IMG/M |
3300009161|Ga0114966_10168825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1410 | Open in IMG/M |
3300009163|Ga0114970_10024746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4038 | Open in IMG/M |
3300009164|Ga0114975_10501831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300009180|Ga0114979_10023223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3955 | Open in IMG/M |
3300009180|Ga0114979_10468761 | Not Available | 730 | Open in IMG/M |
3300009181|Ga0114969_10004672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10819 | Open in IMG/M |
3300009181|Ga0114969_10157355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1423 | Open in IMG/M |
3300009181|Ga0114969_10532042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300009181|Ga0114969_10613447 | Not Available | 595 | Open in IMG/M |
3300009183|Ga0114974_10174954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1327 | Open in IMG/M |
3300009183|Ga0114974_10213274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1173 | Open in IMG/M |
3300009185|Ga0114971_10573039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300010316|Ga0136655_1056746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1216 | Open in IMG/M |
3300010354|Ga0129333_10713337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300010368|Ga0129324_10183383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300010370|Ga0129336_10456054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300010885|Ga0133913_10205702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5244 | Open in IMG/M |
3300010885|Ga0133913_11373027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1799 | Open in IMG/M |
3300010885|Ga0133913_11404775 | All Organisms → Viruses → Predicted Viral | 1775 | Open in IMG/M |
3300011009|Ga0129318_10236744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300011114|Ga0151515_11065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10320 | Open in IMG/M |
3300011115|Ga0151514_11088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10452 | Open in IMG/M |
3300011268|Ga0151620_1001078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10551 | Open in IMG/M |
3300011335|Ga0153698_1657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13617 | Open in IMG/M |
3300011335|Ga0153698_1886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10762 | Open in IMG/M |
3300011337|Ga0153702_1507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13268 | Open in IMG/M |
3300011381|Ga0102688_1684419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300011995|Ga0153800_1005208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1224 | Open in IMG/M |
3300012012|Ga0153799_1090738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300012013|Ga0153805_1021502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1099 | Open in IMG/M |
3300012666|Ga0157498_1046915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300012702|Ga0157596_1110050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300012732|Ga0157549_1177757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300012970|Ga0129338_1004731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
3300012970|Ga0129338_1385397 | Not Available | 649 | Open in IMG/M |
3300013005|Ga0164292_10180939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1516 | Open in IMG/M |
3300013092|Ga0163199_1088751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10299571 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10911615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10758097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300013372|Ga0177922_10027463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300013372|Ga0177922_10487573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1283 | Open in IMG/M |
3300013372|Ga0177922_10664127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300014811|Ga0119960_1080133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300017697|Ga0180120_10216204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300017701|Ga0181364_1061327 | Not Available | 581 | Open in IMG/M |
3300017716|Ga0181350_1061288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
3300017716|Ga0181350_1077485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
3300017722|Ga0181347_1138308 | Not Available | 671 | Open in IMG/M |
3300017723|Ga0181362_1104052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300017723|Ga0181362_1115788 | Not Available | 527 | Open in IMG/M |
3300017723|Ga0181362_1123456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300017736|Ga0181365_1044804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
3300017736|Ga0181365_1048272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
3300017736|Ga0181365_1055252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300017736|Ga0181365_1155523 | Not Available | 540 | Open in IMG/M |
3300017747|Ga0181352_1188093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300017761|Ga0181356_1111972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300017761|Ga0181356_1117789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300017774|Ga0181358_1009837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3945 | Open in IMG/M |
3300017774|Ga0181358_1076575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1228 | Open in IMG/M |
3300017774|Ga0181358_1117592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300017774|Ga0181358_1140076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
3300017777|Ga0181357_1191978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300017777|Ga0181357_1250713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300017777|Ga0181357_1339000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300017778|Ga0181349_1142045 | Not Available | 869 | Open in IMG/M |
3300017778|Ga0181349_1305414 | Not Available | 515 | Open in IMG/M |
3300017778|Ga0181349_1306917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300017780|Ga0181346_1133908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300017780|Ga0181346_1148724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300017780|Ga0181346_1211063 | Not Available | 695 | Open in IMG/M |
3300017780|Ga0181346_1333649 | Not Available | 506 | Open in IMG/M |
3300017784|Ga0181348_1287121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300017784|Ga0181348_1289151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300017785|Ga0181355_1011591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3879 | Open in IMG/M |
3300017785|Ga0181355_1065826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1526 | Open in IMG/M |
3300017788|Ga0169931_10758474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300018416|Ga0181553_10511090 | Not Available | 641 | Open in IMG/M |
3300018420|Ga0181563_10034459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3741 | Open in IMG/M |
3300018420|Ga0181563_10808198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300019784|Ga0181359_1005901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4043 | Open in IMG/M |
3300019784|Ga0181359_1008881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3490 | Open in IMG/M |
3300019784|Ga0181359_1013059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3018 | Open in IMG/M |
3300019784|Ga0181359_1014468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2899 | Open in IMG/M |
3300019784|Ga0181359_1015615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2810 | Open in IMG/M |
3300019784|Ga0181359_1032916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2004 | Open in IMG/M |
3300019784|Ga0181359_1048619 | All Organisms → Viruses → Predicted Viral | 1637 | Open in IMG/M |
3300019784|Ga0181359_1051732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1583 | Open in IMG/M |
3300019784|Ga0181359_1066087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1376 | Open in IMG/M |
3300019784|Ga0181359_1102246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
3300019784|Ga0181359_1107904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
3300019784|Ga0181359_1174769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300019784|Ga0181359_1186002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300019784|Ga0181359_1219675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300019784|Ga0181359_1231072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300020074|Ga0194113_10582954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300020083|Ga0194111_10761705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300020084|Ga0194110_10609753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300020084|Ga0194110_10637396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300020141|Ga0211732_1031911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300020151|Ga0211736_10648591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2626 | Open in IMG/M |
3300020157|Ga0194049_1045434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1144 | Open in IMG/M |
3300020159|Ga0211734_10226407 | All Organisms → Viruses → Predicted Viral | 2544 | Open in IMG/M |
3300020161|Ga0211726_10858004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1744 | Open in IMG/M |
3300020162|Ga0211735_11421808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300020179|Ga0194134_10130403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
3300020204|Ga0194116_10191136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1179 | Open in IMG/M |
3300020204|Ga0194116_10353300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300020205|Ga0211731_10247222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2283 | Open in IMG/M |
3300020205|Ga0211731_10623498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300020205|Ga0211731_11619116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3755 | Open in IMG/M |
3300020205|Ga0211731_11660148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1217 | Open in IMG/M |
3300020505|Ga0208088_1009300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1388 | Open in IMG/M |
3300020506|Ga0208091_1016508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300020549|Ga0207942_1046653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300020556|Ga0208486_1012746 | All Organisms → Viruses → Predicted Viral | 1319 | Open in IMG/M |
3300020569|Ga0208229_1004139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3277 | Open in IMG/M |
3300021075|Ga0194063_10042162 | All Organisms → Viruses → Predicted Viral | 2210 | Open in IMG/M |
3300021140|Ga0214168_1001684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8751 | Open in IMG/M |
3300021424|Ga0194117_10377482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300021602|Ga0194060_10175772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
3300021959|Ga0222716_10235281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
3300021960|Ga0222715_10255481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
3300021961|Ga0222714_10107427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1751 | Open in IMG/M |
3300021961|Ga0222714_10279883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
3300021961|Ga0222714_10332329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300021961|Ga0222714_10389714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300021961|Ga0222714_10440718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300021962|Ga0222713_10286817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
3300021962|Ga0222713_10433912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300021962|Ga0222713_10726082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300021962|Ga0222713_10782851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300021963|Ga0222712_10115493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1856 | Open in IMG/M |
3300021963|Ga0222712_10410221 | Not Available | 821 | Open in IMG/M |
3300022190|Ga0181354_1132326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300022190|Ga0181354_1175034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300022190|Ga0181354_1181180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300022190|Ga0181354_1235080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300022198|Ga0196905_1014698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2526 | Open in IMG/M |
3300022198|Ga0196905_1107389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300022198|Ga0196905_1119974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300022200|Ga0196901_1155572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300022200|Ga0196901_1227584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300022407|Ga0181351_1005026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5010 | Open in IMG/M |
3300022407|Ga0181351_1018115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2960 | Open in IMG/M |
3300022407|Ga0181351_1210254 | Not Available | 641 | Open in IMG/M |
3300022407|Ga0181351_1212068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300022407|Ga0181351_1212885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300022407|Ga0181351_1241768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300022553|Ga0212124_10063890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2132 | Open in IMG/M |
3300022752|Ga0214917_10004860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14682 | Open in IMG/M |
3300023179|Ga0214923_10327338 | Not Available | 819 | Open in IMG/M |
3300023184|Ga0214919_10015389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9025 | Open in IMG/M |
3300023184|Ga0214919_10184375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1594 | Open in IMG/M |
3300024262|Ga0210003_1168084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
3300024346|Ga0244775_10345678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1229 | Open in IMG/M |
3300024346|Ga0244775_10909899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300024348|Ga0244776_10157738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1647 | Open in IMG/M |
3300024480|Ga0255223_1009866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
3300024510|Ga0255187_1034220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300024531|Ga0255228_1012508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
3300024558|Ga0255232_1120782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300024560|Ga0256306_1078721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300024566|Ga0256309_1026957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1555 | Open in IMG/M |
3300024571|Ga0256302_1057440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
3300024849|Ga0255230_1058897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300025307|Ga0208566_1040287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1600 | Open in IMG/M |
3300025445|Ga0208424_1013298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300025630|Ga0208004_1028394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1663 | Open in IMG/M |
3300025635|Ga0208147_1058858 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
3300025646|Ga0208161_1131002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300025818|Ga0208542_1084409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300025889|Ga0208644_1003497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12192 | Open in IMG/M |
3300025896|Ga0208916_10111175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1163 | Open in IMG/M |
3300025896|Ga0208916_10321626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300025896|Ga0208916_10352290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300026567|Ga0256303_1033004 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
3300027320|Ga0208923_1082957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300027586|Ga0208966_1001535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7262 | Open in IMG/M |
3300027586|Ga0208966_1009562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2894 | Open in IMG/M |
3300027601|Ga0255079_1002516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4862 | Open in IMG/M |
3300027608|Ga0208974_1006317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4012 | Open in IMG/M |
3300027608|Ga0208974_1012716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2706 | Open in IMG/M |
3300027608|Ga0208974_1036297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1466 | Open in IMG/M |
3300027608|Ga0208974_1060833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300027627|Ga0208942_1000579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14499 | Open in IMG/M |
3300027631|Ga0208133_1038098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1185 | Open in IMG/M |
3300027649|Ga0208960_1152546 | Not Available | 574 | Open in IMG/M |
3300027679|Ga0209769_1027194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1993 | Open in IMG/M |
3300027688|Ga0209553_1129684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300027689|Ga0209551_1126835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300027734|Ga0209087_1023859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2981 | Open in IMG/M |
3300027754|Ga0209596_1096768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1402 | Open in IMG/M |
3300027759|Ga0209296_1025568 | All Organisms → Viruses → Predicted Viral | 3309 | Open in IMG/M |
3300027759|Ga0209296_1146209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1068 | Open in IMG/M |
3300027759|Ga0209296_1198929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300027763|Ga0209088_10002025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12786 | Open in IMG/M |
3300027763|Ga0209088_10003069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9951 | Open in IMG/M |
3300027763|Ga0209088_10008410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5681 | Open in IMG/M |
3300027763|Ga0209088_10306024 | Not Available | 642 | Open in IMG/M |
3300027764|Ga0209134_10274075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300027770|Ga0209086_10020374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4171 | Open in IMG/M |
3300027770|Ga0209086_10178574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 998 | Open in IMG/M |
3300027785|Ga0209246_10002465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7110 | Open in IMG/M |
3300027785|Ga0209246_10041590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1763 | Open in IMG/M |
3300027798|Ga0209353_10070474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1592 | Open in IMG/M |
3300027804|Ga0209358_10430699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
3300027808|Ga0209354_10191354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
3300027808|Ga0209354_10338082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300027816|Ga0209990_10330305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300027892|Ga0209550_10435765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300029930|Ga0119944_1007489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1707 | Open in IMG/M |
3300031539|Ga0307380_10973252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300031565|Ga0307379_10710470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300031566|Ga0307378_11268729 | Not Available | 578 | Open in IMG/M |
3300031578|Ga0307376_10960598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300031669|Ga0307375_10208638 | All Organisms → Viruses → Predicted Viral | 1306 | Open in IMG/M |
3300031772|Ga0315288_10536517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1145 | Open in IMG/M |
3300031772|Ga0315288_11677941 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300031857|Ga0315909_10007276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12379 | Open in IMG/M |
3300031885|Ga0315285_10298706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
3300031952|Ga0315294_10613188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
3300031952|Ga0315294_11287008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300031963|Ga0315901_10685279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300031999|Ga0315274_10772893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300031999|Ga0315274_11449395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300031999|Ga0315274_12042613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300032050|Ga0315906_10209641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1825 | Open in IMG/M |
3300032177|Ga0315276_12210630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300032516|Ga0315273_10833299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
3300033233|Ga0334722_10315089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
3300033233|Ga0334722_10869711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300033978|Ga0334977_0168910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
3300033981|Ga0334982_0118137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1380 | Open in IMG/M |
3300033993|Ga0334994_0452167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300033995|Ga0335003_0076601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1761 | Open in IMG/M |
3300033996|Ga0334979_0305671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300034023|Ga0335021_0012426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5798 | Open in IMG/M |
3300034050|Ga0335023_0160670 | All Organisms → Viruses → Predicted Viral | 1273 | Open in IMG/M |
3300034064|Ga0335001_0029953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3192 | Open in IMG/M |
3300034066|Ga0335019_0467868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
3300034073|Ga0310130_0130901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300034106|Ga0335036_0624271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
3300034116|Ga0335068_0582557 | Not Available | 506 | Open in IMG/M |
3300034119|Ga0335054_0655990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300034120|Ga0335056_0177140 | All Organisms → Viruses → Predicted Viral | 1246 | Open in IMG/M |
3300034120|Ga0335056_0582353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300034357|Ga0335064_0420296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.53% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.44% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.34% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.97% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.49% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.12% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.57% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.30% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.75% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.75% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.20% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.92% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.65% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.37% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.10% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.10% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.10% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.82% |
Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 0.82% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.82% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.82% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.82% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.82% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.55% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.27% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.27% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.27% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.27% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.27% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.27% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.27% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake | 0.27% |
Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.27% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.27% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.27% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.27% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352003 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300002141 | M3t6BS1 (103f) | Environmental | Open in IMG/M |
3300002198 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUL 2013 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002465 | Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300003684 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007860 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3um | Environmental | Open in IMG/M |
3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012732 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020157 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25m | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021075 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L373-20m | Environmental | Open in IMG/M |
3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024510 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8h | Environmental | Open in IMG/M |
3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024558 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024849 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025307 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m (SPAdes) | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026567 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2199919062 | 2199352003 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKTKDTPTETTGE |
JGI12421J11937_100004834 | 3300000756 | Freshwater And Sediment | MALTDEDKAFLIKIGQELPTEVKVTKPPKDTTTEKDEA* |
JGI12421J11937_101508082 | 3300000756 | Freshwater And Sediment | MALTDEDKAFLIKIGQELPTEVKVTKPPKDTTTTENEV* |
M3t6BS1_14630382 | 3300002141 | Marine | MALTDEDKKFLIKIGQVVPVEVKVTKPPKETPTEKDEA* |
metazooDRAFT_12460442 | 3300002198 | Lake | MSLSDEEKAFLIKIGQGLPKEIKETQPKETTTQKVEE* |
B570J29032_1090412172 | 3300002408 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKPKETPTEKIGE* |
B570J29032_1093715362 | 3300002408 | Freshwater | MALSDEEKAFLIKIGQGLPKEIKETQPKETTTQKVEE* |
LO132_100458394 | 3300002465 | Freshwater Lake | LELKMTLTDEEKAFLIKIGXVKADEVKDNKPKETTTQTEKEV* |
B570J40625_1005825903 | 3300002835 | Freshwater | MALTDEDKAFLIKIGQELPVEVKVTKPKPITETTTEKDEA* |
B570J40625_1005892643 | 3300002835 | Freshwater | MALTDEDKAFLIKIGQELPKEVKETKKKETPVETPTQETEV* |
JGI25908J49247_100505482 | 3300003277 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKQKAVKDTETPTTENEA* |
JGI25910J50241_101708682 | 3300003388 | Freshwater Lake | MALTDXDKAFLIKIGQELPKEVKETKQKAVKDTETPTTENEA* |
JGI25930J51415_10081761 | 3300003499 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKKKETPVEKPTQETEV* |
Ga0005851_10275401 | 3300003684 | Freshwater And Sediment | MALTEADKAFLIKIGQELPKEVKETKKKETPVETPTQETEV* |
Ga0066599_1013135562 | 3300004282 | Freshwater | MALTDEDKAFLIKIGQVEPEQAKPKKTKPTETTTEKVEE* |
Ga0007764_117250992 | 3300004797 | Freshwater Lake | MALTDEEKAFLIKIGQELPKEVKETNKKETQAQTPTQETEV* |
Ga0070374_100061326 | 3300005517 | Freshwater Lake | MALTDEDKAFLIKIGQVVPAEVKETKSKATPTEKDEE* |
Ga0070374_100168582 | 3300005517 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKTKDTPTETTGE* |
Ga0070374_100203244 | 3300005517 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKTKETPTEKDEA* |
Ga0070374_100645342 | 3300005517 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKDTKPKETLTKENEV* |
Ga0070374_101133005 | 3300005517 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKETKPKETLTKENEV* |
Ga0070374_104796782 | 3300005517 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEIKVTKPKETPTEKDEA* |
Ga0070374_106487302 | 3300005517 | Freshwater Lake | MALTDEDKAFLIKIGQELPTEIKETKTKETPTEKDEA* |
Ga0049083_100855733 | 3300005580 | Freshwater Lentic | MALTDEDKAFLIKIGQELPVEVKETKPKETPTEKDEA* |
Ga0049083_101655282 | 3300005580 | Freshwater Lentic | MALTDEDKAFLIKIGQELPSEVKVTKPPKETPTEKDEA* |
Ga0049083_101931502 | 3300005580 | Freshwater Lentic | MALTDEDKAFLIKIGQELPKEIKETKQKAVKDTETPTTENEA* |
Ga0049081_100022717 | 3300005581 | Freshwater Lentic | MALTDEDKAFLIKIGQELPKEVKETKKKETPVETTTTETEV* |
Ga0049081_100114192 | 3300005581 | Freshwater Lentic | MALTDEDKAFLIKIGQELPKEVKETKKKETPTETPTQETEA* |
Ga0049081_100191092 | 3300005581 | Freshwater Lentic | MTLTDEDKAFLIKIGQVVPAEVKATPKKQEPTTEKDEA* |
Ga0049081_100576873 | 3300005581 | Freshwater Lentic | MALTDEDKAFLIKIGQELPKEVKETKKKETPAETPTQETEV* |
Ga0049081_100792244 | 3300005581 | Freshwater Lentic | MALTDEDKKFLIKIGQELPIEVKETKKQKETPTETPTLQKEE* |
Ga0049081_101621841 | 3300005581 | Freshwater Lentic | MALTDEEKAFLIKIGQELPKEVKDTKQKATETPTTENEA* |
Ga0049081_102075992 | 3300005581 | Freshwater Lentic | MALTDEDKAFLIKIGQELPVEVKETKPKETTTTENEV* |
Ga0049081_102563481 | 3300005581 | Freshwater Lentic | MALTDEEKAFLIKIGQDLPKEVKEIKQQKETVTVTPTQETEV* |
Ga0049085_100011828 | 3300005583 | Freshwater Lentic | MTLTDEDKAFLIKIGQDLPVEVKETKPKETTTEKDEE* |
Ga0049085_100438213 | 3300005583 | Freshwater Lentic | MALTDEEKAFLIKIGQDLPKEIKETQPKETTTQKVEE* |
Ga0049085_100582293 | 3300005583 | Freshwater Lentic | MALTDEDKAFLIKIGQELPTEVKVTKPPKETTTEKDEA* |
Ga0049085_101269811 | 3300005583 | Freshwater Lentic | MSLTDEDRAFLIKIGQELPVEVKENKQTKSTETEKDEE* |
Ga0049085_101352793 | 3300005583 | Freshwater Lentic | MTLTDEDKAFLIKIGQVVPAEIKETKPKETLQEKDEE* |
Ga0049085_101582662 | 3300005583 | Freshwater Lentic | MALTDEDKAFLIKIGQELPAEIKETKTKETPTEKDEA* |
Ga0049085_102604112 | 3300005583 | Freshwater Lentic | MALTDEDKAFLIKIGQELPVEVKETKQKETTTEKDEA* |
Ga0049085_102627921 | 3300005583 | Freshwater Lentic | MALTDEDKAFLIKIGQELPAEIKVTKPKETPTEKDEA* |
Ga0049082_100196512 | 3300005584 | Freshwater Lentic | MALTDEEKAFLIKIGQELPVEVKETKPKETTTEKDEA* |
Ga0049082_100372693 | 3300005584 | Freshwater Lentic | MTLTDEDKAFLIKIGQVVPTEIKETKPKETLTKENEV* |
Ga0049084_101369541 | 3300005585 | Freshwater Lentic | LELNMTLTDEDKAFLIKIGQVVPAEIKETKPKATPTEKDEE* |
Ga0078894_110253932 | 3300005662 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKTKDTSTEKIGE* |
Ga0073913_100117063 | 3300005940 | Sand | MALTDEDKAFLIKIGQELPKEVKETKQKTVKDTETPTTENEA* |
Ga0075470_102487072 | 3300006030 | Aqueous | MALTDEEKAFLIKIGQGLPKEIKETQPKETTTQKVEE* |
Ga0075465_101327112 | 3300006037 | Aqueous | MSLTDEDKAFLIKIGQELPVEVKETKPPKETTTTENEV* |
Ga0075465_101536502 | 3300006037 | Aqueous | MALTDEEKAFLIKIGQELPKEIKETQPKETTTQKVEE* |
Ga0070744_100330443 | 3300006484 | Estuarine | MALTDEDKAFLIKIGQDLPVEVKETKPKETPIQENEV* |
Ga0070744_100589282 | 3300006484 | Estuarine | MALTDEDKAFLIKIGQELPVEVKETKTKETLTEKDEA* |
Ga0070744_100899742 | 3300006484 | Estuarine | MALTDEEKAFLIKIGQELPVEIKDTKPKDPTTKENEV* |
Ga0070744_101265581 | 3300006484 | Estuarine | MALTDEEKAFLIKIGQELPIEIKETKPKETLQEKDEA* |
Ga0070744_101473282 | 3300006484 | Estuarine | MALTDEDKAFLIKIGQELPSEVKVTKPPKETTTEKDEA* |
Ga0070744_101517523 | 3300006484 | Estuarine | TDEDKAFLIKIGQELPKEVKETKQKAAPVETTTTETEV* |
Ga0070744_101545823 | 3300006484 | Estuarine | AKMALTDEDKAFLIKIGQELPKEVKETKQKTVKDTETPTTENEA* |
Ga0075461_100103283 | 3300006637 | Aqueous | MALTEADKAFLIKIGQELPKEVKETKKKETPTETPTQETEA* |
Ga0075461_100678283 | 3300006637 | Aqueous | MALTDEDKAFLIKIGQELPKEVKETKKKETPVEKPTQGTEV* |
Ga0070749_100069566 | 3300006802 | Aqueous | MALTDEEKAFLIKIGQELPKEVKETKKEKETPAETPTQETEV* |
Ga0070749_105881882 | 3300006802 | Aqueous | MALTDEEKAFLIKIGQDLPSEVKETKPKETLQEKEEA* |
Ga0075467_106849542 | 3300006803 | Aqueous | MALTEEEKAFLIKIGQELPTEVKETKPKETTNEKDEA* |
Ga0075464_100016345 | 3300006805 | Aqueous | MSLTDEDKAFLIKIGQELPVEVKETKPPKETPSEKDEA* |
Ga0075464_103905552 | 3300006805 | Aqueous | MALTDEEKAFLIKIGQELPVEVKETKPKDTPTEKIGE* |
Ga0075464_103955581 | 3300006805 | Aqueous | LMALTDEEKAFLIKIGQELPVEVKETKPQEKPTKENEV* |
Ga0075464_105456792 | 3300006805 | Aqueous | MALTDEEKAFLIKIGQDLPVEVKDTKPKDPTTKENEV* |
Ga0075464_108243673 | 3300006805 | Aqueous | TMSLTDEDKAFLIKIGQELPVEVKETKPPKETTTTENEV* |
Ga0075473_100651984 | 3300006875 | Aqueous | MALTEADKAFLIKIGQELPKEVKETKKKETPVEKPTQETEV* |
Ga0070748_11438112 | 3300006920 | Aqueous | MALTEEEKAFLIKIGQELPVEVKETKTKDTPTETTGE* |
Ga0070748_11901741 | 3300006920 | Aqueous | MALTEEEKAFLIKIGQELPVEVKEIKTKDTPTEKIGE* |
Ga0070748_13723711 | 3300006920 | Aqueous | MALTEEEKAFLIKIGQELPVEVKETKPQEKPTKEN |
Ga0099851_10517714 | 3300007538 | Aqueous | MALTEEDKAFLIKIGQELPKEVKETKKKDTPVETTTTETEV* |
Ga0099851_13202791 | 3300007538 | Aqueous | MALTDDDKAFLIKICQELPKEVKETKKKETHVETTTTETEV* |
Ga0099847_10625874 | 3300007540 | Aqueous | MALTDKEKAFLIKIGQELPKEVKETKKKETPTETPTQETEA* |
Ga0099848_12574702 | 3300007541 | Aqueous | MALTDEDKAFLIKIGQELPKEVKETKKKETHVETTTTETEV* |
Ga0102817_10956272 | 3300007555 | Estuarine | MALTDEDKAFLIKIGQELPVEVKETKTKDTPTETTGE* |
Ga0102828_10051864 | 3300007559 | Estuarine | MALTDEDKAFLIKIGQELPKEVKETKQKAAPVETTTTETEV* |
Ga0102828_10683653 | 3300007559 | Estuarine | MALTDEEKAFLIKIGQDLPTEVKETKPKETPIQENEV* |
Ga0102828_10940253 | 3300007559 | Estuarine | MALTEEEKAFLIKIGQELPVEVKETKTKDTPTEKIGE* |
Ga0102828_11616292 | 3300007559 | Estuarine | MALTDEEKAFLIKIGQELPVEVKETKPKETLQEKDEA* |
Ga0102828_11997842 | 3300007559 | Estuarine | MTLTDEEKAFLIKVGQELPSEVKETKPTTTEKDEE* |
Ga0102856_10607952 | 3300007636 | Estuarine | MALTEEEKAFLIKIGQDLPKEIKETQPKETTTQKVEE* |
Ga0102859_12254322 | 3300007708 | Estuarine | MALTEEEKAFLIKIGQELPIEVKETKTKENTTEKEEV* |
Ga0102859_12445372 | 3300007708 | Estuarine | MALTDEDKAFLIKIGQDLPSEVKETKPKETPTEKDEA* |
Ga0104986_14416 | 3300007734 | Freshwater | MALTDEEKAFLIKIGQDVPKEVKETKQKETTTVTPTQETEV* |
Ga0104986_148519 | 3300007734 | Freshwater | MALTDEEKAFLIKIGQELPVEIKETKPKETITEKDEA* |
Ga0104986_16278 | 3300007734 | Freshwater | MALTDEDKAFLIKIGQELPSEVKETKPTKETQIEKDEA* |
Ga0104988_1044721 | 3300007735 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKTKDTPTEKVEE* |
Ga0105735_11105052 | 3300007860 | Estuary Water | MALTDEDKAFLIKIGQELPVEVKETKTKETPTEKDEA* |
Ga0105736_11275962 | 3300007861 | Estuary Water | MALTEEEKAFLIKIGQELPVEVKETKPKDTPTEKIGE* |
Ga0099850_10348204 | 3300007960 | Aqueous | MALTEEDKAFLIKIGQELPKEVKETKKKETPVETTTTETEV* |
Ga0105746_12527471 | 3300007973 | Estuary Water | MALTDEEKAFLIKIGQELPVEVKETKTQEKPTKENEV* |
Ga0108970_111835472 | 3300008055 | Estuary | MALTDEEKAFLIKIGQELPVEVKETKTKDTPTEKIGE* |
Ga0114347_10908554 | 3300008114 | Freshwater, Plankton | MALTEADKAFLIKIGQELSKEVKETKKKETPVETPTQETEV* |
Ga0114351_10142918 | 3300008117 | Freshwater, Plankton | MALTDEEKAFLIKIGQELPIEVKETKKQKETPTETPTLQKEE* |
Ga0114363_10508333 | 3300008266 | Freshwater, Plankton | MALTDEDKAFLIKVGQELPKEIKETKQKKETPAQTPTQETEV* |
Ga0114364_11701832 | 3300008267 | Freshwater, Plankton | MALTDEDKAFLIKIGQELPVEVKETKPKETTQEKDEA* |
Ga0102829_10481064 | 3300009026 | Estuarine | MALTDEDKAFLIKIGQELPVEVKVTKPPKETTTEKDEA* |
Ga0102829_11646001 | 3300009026 | Estuarine | MALTDEDKAFLIKIGQDLPIEVKETKSKATPTEKDEE* |
Ga0105152_100761742 | 3300009039 | Lake Sediment | MALTEEEKAFLIKIGQELPTEVKETQPKETPIEKDEA* |
Ga0105152_104647581 | 3300009039 | Lake Sediment | MALTDEEKAFLVKIGQDLPVEVKETKQTTTEKDEA* |
Ga0105152_104757681 | 3300009039 | Lake Sediment | MALTDEEKAFLIKIGQELPVEVKETKQTTTEKDEA* |
Ga0102830_10509151 | 3300009059 | Estuarine | MALTDEDKAFLIKIGQELPKEVKETKKKETPAQTPTQETEV* |
Ga0102815_102552521 | 3300009080 | Estuarine | MALTDEEKAFLIKIGQELPVEVKETKTKETPTEKIGE* |
Ga0114918_102984543 | 3300009149 | Deep Subsurface | MPLTDKEKAFLIKIGQELPKEVKETKKKEAPTETPTQEIEA* |
Ga0114918_103638213 | 3300009149 | Deep Subsurface | MPLTDKEKAFLIKIGQELPKEVKETKKKETPTETPTQETEA* |
Ga0114918_104640853 | 3300009149 | Deep Subsurface | MPLTDKEKAFLIKIGQELPKEVKETKKKETPTETPTQETEV* |
Ga0114980_1000243913 | 3300009152 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKETKTKDPTTTENEV* |
Ga0114980_101065241 | 3300009152 | Freshwater Lake | TDEEKAFLIKIGQELPVEVKETKTKDTPTETTGE* |
Ga0114980_103543022 | 3300009152 | Freshwater Lake | MALTDEEKAFLIKIGQELPIEVKETKTKEILQEKDEA* |
Ga0114968_101469494 | 3300009155 | Freshwater Lake | MALTDEQKAFLIKICQELPVADKETKPTKETPSEKDEA* |
Ga0114968_102022772 | 3300009155 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKTKATTTETTGE* |
Ga0114968_102833482 | 3300009155 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKETKPKETLQEKDEA* |
Ga0114968_103756571 | 3300009155 | Freshwater Lake | MALTEEDKAFLIKIGQELPTEVKENKPKETPIEKDEA* |
Ga0114977_101223094 | 3300009158 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKPPKETPSEKDEA* |
Ga0114966_101688252 | 3300009161 | Freshwater Lake | MSLTDEDKAFLIKIGQELPTEVKETKPKETLKEKDEA* |
Ga0114970_100247462 | 3300009163 | Freshwater Lake | MALTDEDKAFLIKIGQELPSEVKETKPPKETPTEKDEA* |
Ga0114975_105018312 | 3300009164 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKAKENTTEKEEV* |
Ga0114979_100232232 | 3300009180 | Freshwater Lake | MALTDEEKAFLIKIGQELPIEVKETKTKEQLTETIGE* |
Ga0114979_104687611 | 3300009180 | Freshwater Lake | MPLSEEEKAFLIKIGQELPIEIKETKPKETTTEKVEE* |
Ga0114969_100046722 | 3300009181 | Freshwater Lake | MALTDEEKAFLIKIGQDLPIEVKETKPKETLQEKDEA* |
Ga0114969_101573553 | 3300009181 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKPSKETPSEKDEA* |
Ga0114969_105320423 | 3300009181 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKTKETLTEKDEA* |
Ga0114969_106134471 | 3300009181 | Freshwater Lake | MALTEEDKAFLIKIGQELPVEVKETKPKEITTTENEV* |
Ga0114974_101749543 | 3300009183 | Freshwater Lake | MALTDEEKAFLIKIGQVVPDEIKTTTKKQEPTTEKDEE* |
Ga0114974_102132743 | 3300009183 | Freshwater Lake | MALTDEEKAFLIKIGQVVPNEVKETKPKDPTTKENEV* |
Ga0114971_105730392 | 3300009185 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKETKTKDTLTEKDEA* |
Ga0136655_10567462 | 3300010316 | Freshwater To Marine Saline Gradient | MALTDEEKAFLIKIGQELPVEVKEIKTKDTPTEKIGE* |
Ga0129333_107133372 | 3300010354 | Freshwater To Marine Saline Gradient | MALTDEDKAFLIKIGQELPKEVKETKQKKETPTETPTQETEV* |
Ga0129324_101833833 | 3300010368 | Freshwater To Marine Saline Gradient | MALTDEEKAFLIKIGQELPKEVKETKKKDTPVETTTTETEV* |
Ga0129336_104560541 | 3300010370 | Freshwater To Marine Saline Gradient | MALTDEEKAFLIKIGQELPKEVKETKKKETPVEKPTQETEV* |
Ga0133913_102057027 | 3300010885 | Freshwater Lake | MALTEEDKAFLIKIGQHLPTEVKENKPKETPTEKDEA* |
Ga0133913_113730274 | 3300010885 | Freshwater Lake | MPLSEEEKAFLIKIGQELPVEVKETKPKETLQEKDEA* |
Ga0133913_114047754 | 3300010885 | Freshwater Lake | MALTDEEKAFLIKIGQVVPAEVKETPKKQEPTTEKDEA* |
Ga0129318_102367442 | 3300011009 | Freshwater To Marine Saline Gradient | MALTDEEKAFLIKIGQDLPSEVKETKTKETPTEKDEA* |
Ga0151515_110655 | 3300011114 | Freshwater | MALTDEEKAFLIKIGQELPIEVKETKPKETTTTENEV* |
Ga0151514_110886 | 3300011115 | Freshwater | MPLTDEEKAFLIKIGQDLPVEVKDTKPKDPTTKENEV* |
Ga0151620_10010785 | 3300011268 | Freshwater | VALSDEEKAFLIKIGQGLPKEIKETQPKETTTQKVEE* |
Ga0153698_16576 | 3300011335 | Freshwater | MALTDEDKAFLIKIGQELPAEIKVTKPKETITEKDEA* |
Ga0153698_188619 | 3300011335 | Freshwater | MALTDEEKAFLIKIGQDLPKEIKETQPKDTTTQKVEE* |
Ga0153702_15076 | 3300011337 | Freshwater | MALTDEEKAFLIKIGQDVPVEIKETKKETPTETTTLKKEE* |
Ga0102688_16844193 | 3300011381 | Freshwater Lake | DEEKAFLIKIGQELPKEVKETNKKETQAQTPTQETEV* |
Ga0153800_10052084 | 3300011995 | Freshwater | KAFLIKIGQELPKEVKETNKKETQAQTPTQETEV* |
Ga0153799_10907382 | 3300012012 | Freshwater | LDIGDIMALTDEDKAFLIKIGQELPVEVKVTKPKPITETTTEKDEA* |
Ga0153805_10215023 | 3300012013 | Surface Ice | MALTDEDKAFLIKIGQELPKEVKETNKKETQAQTPTQETEV* |
Ga0157498_10469151 | 3300012666 | Freshwater, Surface Ice | MALTDEEKAFLIKIGQDLPKEVKEIKQQKETITVTPTQETEV* |
Ga0157596_11100503 | 3300012702 | Freshwater | ELGVNKVALSDEEKAFLIKIGQGLPKEIKETQPKETTTQKVEE* |
Ga0157549_11777571 | 3300012732 | Freshwater | RAGAKMALTDEDKAFLIKIGQDLPIEVKETKPPKETTTTENEV* |
Ga0129338_10047311 | 3300012970 | Aqueous | DEEKAFLIKIGQELPKEVKETKKEKETPAETPTQETEV* |
Ga0129338_13853972 | 3300012970 | Aqueous | MALTEADKAFLIKIGQELPKELKETKKKETPVETPAQETEV* |
Ga0164292_101809392 | 3300013005 | Freshwater | MALTDEEKAFLIKIGQDVPKEIKETQPKETTTQKVEE* |
Ga0163199_10887512 | 3300013092 | Freshwater | MALTDEEKAFLIKIGQDLPVEVKETKPKETLQEKDEA* |
(restricted) Ga0172373_102995712 | 3300013131 | Freshwater | MALTEEEKTFLIKIGQELPIEIKETKKQKETPTETPTLQKEE* |
(restricted) Ga0172373_109116151 | 3300013131 | Freshwater | RAGAKMALTDEDKAFLIKIGQELPKEVKETKKKETPVETSTQETEV* |
(restricted) Ga0172375_107580972 | 3300013137 | Freshwater | MALTEEEKAFLIKIGQELPKEVKETNKKETQAQTPTQETEV* |
Ga0177922_100274631 | 3300013372 | Freshwater | MALTDEDKAFLIKIGQELPTEVKETKPKETLTKENEV* |
Ga0177922_104875733 | 3300013372 | Freshwater | MALTDEDKAFLIKIGQELPSEVKVTKPPKETTTTENEV* |
Ga0177922_106641273 | 3300013372 | Freshwater | MALTDEDKAFLIKIGQELPVEIKVTKPPKETTTEKDEA* |
Ga0119960_10801331 | 3300014811 | Aquatic | MALTDEEKAFLIKIGQDLPKEIKETQPKETTTRS* |
Ga0180120_102162043 | 3300017697 | Freshwater To Marine Saline Gradient | MALTEEDKAFLIKIGQELPKEVKETKKKETPVEKPTQETEV |
Ga0181364_10613272 | 3300017701 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKESKPKETTTKENEV |
Ga0181350_10612881 | 3300017716 | Freshwater Lake | MSLTDEDKAFLIKIGQVVPVEVKETKPPKETTTEKDEA |
Ga0181350_10774851 | 3300017716 | Freshwater Lake | VKMALTDEEKAFLIKIGQELPVEVKETKTKETPTEKDEA |
Ga0181347_11383082 | 3300017722 | Freshwater Lake | MSLTDEDKAFLIKIGQTLPVEVKENKQTKPTQTEKDEE |
Ga0181362_11040521 | 3300017723 | Freshwater Lake | TDEDKAFLIKIGQELPTEVKVTKPPKDTTTEKDEA |
Ga0181362_11157881 | 3300017723 | Freshwater Lake | MSLTDEDKAFLIKIGQVVPTEIKETKPKETLTKENEV |
Ga0181362_11234561 | 3300017723 | Freshwater Lake | TDEDKAFLIKIGQELPAEVKVTKPKPITETTTEKDEA |
Ga0181365_10448042 | 3300017736 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKPKETPIKENEV |
Ga0181365_10482721 | 3300017736 | Freshwater Lake | MALTDEEKEFLIKIGQELPVEVKETKTKETPTEKDEA |
Ga0181365_10552524 | 3300017736 | Freshwater Lake | TDEDKAFLIKIGQELPKEVKETKQKAVKDTETPTTENEA |
Ga0181365_11555232 | 3300017736 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKETKPKETPIKENEV |
Ga0181352_11880932 | 3300017747 | Freshwater Lake | GAKMALTDEDKAFLIKIGQELPKEVKETKKKETPVETPTQETEV |
Ga0181356_11119722 | 3300017761 | Freshwater Lake | MALTDEEKAFLIKIGQELPSEVKVTKPPKETTTEKDEA |
Ga0181356_11177893 | 3300017761 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKTKETPTEKDE |
Ga0181358_10098372 | 3300017774 | Freshwater Lake | MALTDEEKAFLIKIGQDLPVEVKETKPKETTTEKDEA |
Ga0181358_10765753 | 3300017774 | Freshwater Lake | MTLTDEDKAFLIKIGQVVPTEINETKPKERKREKDEE |
Ga0181358_11175921 | 3300017774 | Freshwater Lake | MTLTDEDKAFLIKIGQELPSEVKITKPTKETTTEKDEE |
Ga0181358_11400761 | 3300017774 | Freshwater Lake | MALTDEEKAFLIKIGQELPVLVKDITTKETPTEKD |
Ga0181357_11919781 | 3300017777 | Freshwater Lake | LMALTDEEKAFLIKIGQELPVEVKETKTKDTPTETTGE |
Ga0181357_12507132 | 3300017777 | Freshwater Lake | MALTDEDKAFLIKIGQELPAEVKVTKPKPITETTTEKDEA |
Ga0181357_13390001 | 3300017777 | Freshwater Lake | MSLTDEDKAFLIKIGQVVPVEVKETKTTKETTTEKDEA |
Ga0181349_11420453 | 3300017778 | Freshwater Lake | MALTDEEKAFLIKIGQDLPKEVKETKQQKETVTVTTTQETEV |
Ga0181349_13054141 | 3300017778 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEIKETKPKETPIKENEV |
Ga0181349_13069172 | 3300017778 | Freshwater Lake | KMALTDEEKAFLIKIGQELPVEVKETKTKETPTEKDEA |
Ga0181346_11339081 | 3300017780 | Freshwater Lake | RAGVKMALTDEDKAFLIKIGQELPTEVKVTKPPKDTTTEKDEA |
Ga0181346_11487242 | 3300017780 | Freshwater Lake | MTLTDEDKAFLIKIGQVVPVEVKETKPTKETTTEKDEA |
Ga0181346_12110633 | 3300017780 | Freshwater Lake | MALSQEEKDFLIKIGQELPSEVKETKPTKETTEKAEE |
Ga0181346_13336492 | 3300017780 | Freshwater Lake | MSLTDEDKAFLIKIGQELPTEIKVTKPIKDTTTTENEV |
Ga0181348_12871212 | 3300017784 | Freshwater Lake | MTLTDEDKAFLIKIGQELPVEVKVTKPKPITETTTEKDEA |
Ga0181348_12891511 | 3300017784 | Freshwater Lake | MALTDEDKAFLIKIGQELPAEIKVTKPKETPTEKDE |
Ga0181355_10115916 | 3300017785 | Freshwater Lake | MALTDKEKAFLIKIGQELPVEVKDTKPKETLTKENEV |
Ga0181355_10658261 | 3300017785 | Freshwater Lake | LIMALTDEDKAFLIKIGQELPVEVKETKPKETPTEKDEA |
Ga0169931_107584741 | 3300017788 | Freshwater | MALTEEEKAFLIKIGQELPKEVKETNKKETQAQTPTQET |
Ga0181553_105110903 | 3300018416 | Salt Marsh | GVKMALTEEEKAFLIKIGQELPVEIKESKPKETPTKENEV |
Ga0181563_100344594 | 3300018420 | Salt Marsh | MALTDEEKAFLIKIGQELPVEVKETKTQEKPTKENEV |
Ga0181563_108081982 | 3300018420 | Salt Marsh | MALTDEEKAFLIKIGQGLPKEIKETQPKETTTQKVEE |
Ga0181359_10059015 | 3300019784 | Freshwater Lake | MSLTDEDKAFLIKIGQELPVEVKENKQTKPTQTEKDEE |
Ga0181359_10088813 | 3300019784 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKDTKPKETLTKENEV |
Ga0181359_10130591 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKKKETPVEKPTQETEV |
Ga0181359_10144683 | 3300019784 | Freshwater Lake | MTLTDEDKAFLIKIGQVVPAEVKVTPTKQATTTEKDEA |
Ga0181359_10156156 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKETKPKETPTEKDEA |
Ga0181359_10329163 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQVVPAEVKETKSKATPTEKDEE |
Ga0181359_10486193 | 3300019784 | Freshwater Lake | MALTDEEKAFLIKIGQELPKEVKETNKKETQAQTPTQETEV |
Ga0181359_10517325 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKETKPKETLTKENEV |
Ga0181359_10660873 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKETKTKETPTEKDEA |
Ga0181359_11022462 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQELPIEVKVTKPPKETTTEKDEA |
Ga0181359_11079044 | 3300019784 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKTKETPTEKDEA |
Ga0181359_11747693 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQELPTEVKVTKPPKETTTEKDEA |
Ga0181359_11860023 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKQKAAPVETTTTETEV |
Ga0181359_12196752 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKQKTVKDTETPTTENEA |
Ga0181359_12310721 | 3300019784 | Freshwater Lake | MALTDEDKAFLIKIGQELPSEVKVTKPPKETTTEKDEA |
Ga0194113_105829542 | 3300020074 | Freshwater Lake | MALTDEEKAFLIKIGQDLPAEIKETKRQKETPTETPTQEKEE |
Ga0194111_107617052 | 3300020083 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKKKETPVETTTQETEV |
Ga0194110_106097531 | 3300020084 | Freshwater Lake | NELELKMALTDEDKAFLIKIGQELPKEVKETKKKETPVETTTQETEV |
Ga0194110_106373962 | 3300020084 | Freshwater Lake | MALTDEEKAFLIKIGQDLPAEIKETKRQKETPTETPTQEKEV |
Ga0211732_10319112 | 3300020141 | Freshwater | MALTDEEKAFFIKIGQDLPKEIKETQPKETTTQKVEE |
Ga0211736_106485912 | 3300020151 | Freshwater | MALTDEEKAFLIKIGQDLPKEIKETQPKETTTQKVEE |
Ga0194049_10454343 | 3300020157 | Anoxic Zone Freshwater | MALTDEDKAFLIKIGQELPIEVKETKPKETTTTENEV |
Ga0211734_102264076 | 3300020159 | Freshwater | MALTDEDKKFLIKIGQELPIEIKETKKQKETPTETPTLQKEE |
Ga0211726_108580042 | 3300020161 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKPKETSTKENEV |
Ga0211735_114218082 | 3300020162 | Freshwater | MALTDEDKAFLIKIGQVVPAEVKVTKPTKETTTEKDEA |
Ga0194134_101304032 | 3300020179 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKKKETPAETPTQETEV |
Ga0194116_101911363 | 3300020204 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKKKETPAETPTQET |
Ga0194116_103533003 | 3300020204 | Freshwater Lake | LKMALTEEEKAFLIKIGQESPKEVKETNKKETQAQTPTQETEV |
Ga0211731_102472224 | 3300020205 | Freshwater | MAFTDEEKAFLIKIGQDLPIEVKDNKTKEPTTKENEV |
Ga0211731_106234982 | 3300020205 | Freshwater | MALTDEEKAFLIKIGQVVPNEVKETKPKDPTTKENEV |
Ga0211731_116191163 | 3300020205 | Freshwater | MALTDEEKAFLIKIGQELPIEIKETKKQKETPTETPTLQKEE |
Ga0211731_116601483 | 3300020205 | Freshwater | MALTDEDKAFLIKIGQELPKEVKETNKKETQAQTPTQETEV |
Ga0208088_10093002 | 3300020505 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKTKETPTEKIGE |
Ga0208091_10165083 | 3300020506 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKTKDTPTEKIGE |
Ga0207942_10466532 | 3300020549 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKPKETPTEKIGE |
Ga0208486_10127465 | 3300020556 | Freshwater | MALTDEEKAFLIIIGQDLPKEIKETQPKETTTQKVEE |
Ga0208229_10041392 | 3300020569 | Freshwater | MALTDEDKAFLIKIGQELPVEVKVTKPKPITETTTEKDEA |
Ga0194063_100421624 | 3300021075 | Anoxic Zone Freshwater | MPLSDEEKAFLIKIGQELPIEVKDTKPTKATTTENEA |
Ga0214168_10016847 | 3300021140 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKPKENTTEKEEV |
Ga0194117_103774821 | 3300021424 | Freshwater Lake | MALTEEEKAFLIKIGQELPKEVKETNKKETHAQTPTQETEV |
Ga0194060_101757723 | 3300021602 | Anoxic Zone Freshwater | MALTDEEKAFLIKIGQELPVEIKETKTKDPTTKENEV |
Ga0222716_102352813 | 3300021959 | Estuarine Water | MALTDEDKAFLIKIGQELPKEVKETKKKQTPVETPTQETEV |
Ga0222715_102554812 | 3300021960 | Estuarine Water | MALTDEEKAFLIKIGQDLPKEVKETKQKETTTVTPTQETEV |
Ga0222714_101074273 | 3300021961 | Estuarine Water | MALTDEEKAFLIKIGQDLPKEVKETKQQKETVTVTPTQETEV |
Ga0222714_102798832 | 3300021961 | Estuarine Water | MALTDEDKAFLIKIGQELPVEVKETKPKETLQEKDEA |
Ga0222714_103323292 | 3300021961 | Estuarine Water | MALTDEDKAFLIKIGQELPKEVKETKKKETPVETPTTETEV |
Ga0222714_103897143 | 3300021961 | Estuarine Water | MALTDEDKAFLIKIGQELPVEVKETKTKETLTEKDEA |
Ga0222714_104407182 | 3300021961 | Estuarine Water | MALTDEEKAFLIKIGQDLPKEVKETKQKETTIVTPTQETEV |
Ga0222713_102868173 | 3300021962 | Estuarine Water | MALTDEEKAFLIKIGQELPVEVKETKPKETLTKENEV |
Ga0222713_104339122 | 3300021962 | Estuarine Water | MALTDEDKAFLIKIGQEVPAEVKVTKPTKETTTEKDEA |
Ga0222713_107260821 | 3300021962 | Estuarine Water | NNVALSDEEKAFLIKIGQGLPKEIKETQPKETTTQKVEE |
Ga0222713_107828512 | 3300021962 | Estuarine Water | DKAFLIKIGQELPKEVKETKKKETHVETTTTETEV |
Ga0222712_101154935 | 3300021963 | Estuarine Water | MALTDEEKAFLIKIGQELPVEVKETKPKETPTQKVED |
Ga0222712_104102211 | 3300021963 | Estuarine Water | MSLTDEDKAFLIKIGQELPVEVKETKPPKETPSEKDEA |
Ga0181354_11323262 | 3300022190 | Freshwater Lake | MALTDEDKAFLIKIGQELPKKVKETKQKAVKDTETPTTENEA |
Ga0181354_11750342 | 3300022190 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKPKETPTEKDEA |
Ga0181354_11811802 | 3300022190 | Freshwater Lake | MALTDEEKAFLIKIGQELPVLVKDITTKETPTEKDEA |
Ga0181354_12350802 | 3300022190 | Freshwater Lake | EDKAFLIKIGQELPKEVKETKQKAVKDTETPTTENEA |
Ga0196905_10146982 | 3300022198 | Aqueous | MALTEEDKAFLIKIGQELPKEVKETKKKDTPVETTTTETEV |
Ga0196905_11073892 | 3300022198 | Aqueous | MALTDEDKAFLIKIGQELPKEVKETKKKETHVETTTTETEV |
Ga0196905_11199743 | 3300022198 | Aqueous | MALTDEDKAFLIKIGQELPKEVKETKKKETPVEKPTQGT |
Ga0196901_11555721 | 3300022200 | Aqueous | TDEDKAFLIKIGQELPKEVKETKKKETPVETTTTETEV |
Ga0196901_12275841 | 3300022200 | Aqueous | EKAFLIKIGQELPKEVKETKKKETPVQTPTQETEV |
Ga0181351_10050267 | 3300022407 | Freshwater Lake | MALTDEDKAFLIKIGQELPTEVKVTKPPKDTTTEKDEA |
Ga0181351_10181151 | 3300022407 | Freshwater Lake | AKMALTDEDKAFLIKIGQELPKEVKETKQKAVKDTETPTTENEA |
Ga0181351_12102542 | 3300022407 | Freshwater Lake | MTLTDEDKAFLIKIGQVVPTEIKETKPKETLTKENEV |
Ga0181351_12120683 | 3300022407 | Freshwater Lake | TDEDKAFLIKIGQELPKEVKETKQKTVKDTETPTTENEA |
Ga0181351_12128852 | 3300022407 | Freshwater Lake | MALTDEDKAFLIKIGQELPAEIKETKTKETPTEKDEA |
Ga0181351_12417682 | 3300022407 | Freshwater Lake | MSLTDEDKAFLIKIGQVVPIEVKVTKPLKETTTEK |
Ga0212124_100638901 | 3300022553 | Freshwater | MALTDEEKAFLIKIGQDLPVEVKETKPKETLQEKDEA |
Ga0214917_1000486020 | 3300022752 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKTKATTTETTGE |
Ga0214923_103273383 | 3300023179 | Freshwater | DIMALTEEEKAFLIKIGQELPVEVKETKTQEKPTKENEV |
Ga0214919_100153891 | 3300023184 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKTKDTSTEKIGE |
Ga0214919_101843753 | 3300023184 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKPPKETPSEKDEA |
Ga0210003_11680842 | 3300024262 | Deep Subsurface | MPLTDKEKAFLIKIGQELPKEVKETKKKETPTETPTQEIEA |
Ga0244775_103456782 | 3300024346 | Estuarine | MTLTDEEKAFLIKVGQELPSEVKETKPTTTEKDEE |
Ga0244775_109098992 | 3300024346 | Estuarine | MALTDEEKAFLIKIGQDLPTEVKETKPKETPIQENEV |
Ga0244776_101577385 | 3300024348 | Estuarine | MALTDEEKAFLIKIGQELPVEIKETKTKDTPTETTGE |
Ga0255223_10098665 | 3300024480 | Freshwater | MALTDEDKAFLIKIGQELPKEVKETKQKAVKDTETPTTENEE |
Ga0255187_10342202 | 3300024510 | Freshwater | MALTDEDKAFLIKIGQELPKEVKETKKKETPLEKPTQETEV |
Ga0255228_10125082 | 3300024531 | Freshwater | MALTDEDKAFLIKIGQELPKEVKETKQKAAPVETTTTGTEV |
Ga0255232_11207821 | 3300024558 | Freshwater | RAGAKMALTDEDKAFLIKIGQELPKEVKETKQKAVKDTETPTTENEE |
Ga0256306_10787213 | 3300024560 | Freshwater | EDKAFLIKIGQELPKEVKETKQKAIKDTETPTTENEA |
Ga0256309_10269574 | 3300024566 | Freshwater | MPLTDEDKAFLIKIGQELPKEVKETKQKAIKDTETPTTENEA |
Ga0256302_10574404 | 3300024571 | Freshwater | EDKAFLIKIGQELPKEVKETKQKTVKDTETPTTENEA |
Ga0255230_10588971 | 3300024849 | Freshwater | LTDEDKAFLIKIGQELPKEVKETKQKAIKDTETPTTENEA |
Ga0208566_10402874 | 3300025307 | Freshwater | MALTEEEKAFLIKIGQELPVEVKETKPKETLQEKDEA |
Ga0208424_10132983 | 3300025445 | Aqueous | MALTEADKAFLIKIGQELPKEVKETKKKETPTETPTQETEA |
Ga0208004_10283943 | 3300025630 | Aqueous | MALTDEDKAFLIKIGQELPKEVKETKKKETPVEKPTQGTEV |
Ga0208147_10588582 | 3300025635 | Aqueous | MALTDEEKAFLIKIGQDLPSEVKETKPKETLQEKEEA |
Ga0208161_11310022 | 3300025646 | Aqueous | MALTDEDKAFLIKIGQELPKEVKETKKKETPAQTPTQETEV |
Ga0208542_10844093 | 3300025818 | Aqueous | MALTDEDKAFLIKIGQELPKEVKETKKKETPVEKPTQGTE |
Ga0208644_10034976 | 3300025889 | Aqueous | MALTDEEKAFLIKIGQELPKEVKETKKEKETPAETPTQETEV |
Ga0208916_101111752 | 3300025896 | Aqueous | MALTDEEKAFLIKIGQDLPVEVKDTKPKDPTTKENEV |
Ga0208916_103216262 | 3300025896 | Aqueous | MALTDEEKAFLIKIGQELPVEVKETKPKDTPTEKIGE |
Ga0208916_103522903 | 3300025896 | Aqueous | TMSLTDEDKAFLIKIGQELPVEVKETKPPKETTTTENEV |
Ga0256303_10330041 | 3300026567 | Freshwater | MALTDEDKAFLIKIGQELPKEVKEKKQKAIKDTETPTTENEA |
Ga0208923_10829572 | 3300027320 | Estuarine | MALTDEDKAFLIKIGQDLPIEVKETKSKATPTEKDEE |
Ga0208966_10015356 | 3300027586 | Freshwater Lentic | MTLTDEDKAFLIKIGQVVPAEIKETKPKETLQEKDEE |
Ga0208966_10095626 | 3300027586 | Freshwater Lentic | MALTDEEKAFLIKIGQELPVEVKETKPKETTTEKDEA |
Ga0255079_10025164 | 3300027601 | Freshwater | MALTDEDKAFLIKIGQELPKEVKETKQKAIKDTETPTTENEA |
Ga0208974_10063176 | 3300027608 | Freshwater Lentic | MTLTDEDKAFLIKIGQVVPAEVKATPKKQEPTTEKDEA |
Ga0208974_10127163 | 3300027608 | Freshwater Lentic | MALTDEDKAFLIKIGQELPKEVKETKKKETPVETTTTETEV |
Ga0208974_10362972 | 3300027608 | Freshwater Lentic | MALTDEDKKFLIKIGQELPIEVKETKKQKETPTETPTIQKEE |
Ga0208974_10608332 | 3300027608 | Freshwater Lentic | MALTDEDKAFLIKIGQELPKEVKETKKKETPTETPTQETEA |
Ga0208942_10005796 | 3300027627 | Freshwater Lentic | MTLTDEDKAFLIKIGQDLPVEVKETKPKETTTEKDEE |
Ga0208133_10380982 | 3300027631 | Estuarine | MALTDEDKAFLIKIGQDLPVEVKETKPKETPIQENEV |
Ga0208960_11525461 | 3300027649 | Freshwater Lentic | MTLTDEDKAFLIKIGQVVPAEIKETKPKATPTEKD |
Ga0209769_10271942 | 3300027679 | Freshwater Lake | MALTDEDKAFLIKIGQELPAEVKETKTKETPTEKDEA |
Ga0209553_11296842 | 3300027688 | Freshwater Lake | MTLTDEDKAFLIKIGQVVPAEIKETKPKATPTEKDEE |
Ga0209551_11268351 | 3300027689 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKQKAAPLETTTTETEV |
Ga0209087_10238595 | 3300027734 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKAKENTTEKE |
Ga0209596_10967683 | 3300027754 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKPSKETPSEKDEA |
Ga0209296_10255682 | 3300027759 | Freshwater Lake | MALTDEEKAFLIKIGQVVPAEVKETPKKQEPTTEKDEA |
Ga0209296_11462094 | 3300027759 | Freshwater Lake | MALTDEEKAFLIKIGQELPVEVKETKAKENTTEKEEV |
Ga0209296_11989292 | 3300027759 | Freshwater Lake | MALTDEEKAFLIKIGQVVPDEIKTTTKKQEPTTEKDEE |
Ga0209088_1000202513 | 3300027763 | Freshwater Lake | MALTDEDKAFLIKIGQELPVEVKETKTKDPTTTENEV |
Ga0209088_100030693 | 3300027763 | Freshwater Lake | MALTDEEKAFLIKIGQELPIEVKETKTKEILQEKDEA |
Ga0209088_100084106 | 3300027763 | Freshwater Lake | MALTDEEKAFLIKIGQELPIEVKETKTKEQLTETIGE |
Ga0209088_103060243 | 3300027763 | Freshwater Lake | MPLSEEEKAFLIKIGQELPIEIKETKPKETTTEKVEE |
Ga0209134_102740752 | 3300027764 | Freshwater Lake | MPLTDEDKAFLIKIGQELPVEVKITKPTKTTTTETEA |
Ga0209086_100203741 | 3300027770 | Freshwater Lake | MALTEEDKAFLIKIGQELPTEVKENKPKETPIEKDEA |
Ga0209086_101785743 | 3300027770 | Freshwater Lake | MSLTDEDKAFLIKIGQELPTEVKETKPKETLKEKDEA |
Ga0209246_100024651 | 3300027785 | Freshwater Lake | ALTDEDKAFLIKIGQELPKEVKETKQKAVKDTETPTTENEA |
Ga0209246_100415902 | 3300027785 | Freshwater Lake | MSLTDEDKAFLIKIGQVVPVEVKETKPTKETTTEKDEA |
Ga0209353_100704741 | 3300027798 | Freshwater Lake | AKMALTDEEKAFLIKIGQELPVEVKETKPKETLTKENEV |
Ga0209358_104306991 | 3300027804 | Freshwater Lake | AGHRSNKMALTDEEKAFLIKIGQDLPKEIKETQPKETTTQKVEE |
Ga0209354_101913542 | 3300027808 | Freshwater Lake | MSLTDEDKAFLIKIGQALPVEVKENKQTKPTQTEKDEE |
Ga0209354_103380821 | 3300027808 | Freshwater Lake | MALTDEDKAFLIKIGQELPKEVKETKQKAVKDTETPTTEN |
Ga0209990_103303053 | 3300027816 | Freshwater Lake | MALTEEEKAFLIKIGQELPKEVKETNKKETQAQTPTQETEV |
Ga0209550_104357651 | 3300027892 | Freshwater Lake | DKAFLIKIGQELPKEIKETKQKAVKDTETPTTENEA |
Ga0119944_10074893 | 3300029930 | Aquatic | MALTEEDKAFLIKVGQELPKEIKETKQKKETPAQTPTQETEV |
Ga0307380_109732522 | 3300031539 | Soil | MPLTDKEKAFLIKIGQELPKEVKETKKKEAPTETPTQEIEA |
Ga0307379_107104702 | 3300031565 | Soil | MPLTDKEKAFLIKIGQELPKEVKETKKKETPTETPTQETEV |
Ga0307378_112687292 | 3300031566 | Soil | MALTDEDKKFLIKIGQKLPIEVKETKKQKEAPTETPTLQKEE |
Ga0307376_109605981 | 3300031578 | Soil | MPLTDEDKAFLIKIGQELPKEVKETKKKETPVETPRQETEV |
Ga0307375_102086383 | 3300031669 | Soil | MPLTDKEKAFLIKIGQELPKEVKETKKKETPTETPIQETEA |
Ga0315288_105365172 | 3300031772 | Sediment | MALTDEDKAFLIKIGQELPAEIKVTKPTKDTTTEKDEA |
Ga0315288_116779412 | 3300031772 | Sediment | MALTDEDKEFLIKIGQELPTEVKVTKSTKDTPTEKDEA |
Ga0315909_100072766 | 3300031857 | Freshwater | MALTDEEKAFLIKIGQELPIEVKETKKQKETPTETPTLQKEE |
Ga0315285_102987062 | 3300031885 | Sediment | MALTDEDKAFLIKIGQVVPAEVKVTKPPKETTTTENEV |
Ga0315294_106131881 | 3300031952 | Sediment | ELELKMALTDEDKAFLIKIGQVVPAEVKATPKKQEPTTEKDEA |
Ga0315294_112870082 | 3300031952 | Sediment | MALTDEDKAFLIKIGQEVPIEVKVTKPPKETPTEKDEA |
Ga0315901_106852793 | 3300031963 | Freshwater | MALTDEDKAFLIKIGQELPKEVKETKKKETPVQTPTQETEV |
Ga0315274_107728932 | 3300031999 | Sediment | MALTDEDKAFLIKIGQELPTEVKVTKPPKDTTTTENEV |
Ga0315274_114493952 | 3300031999 | Sediment | MALTDEDKAFLIKIGQVVPAEVKATPKKQEPTTEKDEA |
Ga0315274_120426132 | 3300031999 | Sediment | MALTDEDKAFLIKIGQEVPVEVKETKPKETPTEKDEA |
Ga0315906_102096414 | 3300032050 | Freshwater | MALTDEDKAFLIKIGQELPKEVKETKKKGTPVEKPTQETEV |
Ga0315276_122106301 | 3300032177 | Sediment | MALTDEDKAFLIKIGQVVPAEVKATPKKQEPTTEKDEE |
Ga0315273_108332994 | 3300032516 | Sediment | MALTDEDKAFLIKIGQVVPAEVKITKPPKETTTTENEV |
Ga0334722_103150892 | 3300033233 | Sediment | MALTDEDKAFLIKIGQELPAEIKVTKSKETPTEKDEA |
Ga0334722_108697112 | 3300033233 | Sediment | MALTDEDKAFLIKIGQELPVEVKETKPKENTTEKEEV |
Ga0334977_0168910_234_353 | 3300033978 | Freshwater | MALTDEEKAFLIKIGQELPKEVKDTKQKATETPTTENEA |
Ga0334982_0118137_1203_1316 | 3300033981 | Freshwater | MALTDEEKAFLIKIGQDVPKEIKETQPKETTTQKVEE |
Ga0334994_0452167_321_446 | 3300033993 | Freshwater | MALTEEDKAFLIKIGQELPKEVKETKQKAAPVETTTTETEV |
Ga0335003_0076601_1222_1335 | 3300033995 | Freshwater | MSLTDEDKAFLIKIGQELPIEIKETKPKETLTKENEV |
Ga0334979_0305671_557_670 | 3300033996 | Freshwater | MALTDEEKAFLIKIGQELPVEVKETKTKETPTETTGE |
Ga0335021_0012426_5599_5724 | 3300034023 | Freshwater | MALTDEDKAFLIKIGQELPKEIKETKQKAAPVETTTTETEV |
Ga0335023_0160670_1040_1162 | 3300034050 | Freshwater | MALTDEDKAFLIKIGQVVPAEIKVTKLKPITETTTEKDEA |
Ga0335001_0029953_2_112 | 3300034064 | Freshwater | ALTDEEKAFLIKIGQELPVEVKETKTKDTPTETTGE |
Ga0335019_0467868_216_329 | 3300034066 | Freshwater | MSLSDEEKAFLIKIGQDLPKEIKETQPKETTTQKVEE |
Ga0310130_0130901_1_108 | 3300034073 | Fracking Water | DKAFLIKIGQELPKEVKETKKKETPVEKPTQETEV |
Ga0335036_0624271_262_384 | 3300034106 | Freshwater | MALTNEDKAFLIKIGQELPVEVKVTKPKPITETTTEKDEA |
Ga0335068_0582557_95_208 | 3300034116 | Freshwater | MALSDEEKAFLIKIGQELPVEVKDTKPTKVTPTENEA |
Ga0335054_0655990_2_115 | 3300034119 | Freshwater | MALTDEEKAFLIKIGQELPKEVKDTKQKATETPTTENE |
Ga0335056_0177140_1133_1246 | 3300034120 | Freshwater | MALTDEDKAFLIKIGQELPKEVKETKKKETPVETPTQE |
Ga0335056_0582353_467_577 | 3300034120 | Freshwater | EDKAFLIKIGQELPKEVKETKKKETPVETPTQETEV |
Ga0335064_0420296_442_555 | 3300034357 | Freshwater | MALTDEEKAFLIKIGQELPVEIKETKTKDTSTEKIGE |
⦗Top⦘ |