Basic Information | |
---|---|
Family ID | F006141 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 380 |
Average Sequence Length | 41 residues |
Representative Sequence | MILEIFLYGFITAFGWWTANHYVIEPHFPPPIEKKEEK |
Number of Associated Samples | 161 |
Number of Associated Scaffolds | 380 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 82.28 % |
% of genes near scaffold ends (potentially truncated) | 11.58 % |
% of genes from short scaffolds (< 2000 bps) | 61.58 % |
Associated GOLD sequencing projects | 138 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (63.684 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (47.105 % of family members) |
Environment Ontology (ENVO) | Unclassified (75.263 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (90.263 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 380 Family Scaffolds |
---|---|---|
PF09825 | BPL_N | 16.32 |
PF14743 | DNA_ligase_OB_2 | 5.26 |
PF00085 | Thioredoxin | 3.16 |
PF00574 | CLP_protease | 2.89 |
PF13517 | FG-GAP_3 | 2.63 |
PF00149 | Metallophos | 2.11 |
PF00268 | Ribonuc_red_sm | 2.11 |
PF02867 | Ribonuc_red_lgC | 1.58 |
PF00534 | Glycos_transf_1 | 1.32 |
PF13439 | Glyco_transf_4 | 1.32 |
PF16473 | Rv2179c-like | 1.32 |
PF01027 | Bax1-I | 1.32 |
PF01145 | Band_7 | 1.05 |
PF03819 | MazG | 1.05 |
PF01227 | GTP_cyclohydroI | 1.05 |
PF14083 | PGDYG | 0.79 |
PF04055 | Radical_SAM | 0.79 |
PF05226 | CHASE2 | 0.79 |
PF10902 | WYL_2 | 0.79 |
PF11750 | DUF3307 | 0.79 |
PF03721 | UDPG_MGDP_dh_N | 0.79 |
PF14090 | HTH_39 | 0.53 |
PF00293 | NUDIX | 0.53 |
PF13186 | SPASM | 0.53 |
PF01467 | CTP_transf_like | 0.53 |
PF00004 | AAA | 0.53 |
PF00166 | Cpn10 | 0.53 |
PF04308 | RNaseH_like | 0.53 |
PF13609 | Porin_4 | 0.26 |
PF00730 | HhH-GPD | 0.26 |
PF06941 | NT5C | 0.26 |
PF04984 | Phage_sheath_1 | 0.26 |
PF13489 | Methyltransf_23 | 0.26 |
PF13578 | Methyltransf_24 | 0.26 |
PF00383 | dCMP_cyt_deam_1 | 0.26 |
PF13759 | 2OG-FeII_Oxy_5 | 0.26 |
PF00375 | SDF | 0.26 |
PF01223 | Endonuclease_NS | 0.26 |
PF03104 | DNA_pol_B_exo1 | 0.26 |
PF03481 | Sua5_C | 0.26 |
PF00011 | HSP20 | 0.26 |
PF01165 | Ribosomal_S21 | 0.26 |
PF06289 | FlbD | 0.26 |
PF04773 | FecR | 0.26 |
PF00463 | ICL | 0.26 |
PF00984 | UDPG_MGDP_dh | 0.26 |
PF00182 | Glyco_hydro_19 | 0.26 |
PF14235 | DUF4337 | 0.26 |
PF00211 | Guanylate_cyc | 0.26 |
PF02668 | TauD | 0.26 |
PF04023 | FeoA | 0.26 |
PF01521 | Fe-S_biosyn | 0.26 |
PF00109 | ketoacyl-synt | 0.26 |
PF13671 | AAA_33 | 0.26 |
PF02622 | DUF179 | 0.26 |
PF10504 | DUF2452 | 0.26 |
PF13640 | 2OG-FeII_Oxy_3 | 0.26 |
PF00210 | Ferritin | 0.26 |
PF01503 | PRA-PH | 0.26 |
PF00768 | Peptidase_S11 | 0.26 |
PF00487 | FA_desaturase | 0.26 |
PF16790 | Phage_clamp_A | 0.26 |
PF13544 | Obsolete Pfam Family | 0.26 |
PF03851 | UvdE | 0.26 |
PF07963 | N_methyl | 0.26 |
PF01592 | NifU_N | 0.26 |
PF13353 | Fer4_12 | 0.26 |
PF01476 | LysM | 0.26 |
PF08443 | RimK | 0.26 |
PF02739 | 5_3_exonuc_N | 0.26 |
PF01230 | HIT | 0.26 |
COG ID | Name | Functional Category | % Frequency in 380 Family Scaffolds |
---|---|---|---|
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 5.79 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 5.79 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.89 |
COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 2.11 |
COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 1.58 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.05 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.05 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.79 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.79 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.79 |
COG4252 | Extracytoplasmic sensor domain CHASE2 (specificity unknown) | Signal transduction mechanisms [T] | 0.79 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.26 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.26 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.26 |
COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.26 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.26 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.26 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.26 |
COG1582 | Swarming motility protein SwrD | Cell motility [N] | 0.26 |
COG1678 | Putative transcriptional regulator, AlgH/UPF0301 family | Transcription [K] | 0.26 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.26 |
COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 0.26 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.26 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.26 |
COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.26 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.26 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.26 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.26 |
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.26 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.26 |
COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 0.26 |
COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 0.26 |
COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.74 % |
Unclassified | root | N/A | 20.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000439|TBL_comb48_EPIDRAFT_1018260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3345 | Open in IMG/M |
3300001839|RCM40_1071321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 661 | Open in IMG/M |
3300001843|RCM34_1076742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300001844|RCM35_1060886 | All Organisms → Viruses → Predicted Viral | 1444 | Open in IMG/M |
3300001851|RCM31_10001564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
3300001851|RCM31_10133517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300001968|GOS2236_1080167 | All Organisms → Viruses → Predicted Viral | 1577 | Open in IMG/M |
3300002476|metazooDRAFT_10821827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300003277|JGI25908J49247_10003449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5032 | Open in IMG/M |
3300003411|JGI25911J50253_10190288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300004112|Ga0065166_10084535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1126 | Open in IMG/M |
3300004112|Ga0065166_10277033 | Not Available | 680 | Open in IMG/M |
3300004123|Ga0066181_10023170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1506 | Open in IMG/M |
3300004240|Ga0007787_10304637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300004461|Ga0066223_1014926 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
3300004763|Ga0007746_1250628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300004774|Ga0007794_10012651 | All Organisms → Viruses → Predicted Viral | 2514 | Open in IMG/M |
3300004774|Ga0007794_10249295 | Not Available | 527 | Open in IMG/M |
3300004805|Ga0007792_10023608 | All Organisms → Viruses → Predicted Viral | 1870 | Open in IMG/M |
3300004805|Ga0007792_10213283 | Not Available | 593 | Open in IMG/M |
3300004807|Ga0007809_10105785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300005517|Ga0070374_10052866 | All Organisms → Viruses → Predicted Viral | 2112 | Open in IMG/M |
3300005517|Ga0070374_10441733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300005527|Ga0068876_10246410 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300005528|Ga0068872_10303380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
3300005580|Ga0049083_10109090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
3300005580|Ga0049083_10141107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300005581|Ga0049081_10000359 | All Organisms → cellular organisms → Bacteria | 17456 | Open in IMG/M |
3300005581|Ga0049081_10001788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8103 | Open in IMG/M |
3300005581|Ga0049081_10011207 | All Organisms → Viruses → Predicted Viral | 3388 | Open in IMG/M |
3300005581|Ga0049081_10185113 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300005581|Ga0049081_10218589 | Not Available | 678 | Open in IMG/M |
3300005581|Ga0049081_10223910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300005581|Ga0049081_10345947 | Not Available | 505 | Open in IMG/M |
3300005582|Ga0049080_10176949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
3300005584|Ga0049082_10000056 | Not Available | 24851 | Open in IMG/M |
3300005662|Ga0078894_10318801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1409 | Open in IMG/M |
3300005662|Ga0078894_10337805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1365 | Open in IMG/M |
3300005662|Ga0078894_11220794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300005662|Ga0078894_11345530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300006030|Ga0075470_10131118 | Not Available | 739 | Open in IMG/M |
3300006114|Ga0007815_1076432 | Not Available | 669 | Open in IMG/M |
3300006484|Ga0070744_10218352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300006802|Ga0070749_10047646 | All Organisms → Viruses → Predicted Viral | 2617 | Open in IMG/M |
3300006805|Ga0075464_10057432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2164 | Open in IMG/M |
3300006805|Ga0075464_10373937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300007212|Ga0103958_1099191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2613 | Open in IMG/M |
3300007549|Ga0102879_1158409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300008107|Ga0114340_1000930 | Not Available | 18907 | Open in IMG/M |
3300008107|Ga0114340_1024394 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
3300008107|Ga0114340_1081158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1340 | Open in IMG/M |
3300008107|Ga0114340_1145954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300008110|Ga0114343_1052515 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
3300008113|Ga0114346_1038067 | Not Available | 2481 | Open in IMG/M |
3300008117|Ga0114351_1000728 | Not Available | 39280 | Open in IMG/M |
3300008259|Ga0114841_1015046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4102 | Open in IMG/M |
3300008267|Ga0114364_1107129 | Not Available | 858 | Open in IMG/M |
3300008267|Ga0114364_1119199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300008450|Ga0114880_1036713 | All Organisms → Viruses → Predicted Viral | 2151 | Open in IMG/M |
3300008962|Ga0104242_1027502 | Not Available | 976 | Open in IMG/M |
3300009068|Ga0114973_10042619 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2703 | Open in IMG/M |
3300009068|Ga0114973_10267531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300009068|Ga0114973_10304708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
3300009068|Ga0114973_10509301 | Not Available | 623 | Open in IMG/M |
3300009151|Ga0114962_10000409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 38402 | Open in IMG/M |
3300009151|Ga0114962_10004964 | Not Available | 10495 | Open in IMG/M |
3300009151|Ga0114962_10006056 | Not Available | 9404 | Open in IMG/M |
3300009151|Ga0114962_10006487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9008 | Open in IMG/M |
3300009151|Ga0114962_10017657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5093 | Open in IMG/M |
3300009151|Ga0114962_10017888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5056 | Open in IMG/M |
3300009151|Ga0114962_10020735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4650 | Open in IMG/M |
3300009151|Ga0114962_10026441 | All Organisms → Viruses → Predicted Viral | 4031 | Open in IMG/M |
3300009151|Ga0114962_10026895 | All Organisms → Viruses → Predicted Viral | 3990 | Open in IMG/M |
3300009151|Ga0114962_10028040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3894 | Open in IMG/M |
3300009151|Ga0114962_10067272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2304 | Open in IMG/M |
3300009151|Ga0114962_10067454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2300 | Open in IMG/M |
3300009151|Ga0114962_10077336 | Not Available | 2117 | Open in IMG/M |
3300009151|Ga0114962_10106968 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 1734 | Open in IMG/M |
3300009151|Ga0114962_10111177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1692 | Open in IMG/M |
3300009151|Ga0114962_10117419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1635 | Open in IMG/M |
3300009151|Ga0114962_10130190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1533 | Open in IMG/M |
3300009151|Ga0114962_10148286 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300009151|Ga0114962_10264251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 975 | Open in IMG/M |
3300009151|Ga0114962_10364031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300009151|Ga0114962_10475173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300009151|Ga0114962_10615471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300009151|Ga0114962_10620708 | Not Available | 559 | Open in IMG/M |
3300009151|Ga0114962_10660291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300009152|Ga0114980_10017522 | All Organisms → Viruses → Predicted Viral | 4504 | Open in IMG/M |
3300009152|Ga0114980_10451224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
3300009154|Ga0114963_10140022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1444 | Open in IMG/M |
3300009154|Ga0114963_10233053 | Not Available | 1051 | Open in IMG/M |
3300009154|Ga0114963_10241928 | Not Available | 1027 | Open in IMG/M |
3300009154|Ga0114963_10418724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300009155|Ga0114968_10009749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6933 | Open in IMG/M |
3300009155|Ga0114968_10060301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2409 | Open in IMG/M |
3300009155|Ga0114968_10508490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300009155|Ga0114968_10573697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300009158|Ga0114977_10001801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14080 | Open in IMG/M |
3300009158|Ga0114977_10198648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1176 | Open in IMG/M |
3300009159|Ga0114978_10000637 | Not Available | 29988 | Open in IMG/M |
3300009159|Ga0114978_10008460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8067 | Open in IMG/M |
3300009159|Ga0114978_10023393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4509 | Open in IMG/M |
3300009159|Ga0114978_10101476 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
3300009159|Ga0114978_10109292 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
3300009159|Ga0114978_10112392 | Not Available | 1787 | Open in IMG/M |
3300009159|Ga0114978_10153613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1481 | Open in IMG/M |
3300009159|Ga0114978_10208802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
3300009159|Ga0114978_10726378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300009159|Ga0114978_10819309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
3300009160|Ga0114981_10678730 | Not Available | 545 | Open in IMG/M |
3300009160|Ga0114981_10746407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300009161|Ga0114966_10081081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2217 | Open in IMG/M |
3300009161|Ga0114966_10284398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
3300009163|Ga0114970_10011233 | All Organisms → cellular organisms → Bacteria | 6263 | Open in IMG/M |
3300009163|Ga0114970_10031092 | All Organisms → Viruses → Predicted Viral | 3548 | Open in IMG/M |
3300009163|Ga0114970_10084603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1982 | Open in IMG/M |
3300009164|Ga0114975_10000049 | Not Available | 78353 | Open in IMG/M |
3300009164|Ga0114975_10001786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14981 | Open in IMG/M |
3300009164|Ga0114975_10005549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8184 | Open in IMG/M |
3300009164|Ga0114975_10007355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7007 | Open in IMG/M |
3300009164|Ga0114975_10008156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6628 | Open in IMG/M |
3300009164|Ga0114975_10009455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6105 | Open in IMG/M |
3300009164|Ga0114975_10013963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4950 | Open in IMG/M |
3300009164|Ga0114975_10021414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3919 | Open in IMG/M |
3300009164|Ga0114975_10038653 | All Organisms → cellular organisms → Bacteria | 2839 | Open in IMG/M |
3300009164|Ga0114975_10314037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300009164|Ga0114975_10690115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300009164|Ga0114975_10774872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300009180|Ga0114979_10054507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2505 | Open in IMG/M |
3300009180|Ga0114979_10056567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2455 | Open in IMG/M |
3300009180|Ga0114979_10415278 | Not Available | 786 | Open in IMG/M |
3300009180|Ga0114979_10862582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300009181|Ga0114969_10057839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2573 | Open in IMG/M |
3300009181|Ga0114969_10346199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300009181|Ga0114969_10576466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300009182|Ga0114959_10003252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12846 | Open in IMG/M |
3300009182|Ga0114959_10013396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5504 | Open in IMG/M |
3300009182|Ga0114959_10025530 | All Organisms → cellular organisms → Bacteria | 3672 | Open in IMG/M |
3300009182|Ga0114959_10100426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1588 | Open in IMG/M |
3300009182|Ga0114959_10143932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1272 | Open in IMG/M |
3300009182|Ga0114959_10145390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1264 | Open in IMG/M |
3300009182|Ga0114959_10201887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
3300009183|Ga0114974_10125490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1628 | Open in IMG/M |
3300009183|Ga0114974_10319385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 908 | Open in IMG/M |
3300009183|Ga0114974_10524077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300009183|Ga0114974_10658156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300009185|Ga0114971_10662130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300009218|Ga0103848_1001852 | All Organisms → Viruses → Predicted Viral | 3262 | Open in IMG/M |
3300009502|Ga0114951_10481322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
3300010157|Ga0114964_10003502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10592 | Open in IMG/M |
3300010157|Ga0114964_10014117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4731 | Open in IMG/M |
3300010157|Ga0114964_10037321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2622 | Open in IMG/M |
3300010157|Ga0114964_10287962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 779 | Open in IMG/M |
3300010157|Ga0114964_10373555 | Not Available | 673 | Open in IMG/M |
3300010160|Ga0114967_10000571 | Not Available | 31635 | Open in IMG/M |
3300010160|Ga0114967_10019780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4750 | Open in IMG/M |
3300010160|Ga0114967_10141882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
3300010160|Ga0114967_10172415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1184 | Open in IMG/M |
3300010334|Ga0136644_10125091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1580 | Open in IMG/M |
3300010334|Ga0136644_10228446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
3300010334|Ga0136644_10709430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300010354|Ga0129333_10200898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1813 | Open in IMG/M |
3300010885|Ga0133913_10029767 | Not Available | 14653 | Open in IMG/M |
3300010885|Ga0133913_10073234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9191 | Open in IMG/M |
3300010885|Ga0133913_10195060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5400 | Open in IMG/M |
3300010885|Ga0133913_10595418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2903 | Open in IMG/M |
3300010885|Ga0133913_10621003 | Not Available | 2836 | Open in IMG/M |
3300010885|Ga0133913_10863225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2353 | Open in IMG/M |
3300010885|Ga0133913_10894261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2306 | Open in IMG/M |
3300010885|Ga0133913_10927375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2258 | Open in IMG/M |
3300010885|Ga0133913_11003091 | Not Available | 2159 | Open in IMG/M |
3300010885|Ga0133913_11148664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1996 | Open in IMG/M |
3300010885|Ga0133913_11409956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1771 | Open in IMG/M |
3300010885|Ga0133913_11515896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1697 | Open in IMG/M |
3300010885|Ga0133913_11719248 | All Organisms → Viruses → Predicted Viral | 1575 | Open in IMG/M |
3300010885|Ga0133913_11810995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1527 | Open in IMG/M |
3300010885|Ga0133913_11883012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1492 | Open in IMG/M |
3300010885|Ga0133913_11906475 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
3300010885|Ga0133913_12504368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300010885|Ga0133913_13071922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
3300010885|Ga0133913_13520532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
3300010885|Ga0133913_13636706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
3300011010|Ga0139557_1048104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
3300011113|Ga0151517_1001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 334901 | Open in IMG/M |
3300011268|Ga0151620_1188510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300011995|Ga0153800_1017542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300012000|Ga0119951_1040733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1408 | Open in IMG/M |
3300012000|Ga0119951_1148807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300012663|Ga0157203_1008036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1841 | Open in IMG/M |
3300012663|Ga0157203_1009497 | Not Available | 1645 | Open in IMG/M |
3300012663|Ga0157203_1061972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300013004|Ga0164293_10708218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
3300013005|Ga0164292_10112910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2032 | Open in IMG/M |
3300013006|Ga0164294_10020568 | All Organisms → cellular organisms → Bacteria | 5385 | Open in IMG/M |
3300013006|Ga0164294_10049283 | All Organisms → Viruses → Predicted Viral | 3276 | Open in IMG/M |
3300013006|Ga0164294_10387485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
3300013014|Ga0164295_10027136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4382 | Open in IMG/M |
3300013285|Ga0136642_1000788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15167 | Open in IMG/M |
3300013285|Ga0136642_1002130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7917 | Open in IMG/M |
3300013286|Ga0136641_1011501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2912 | Open in IMG/M |
3300013286|Ga0136641_1066938 | Not Available | 1026 | Open in IMG/M |
3300013286|Ga0136641_1199903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300013372|Ga0177922_10135250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300013372|Ga0177922_10460832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300017722|Ga0181347_1115952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300017722|Ga0181347_1162830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300017766|Ga0181343_1162066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacterales incertae sedis → Candidatus Fonsibacter → unclassified Candidatus Fonsibacter → Candidatus Fonsibacter sp. PEL4 | 621 | Open in IMG/M |
3300017766|Ga0181343_1198872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300017780|Ga0181346_1245458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300017784|Ga0181348_1078817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1309 | Open in IMG/M |
3300017785|Ga0181355_1078167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1385 | Open in IMG/M |
3300018420|Ga0181563_10764005 | Not Available | 531 | Open in IMG/M |
3300018868|Ga0187844_10160552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
3300019093|Ga0187843_10149628 | Not Available | 1014 | Open in IMG/M |
3300019784|Ga0181359_1005516 | All Organisms → Viruses → Predicted Viral | 4130 | Open in IMG/M |
3300019784|Ga0181359_1023605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2343 | Open in IMG/M |
3300019784|Ga0181359_1065480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1384 | Open in IMG/M |
3300019784|Ga0181359_1105202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1029 | Open in IMG/M |
3300019784|Ga0181359_1138163 | Not Available | 851 | Open in IMG/M |
3300020141|Ga0211732_1272729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300020151|Ga0211736_10560999 | Not Available | 692 | Open in IMG/M |
3300020151|Ga0211736_10988489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5244 | Open in IMG/M |
3300020160|Ga0211733_10380277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5443 | Open in IMG/M |
3300020160|Ga0211733_11007948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1351 | Open in IMG/M |
3300020161|Ga0211726_10912153 | All Organisms → Viruses → Predicted Viral | 3686 | Open in IMG/M |
3300020161|Ga0211726_10983666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300020162|Ga0211735_10709685 | Not Available | 534 | Open in IMG/M |
3300020172|Ga0211729_10373366 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
3300020172|Ga0211729_10586287 | Not Available | 1095 | Open in IMG/M |
3300021131|Ga0214206_1000842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7850 | Open in IMG/M |
3300021131|Ga0214206_1007073 | Not Available | 1765 | Open in IMG/M |
3300021131|Ga0214206_1010633 | Not Available | 1311 | Open in IMG/M |
3300021354|Ga0194047_10273075 | Not Available | 652 | Open in IMG/M |
3300021424|Ga0194117_10009751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7658 | Open in IMG/M |
3300021519|Ga0194048_10015976 | All Organisms → Viruses → Predicted Viral | 3332 | Open in IMG/M |
3300021519|Ga0194048_10118521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
3300021519|Ga0194048_10146061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
3300021519|Ga0194048_10150425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300021519|Ga0194048_10375706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300021956|Ga0213922_1023429 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
3300021960|Ga0222715_10475411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300021961|Ga0222714_10082227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2095 | Open in IMG/M |
3300021961|Ga0222714_10200290 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
3300021961|Ga0222714_10634943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300021962|Ga0222713_10467124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
3300021963|Ga0222712_10214954 | Not Available | 1250 | Open in IMG/M |
3300022407|Ga0181351_1077755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
3300022407|Ga0181351_1261288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300022591|Ga0236341_1008676 | Not Available | 3797 | Open in IMG/M |
3300022591|Ga0236341_1010387 | Not Available | 3318 | Open in IMG/M |
3300022594|Ga0236340_1039582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
3300022748|Ga0228702_1016322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2601 | Open in IMG/M |
3300022752|Ga0214917_10000002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 330017 | Open in IMG/M |
3300022752|Ga0214917_10451550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300023174|Ga0214921_10000015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 356312 | Open in IMG/M |
3300023174|Ga0214921_10040429 | All Organisms → Viruses → Predicted Viral | 4317 | Open in IMG/M |
3300023174|Ga0214921_10078324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium | 2636 | Open in IMG/M |
3300023174|Ga0214921_10152330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacterales incertae sedis → Candidatus Fonsibacter → unclassified Candidatus Fonsibacter → Candidatus Fonsibacter sp. PEL4 | 1564 | Open in IMG/M |
3300023174|Ga0214921_10298780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
3300023174|Ga0214921_10415641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300023174|Ga0214921_10446522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300023179|Ga0214923_10020996 | Not Available | 5830 | Open in IMG/M |
3300023184|Ga0214919_10002788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27046 | Open in IMG/M |
3300023184|Ga0214919_10017444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8286 | Open in IMG/M |
3300023184|Ga0214919_10050957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3958 | Open in IMG/M |
3300023184|Ga0214919_10065183 | All Organisms → Viruses | 3337 | Open in IMG/M |
3300023184|Ga0214919_10117496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2207 | Open in IMG/M |
3300023184|Ga0214919_10187962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1571 | Open in IMG/M |
3300023184|Ga0214919_10209012 | Not Available | 1453 | Open in IMG/M |
3300023184|Ga0214919_10471938 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum | 784 | Open in IMG/M |
3300023311|Ga0256681_10789689 | Not Available | 578 | Open in IMG/M |
3300024289|Ga0255147_1000161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28063 | Open in IMG/M |
3300024289|Ga0255147_1001249 | Not Available | 6428 | Open in IMG/M |
3300024289|Ga0255147_1001865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5149 | Open in IMG/M |
3300024298|Ga0255178_1000493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9405 | Open in IMG/M |
3300024346|Ga0244775_11090992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
3300024346|Ga0244775_11359710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300024348|Ga0244776_10897475 | Not Available | 525 | Open in IMG/M |
3300024351|Ga0255141_1031994 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300025383|Ga0208250_1006429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2393 | Open in IMG/M |
3300025430|Ga0208622_1030272 | Not Available | 1057 | Open in IMG/M |
3300025436|Ga0208103_1048921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300025616|Ga0208613_1035882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
3300025616|Ga0208613_1036219 | All Organisms → Viruses → Predicted Viral | 1163 | Open in IMG/M |
3300025616|Ga0208613_1062085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300025732|Ga0208784_1055872 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
3300025789|Ga0208499_1074583 | Not Available | 501 | Open in IMG/M |
3300025889|Ga0208644_1361782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 549 | Open in IMG/M |
3300027123|Ga0255090_1021862 | Not Available | 1108 | Open in IMG/M |
3300027136|Ga0255107_1034715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300027586|Ga0208966_1000008 | Not Available | 91283 | Open in IMG/M |
3300027586|Ga0208966_1001773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6744 | Open in IMG/M |
3300027586|Ga0208966_1024717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1766 | Open in IMG/M |
3300027601|Ga0255079_1031403 | Not Available | 1188 | Open in IMG/M |
3300027608|Ga0208974_1016010 | All Organisms → Viruses → Predicted Viral | 2370 | Open in IMG/M |
3300027608|Ga0208974_1098140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 784 | Open in IMG/M |
3300027659|Ga0208975_1217624 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300027679|Ga0209769_1174358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300027708|Ga0209188_1000041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 144185 | Open in IMG/M |
3300027708|Ga0209188_1000121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 89773 | Open in IMG/M |
3300027708|Ga0209188_1002099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15090 | Open in IMG/M |
3300027708|Ga0209188_1002449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13681 | Open in IMG/M |
3300027708|Ga0209188_1018211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3673 | Open in IMG/M |
3300027708|Ga0209188_1030273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2597 | Open in IMG/M |
3300027708|Ga0209188_1032034 | All Organisms → cellular organisms → Bacteria | 2502 | Open in IMG/M |
3300027708|Ga0209188_1038961 | Not Available | 2200 | Open in IMG/M |
3300027708|Ga0209188_1077019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1394 | Open in IMG/M |
3300027708|Ga0209188_1104064 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300027708|Ga0209188_1105827 | Not Available | 1121 | Open in IMG/M |
3300027708|Ga0209188_1233449 | Not Available | 644 | Open in IMG/M |
3300027708|Ga0209188_1250232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300027708|Ga0209188_1281345 | Not Available | 561 | Open in IMG/M |
3300027708|Ga0209188_1302524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1005298 | Not Available | 15227 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1076687 | All Organisms → Viruses → Predicted Viral | 1731 | Open in IMG/M |
3300027733|Ga0209297_1020257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3170 | Open in IMG/M |
3300027733|Ga0209297_1173058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
3300027733|Ga0209297_1200236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300027734|Ga0209087_1000021 | Not Available | 101662 | Open in IMG/M |
3300027734|Ga0209087_1191497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300027734|Ga0209087_1280216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300027736|Ga0209190_1025323 | All Organisms → Viruses → Predicted Viral | 3259 | Open in IMG/M |
3300027736|Ga0209190_1074038 | All Organisms → Viruses → Predicted Viral | 1638 | Open in IMG/M |
3300027736|Ga0209190_1177165 | Not Available | 899 | Open in IMG/M |
3300027736|Ga0209190_1204663 | Not Available | 811 | Open in IMG/M |
3300027741|Ga0209085_1000841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20809 | Open in IMG/M |
3300027746|Ga0209597_1000023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 94399 | Open in IMG/M |
3300027747|Ga0209189_1044661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2180 | Open in IMG/M |
3300027747|Ga0209189_1240681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300027747|Ga0209189_1273672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300027749|Ga0209084_1020026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3644 | Open in IMG/M |
3300027749|Ga0209084_1092526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1347 | Open in IMG/M |
3300027749|Ga0209084_1145950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
3300027754|Ga0209596_1000327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 44696 | Open in IMG/M |
3300027754|Ga0209596_1366385 | Not Available | 550 | Open in IMG/M |
3300027756|Ga0209444_10318730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300027759|Ga0209296_1001828 | Not Available | 15701 | Open in IMG/M |
3300027759|Ga0209296_1009783 | Not Available | 5806 | Open in IMG/M |
3300027759|Ga0209296_1024664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3381 | Open in IMG/M |
3300027759|Ga0209296_1044148 | All Organisms → Viruses → Predicted Viral | 2367 | Open in IMG/M |
3300027759|Ga0209296_1114371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1267 | Open in IMG/M |
3300027759|Ga0209296_1145857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
3300027759|Ga0209296_1297547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300027759|Ga0209296_1386754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300027763|Ga0209088_10171722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
3300027763|Ga0209088_10236305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300027763|Ga0209088_10342543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300027769|Ga0209770_10179713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300027769|Ga0209770_10304878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300027770|Ga0209086_10068320 | Not Available | 1915 | Open in IMG/M |
3300027777|Ga0209829_10378773 | Not Available | 554 | Open in IMG/M |
3300027782|Ga0209500_10001923 | Not Available | 15225 | Open in IMG/M |
3300027782|Ga0209500_10129613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1211 | Open in IMG/M |
3300027816|Ga0209990_10057073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1974 | Open in IMG/M |
3300027892|Ga0209550_10410292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
3300027969|Ga0209191_1000236 | Not Available | 44259 | Open in IMG/M |
3300027969|Ga0209191_1000658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25913 | Open in IMG/M |
3300027969|Ga0209191_1001120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18222 | Open in IMG/M |
3300027969|Ga0209191_1009831 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5118 | Open in IMG/M |
3300028392|Ga0304729_1000001 | Not Available | 340548 | Open in IMG/M |
3300028392|Ga0304729_1009750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4565 | Open in IMG/M |
3300028392|Ga0304729_1029460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2229 | Open in IMG/M |
3300028392|Ga0304729_1107347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
3300028394|Ga0304730_1000027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 184358 | Open in IMG/M |
3300031758|Ga0315907_10045613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3875 | Open in IMG/M |
3300031784|Ga0315899_10133368 | Not Available | 2541 | Open in IMG/M |
3300031786|Ga0315908_10717905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300031787|Ga0315900_11124428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300031857|Ga0315909_10004473 | Not Available | 16495 | Open in IMG/M |
3300031857|Ga0315909_10018402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7112 | Open in IMG/M |
3300031857|Ga0315909_10058834 | All Organisms → cellular organisms → Bacteria | 3506 | Open in IMG/M |
3300031963|Ga0315901_10280215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1392 | Open in IMG/M |
3300032092|Ga0315905_10374896 | Not Available | 1344 | Open in IMG/M |
3300032092|Ga0315905_10710327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300032116|Ga0315903_10678310 | Not Available | 775 | Open in IMG/M |
3300034062|Ga0334995_0220983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1300 | Open in IMG/M |
3300034092|Ga0335010_0399048 | Not Available | 753 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 47.11% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.21% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.37% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.47% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.42% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.89% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.63% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.37% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.58% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.58% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.58% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.58% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.05% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.79% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.79% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.53% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.53% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.26% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.26% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.26% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.26% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.26% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.26% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.26% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300001839 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3b | Environmental | Open in IMG/M |
3300001843 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b | Environmental | Open in IMG/M |
3300001844 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007212 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300022594 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1 | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025430 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027123 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d | Environmental | Open in IMG/M |
3300027136 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TBL_comb48_EPIDRAFT_10182605 | 3300000439 | Freshwater | MVVEYIVIGFLSALGWWGANHYVIEPYFPPPIERKEEKHV* |
RCM40_10713212 | 3300001839 | Marine Plankton | MIFEALVFGFFSAFGWWGATHYVIEPHFPPPIERKVEDKKD* |
RCM34_10767421 | 3300001843 | Marine Plankton | WRSDMIFEALVFGFFSAFGWWGATHYVIEPHFPPAIERKVEEKKD* |
RCM35_10608864 | 3300001844 | Marine Plankton | MILEALVFGFFSAFGWWGATHYVIEPHFPPAIERKVEEKKD* |
RCM37_10758142 | 3300001850 | Marine Plankton | MIIEYIFIGFLSALGWWGANHYVIEPYAPPPIEKKKEEKNEKSN* |
RCM31_100015642 | 3300001851 | Marine Plankton | MVLEIFLAGMITAFGWWTSTHYIIEPYFPPPIERKENDRK* |
RCM31_101335172 | 3300001851 | Marine Plankton | MIAAIFLYGFISAFGWWTANHYVIEPHFPPPIERKKDDQPDGKN* |
GOS2236_10801673 | 3300001968 | Marine | MIIELFLYGFMSAFGWWTANHYFIEPHFPPPIERKQEKNEPKSE* |
metazooDRAFT_108218272 | 3300002476 | Lake | MILEIFLYGFITAFGWWSANHYVIEPYFPPPVERKKEDNGINPN* |
JGI25908J49247_100034497 | 3300003277 | Freshwater Lake | MILEILCYGFITAFGWWGANHYVIEPYFPPPIERKKEETK* |
JGI25911J50253_101902881 | 3300003411 | Freshwater Lake | MVFLEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKKEESK*Y |
Ga0065166_100845353 | 3300004112 | Freshwater Lake | MILEVFLYGFITAFGWWSANHYVIEPYFPPPIEKSIDEKNKVNK* |
Ga0065166_102770332 | 3300004112 | Freshwater Lake | MIVELLLYGFITAFGWWGANHYVIEPYFPPPMERKKEETK* |
Ga0066181_100231701 | 3300004123 | Freshwater Lake | HFTKGHTMGLLEVVVYGFFTAFGWWGANHYVIEPYFPPKIERKVEKKDDQK* |
Ga0007787_103046372 | 3300004240 | Freshwater Lake | MILEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEDVLNSK* |
Ga0066223_10149262 | 3300004461 | Marine | MIIEIFFAGFITAFGWWTATHYVIEPHFPPPIEKKVESK* |
Ga0007746_12506282 | 3300004763 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYIIEPYFPPPIEKKEDSKK* |
Ga0007794_100126513 | 3300004774 | Freshwater | MILEIFLAGMITAFGWWTSTHYIIEPYFPPPIERKDGTPTK* |
Ga0007794_102492952 | 3300004774 | Freshwater | EYKMVLEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKVENK* |
Ga0007792_100236085 | 3300004805 | Freshwater | MIIEIFLAGMITAFGWWTSTHYIIEPYFPPPIERKNDTSTK* |
Ga0007792_102132832 | 3300004805 | Freshwater | MILEIFLYGFITAFGWWTSTHYIIEPYFPPPIERKVENKTTDASKD* |
Ga0007809_101057852 | 3300004807 | Freshwater | MIVEIFVYGFISAFGWWTANHYVIEPHFPPAIERKDKEDKDK* |
Ga0070374_100528665 | 3300005517 | Freshwater Lake | MVFLEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKKEESK* |
Ga0070374_104417331 | 3300005517 | Freshwater Lake | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPKIERKVEKKDDQK** |
Ga0068876_102464101 | 3300005527 | Freshwater Lake | KMILEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEDKKAD* |
Ga0068872_103033802 | 3300005528 | Freshwater Lake | MILEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEDKKAD* |
Ga0049083_101090902 | 3300005580 | Freshwater Lentic | MVIEIFMYGFITAFGWWTANHYVIEPHFPPSVLEKKEEVKKNSN* |
Ga0049083_101411071 | 3300005580 | Freshwater Lentic | MVFEIFLYGFITAFGWWTATHYVIEPHFPPPIEKK |
Ga0049081_100003594 | 3300005581 | Freshwater Lentic | MGIVEVIVYGFFTAFGWWGANHYVIEPHFPPPIERKEEKKEDKK* |
Ga0049081_1000178816 | 3300005581 | Freshwater Lentic | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKEEKKNEK* |
Ga0049081_100112072 | 3300005581 | Freshwater Lentic | MVEIFLYGFISAFGWWTANHYIIEPHFPPAVEKKEEKKEKPNEK* |
Ga0049081_101851132 | 3300005581 | Freshwater Lentic | MILEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKVEEKK* |
Ga0049081_102185892 | 3300005581 | Freshwater Lentic | MVFEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQK* |
Ga0049081_102239103 | 3300005581 | Freshwater Lentic | MIVEIFLYGFISAFGWWSATHYVIEPHFPPPIEKKAEQK* |
Ga0049081_103459472 | 3300005581 | Freshwater Lentic | MVLEIFLYGFISAFGWWSATHYVIEPHFPPSVIEKKMEQQK* |
Ga0049080_101769492 | 3300005582 | Freshwater Lentic | MVLEIVMWGFLSAFGWWGAQHYVIEPYFPPPIEKKESK* |
Ga0049082_1000005627 | 3300005584 | Freshwater Lentic | MIVEIFLYGFITAFGWWTAQHYVIEPHFPPPIEKKVEK* |
Ga0078894_103188012 | 3300005662 | Freshwater Lake | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPKIERKVEKKDDQK* |
Ga0078894_103378053 | 3300005662 | Freshwater Lake | MVLEIFMYGFITAFGWWSANHYVIEPHFPPPIEKKIEKKDDVK* |
Ga0078894_112207942 | 3300005662 | Freshwater Lake | MVLEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEDKPN* |
Ga0078894_113455303 | 3300005662 | Freshwater Lake | MVLEIFLYGFISAFGWWSATHYVIEPHFPPPIEKKVENK* |
Ga0075470_101311183 | 3300006030 | Aqueous | LEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKEEKK* |
Ga0007815_10764322 | 3300006114 | Freshwater | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKEEKKEAP |
Ga0070744_102183522 | 3300006484 | Estuarine | MVLEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEEVK* |
Ga0070749_100476463 | 3300006802 | Aqueous | MILEIIAWGFFSAFGWWGAQHYVIEPYFPPPIERKQEKNLTTESK* |
Ga0075464_100574321 | 3300006805 | Aqueous | MLIEMFLYGFVSAFGWWSANHYVIEPHLPPPIVRKDDTKKDSK* |
Ga0075464_103739372 | 3300006805 | Aqueous | MIVEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKVEQK* |
Ga0103958_10991912 | 3300007212 | Freshwater Lake | MVLEIVLWGFLSAFGWWGANHYVIEPYFPPPIEKKKEDK* |
Ga0102879_11584093 | 3300007549 | Estuarine | MILEVFLYGFITAFGWWSANHYVIEPYFPPPIEKAESKNKEKQKEN* |
Ga0114340_100093016 | 3300008107 | Freshwater, Plankton | MIIEIFLYGFISAFGWWTAQHYVIEPHFPPPIEKKEDKKQ* |
Ga0114340_10243944 | 3300008107 | Freshwater, Plankton | MVLEIVMWGFLSAFGWWGANHYVIEPYFPPPIEKNQEKK* |
Ga0114340_10811582 | 3300008107 | Freshwater, Plankton | MVLEIVMWGFLSAFGWWGAQHYVIEPYFPPPIEKKETK* |
Ga0114340_11459542 | 3300008107 | Freshwater, Plankton | MVLEIFLYGFISAFGWWSATHYVIEPHFPPPIEKKVEQK* |
Ga0114343_10525152 | 3300008110 | Freshwater, Plankton | MILEIVMWGFLSAFGWWGAQHYVIEPYFPKHETKVEEVKTDKK* |
Ga0114346_10380675 | 3300008113 | Freshwater, Plankton | MIAEVILWGFFSAFGWWGAQHYIIEPYFPPPIERKQEKNLTSESK* |
Ga0114351_100072811 | 3300008117 | Freshwater, Plankton | YGFFTAFGWWGANHYVIEPYFPPKIERKVEKKDDQK* |
Ga0114841_10150463 | 3300008259 | Freshwater, Plankton | MIVELFLYGFITAFGWWTANHYVIEPYFPPPIERKQDEQK* |
Ga0114364_11071292 | 3300008267 | Freshwater, Plankton | MIIEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQK* |
Ga0114364_11191994 | 3300008267 | Freshwater, Plankton | MIIEIFFAGFITAFGWWTATHYVIEPHFPPPIEKKAEQK* |
Ga0114880_10367134 | 3300008450 | Freshwater Lake | MIIEIFLYGFISAFGWWTAQHYVIEPHFPPPIEKKE |
Ga0104242_10275023 | 3300008962 | Freshwater | MGILEVVVYGFFTAFGWWGANHYVIEPYAPPPIERKKEETK* |
Ga0114973_100426192 | 3300009068 | Freshwater Lake | MIIEIFFYGFITAFGWWSANHYVIEPYFPPPIEKKVELN* |
Ga0114973_102675312 | 3300009068 | Freshwater Lake | MGIVEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKEEKKDDKK* |
Ga0114973_103047081 | 3300009068 | Freshwater Lake | MLLEVIIYGFFTAFGWWGANHYVIEPYFPPPIEKKETK* |
Ga0114973_105093012 | 3300009068 | Freshwater Lake | MVLEIFLAGMITAFGWWTSTHYIIEPYFPPPIEKKVEQK* |
Ga0114962_1000040920 | 3300009151 | Freshwater Lake | MVLEILLYGFVTAFGWWGANHYVIEPYFPPPIEKKVEQK* |
Ga0114962_100049642 | 3300009151 | Freshwater Lake | MIIEIFFYGFVTAFGWWTANHYVIEPYFPPSVLEQREDKKKEDKKD* |
Ga0114962_1000605610 | 3300009151 | Freshwater Lake | MIIEIFCYGFITAFGWWTANHYVIEPHFPPAIERPAEKK* |
Ga0114962_100064875 | 3300009151 | Freshwater Lake | MMILEIFVAGMITAFGWWTSTHYIIEPYFPPPVEKKVEQK* |
Ga0114962_1001765711 | 3300009151 | Freshwater Lake | MMILEIFVAGMITAFGWWTSTHYIIEPYFPPPIEKKETK* |
Ga0114962_100178885 | 3300009151 | Freshwater Lake | MIIEIFVAGMITAFGWWTATHYVIEPHFPPPIEKKVESK* |
Ga0114962_100207352 | 3300009151 | Freshwater Lake | MGIAEVIVYGFFTAFGWWGANHYVIEPYFPPPVERKVEKKEDKK* |
Ga0114962_100264415 | 3300009151 | Freshwater Lake | MILEIFLYGFITAFGWWTANHYVIEPHFPPPIEKKEEK* |
Ga0114962_100268956 | 3300009151 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYVIEPYFPESKKIERKKDD* |
Ga0114962_100280405 | 3300009151 | Freshwater Lake | MIIEIFFAGFITAFGWWTATHYVIEPHFPPPIEKKVEQK* |
Ga0114962_100672724 | 3300009151 | Freshwater Lake | MILEVFVYGFITAFGWWSATHYVIEPYFPPPIEKVEKKVEAK* |
Ga0114962_100674545 | 3300009151 | Freshwater Lake | MIIEIFCYGFITAFGWWTANHYVIEPHFPPSVLEQKEEAKKK* |
Ga0114962_100773362 | 3300009151 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYLPPPMERKVEEKKDDKK* |
Ga0114962_101069683 | 3300009151 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKENSK* |
Ga0114962_101111772 | 3300009151 | Freshwater Lake | MVIEYIVIGFLSALGWWGANHYVIEPYFPPPIIKQEVKKDDEKNSK* |
Ga0114962_101174193 | 3300009151 | Freshwater Lake | MMILEIFVAGMITAFGWWTSTHYIIEPYFPAPIERADAKKTIDASKD* |
Ga0114962_101301903 | 3300009151 | Freshwater Lake | MILEILAYGFITAFGWWGANHYVIEPYFPPPIERKVETKEQPKKE* |
Ga0114962_101482863 | 3300009151 | Freshwater Lake | MIIEYIIIGFLSAIGWWGANHYVIEPYFPPPIETKKEK* |
Ga0114962_102642512 | 3300009151 | Freshwater Lake | MVLEIFLAGMITAFGWWTSTHYIIEPYFPPPIEKKVESK* |
Ga0114962_103640312 | 3300009151 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKEAKKDDKK* |
Ga0114962_104751731 | 3300009151 | Freshwater Lake | MILEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKAEQK* |
Ga0114962_106154711 | 3300009151 | Freshwater Lake | MIILEGVVYGFITAFGWWGANHYVNEPYLHPPIERKEAKKDDKK* |
Ga0114962_106207082 | 3300009151 | Freshwater Lake | MILEIFVAGIITAFGWWTANHYVIEPYFPPPIEKKVEDK* |
Ga0114962_106602912 | 3300009151 | Freshwater Lake | MIIEIFLAGMITAFGWWTSNHYIIEPYFPPPVERKVNDRQ* |
Ga0114980_100175224 | 3300009152 | Freshwater Lake | MEMILEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKENSK* |
Ga0114980_104512242 | 3300009152 | Freshwater Lake | MIIEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKAEQK* |
Ga0114963_101400223 | 3300009154 | Freshwater Lake | IFVAGMITAFGWWTSTHYIIEPYFPPPIERKAEDKK* |
Ga0114963_102330532 | 3300009154 | Freshwater Lake | MVLEIFVAGMITAFGWWTANHYVIEPYFPPPIEKKVEDK* |
Ga0114963_102419284 | 3300009154 | Freshwater Lake | MIVEIFLYGFITAFGWWSATHYVIEPYFPPPIEKKVEQK* |
Ga0114963_104187242 | 3300009154 | Freshwater Lake | MIILEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKEAKKDDKK* |
Ga0114968_100097497 | 3300009155 | Freshwater Lake | MVLEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKAEQK* |
Ga0114968_100603014 | 3300009155 | Freshwater Lake | MGILEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKVEEKKDDKK* |
Ga0114968_105084902 | 3300009155 | Freshwater Lake | MIIEIFLAGMITAFGWWTSTHYIIEPYFPPPIERKVNDRQ* |
Ga0114968_105736971 | 3300009155 | Freshwater Lake | MEMILEVIVYGFFTAFGWWGANHYVIEPYFPPPMEKKENSK* |
Ga0114977_100018014 | 3300009158 | Freshwater Lake | MILEIFVAGMITAFGWWTSTHYIIEPYFPPPIEKKVEQK* |
Ga0114977_101986483 | 3300009158 | Freshwater Lake | VLEIVMWGFLSAFGWWGAQHYVIEPYFPPPIEKKETK* |
Ga0114978_100006371 | 3300009159 | Freshwater Lake | SMIFEVFLYGFITAFGWWSAQHYVIEPHFPPPIEKKVEK* |
Ga0114978_100084607 | 3300009159 | Freshwater Lake | MVLELFLAGMISALGWWTSNHYIIEPHFPPPIERKKEEKK* |
Ga0114978_100233931 | 3300009159 | Freshwater Lake | MIVEIFFYGFITAFGWWSANHYVIEPYFPPPIEKKVDLN* |
Ga0114978_101014762 | 3300009159 | Freshwater Lake | MILEIFCYGFISAFGWWTANHYVIEPHFPPAIEKKVQKDD* |
Ga0114978_101092923 | 3300009159 | Freshwater Lake | MIAEIFLYGFITAFGWWTANHYVIEPHFPPPIEKKINDK* |
Ga0114978_101123924 | 3300009159 | Freshwater Lake | MVLEILLYGFITAFGWWGANHYVIEPYFPPPIERKEDNK |
Ga0114978_101536132 | 3300009159 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPMERKVEEKKEKKDDKK* |
Ga0114978_102088023 | 3300009159 | Freshwater Lake | MVLEIVMWGFLSAFGWWGANHYVIEPYFPPPIEKKESK* |
Ga0114978_107263782 | 3300009159 | Freshwater Lake | MGIAEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKKEETK* |
Ga0114978_108193091 | 3300009159 | Freshwater Lake | MFVYNTSMVIEIFLYGFITAFGWWSATHYVIEPYFPPPIEKQVEKSK* |
Ga0114981_106787302 | 3300009160 | Freshwater Lake | MVLEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKVEQK* |
Ga0114981_107464072 | 3300009160 | Freshwater Lake | MVLEIVMWGFLSAFGWWGANHYVIEPYFPPPIEKKETK* |
Ga0114966_100810812 | 3300009161 | Freshwater Lake | MILEIFVAGMITAFGWWTATHYVIEPHFPPPIEKKVESK* |
Ga0114966_102843983 | 3300009161 | Freshwater Lake | MVLEIFLAGMITAFGWWTSNHYIIEPYFPPPIERKKEENK* |
Ga0114970_100112331 | 3300009163 | Freshwater Lake | MILEIFVAGMITAFGWWTANHYVIEPYFPPPIEKKVEQK* |
Ga0114970_100310926 | 3300009163 | Freshwater Lake | MVLEWIVVGFFSAIGWWSANHYVIEPYFPPPIEKTEKKEK* |
Ga0114970_100846031 | 3300009163 | Freshwater Lake | QMIVEIFLYGFISAFGWWSATHYVIEPHFPPSIEKKAEQK* |
Ga0114975_1000004953 | 3300009164 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYVIEPYFPPSIEKKEESKK* |
Ga0114975_1000178616 | 3300009164 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPMERKVEEKKEKKEDKK* |
Ga0114975_1000554915 | 3300009164 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKVEKKDDQK* |
Ga0114975_1000735514 | 3300009164 | Freshwater Lake | VILEIFLYGFITAFGWWSANHYVIEPYFPPPIEKAESKNKEKQKEN* |
Ga0114975_100081561 | 3300009164 | Freshwater Lake | MIIEIFFYGFVTAFGWWSANHYVIEPYFPPPIERKVEDK* |
Ga0114975_100094557 | 3300009164 | Freshwater Lake | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKVEKKDGQK* |
Ga0114975_100139632 | 3300009164 | Freshwater Lake | MIIEIFLYGFITAFGWWTATHYVIEPYFPPAIERPAEKK* |
Ga0114975_100214143 | 3300009164 | Freshwater Lake | MILEVFLYGFITAFGWWSANHYVIDPYFPAPIEKVESKNKEKQKEN* |
Ga0114975_100386532 | 3300009164 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKKEEKKDDKK* |
Ga0114975_103140373 | 3300009164 | Freshwater Lake | MIIEIFCYGFITAFGWWTANHYVIEPHFPPSVLEQKEEVKKK* |
Ga0114975_106901152 | 3300009164 | Freshwater Lake | MIIEIFFAGFITAFGWWTATHYVIEPHFPPPIEKKVEK* |
Ga0114975_107748722 | 3300009164 | Freshwater Lake | MMILEILTYGFITAFGWWGANHYVIEPYFPPPIERKEEKKNEK* |
Ga0114979_100545076 | 3300009180 | Freshwater Lake | VNKMIIEYILIGFLSAIGWWGATHYVIEPYFPPPLERKVEEKKEEKK* |
Ga0114979_100565675 | 3300009180 | Freshwater Lake | MILEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQK* |
Ga0114979_104152782 | 3300009180 | Freshwater Lake | MMVLEIICYGFITAFGWWAANHYVIEPYFPPPIEKKINEK* |
Ga0114979_108625823 | 3300009180 | Freshwater Lake | MIIEYILIGFLSAIGWWGATHYVIEPYFPPPIERKVEEKKDDKK* |
Ga0114969_100578393 | 3300009181 | Freshwater Lake | MILEVFLYGFITAFGWWSANHYVIDPYFPPPIEKVESKNKEKQKEN* |
Ga0114969_103461994 | 3300009181 | Freshwater Lake | MEMILEVIVYGFFTAFGWWGANHYVIEPYFPPPMEKKEN |
Ga0114969_105764661 | 3300009181 | Freshwater Lake | MIVEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKAEQK* |
Ga0114959_1000325235 | 3300009182 | Freshwater Lake | MILEIFCYGFISAFGWWTANHYVIEPHFPPAIEKKVEKND* |
Ga0114959_100133964 | 3300009182 | Freshwater Lake | MIFEALLFGFFSAFGWWGANHYAIEPHFPPPIERKEEKKDESK* |
Ga0114959_100255306 | 3300009182 | Freshwater Lake | MKGHTMGILEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKDIKAEEKKDDKK* |
Ga0114959_101004262 | 3300009182 | Freshwater Lake | MILEIFAYGFITAFGWWSATHYVIEPYFPPPIEKVEKKVEAK* |
Ga0114959_101439322 | 3300009182 | Freshwater Lake | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKEEKKDDKK* |
Ga0114959_101453902 | 3300009182 | Freshwater Lake | MGILEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKEEKKDDKK* |
Ga0114959_102018871 | 3300009182 | Freshwater Lake | YGFFTAFGWWGANHYVIEPYFPPPLERKVEDKKDDKK* |
Ga0114974_101254902 | 3300009183 | Freshwater Lake | MLLEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKETK* |
Ga0114974_103193852 | 3300009183 | Freshwater Lake | MVLELFLAGMISALGWWTSNHYIIEPHLPPPIERKKEEKK* |
Ga0114974_105240772 | 3300009183 | Freshwater Lake | MIIEIFLYGFITAFGWWSATHYVIEPYFPPPIEKKVEQK* |
Ga0114974_106581561 | 3300009183 | Freshwater Lake | MILEVFLYGFITAFGWWSANHYVIDPYFPAPIEKVES |
Ga0114971_106621302 | 3300009185 | Freshwater Lake | MVLEILLYGFITAFGWWGANHYVIEPYFPPPIERKEDNKQETTERK* |
Ga0103848_10018524 | 3300009218 | River Water | MILNVIVYGFFTAFGWWGANHYVIEPYFPEPVKKEVKNADK* |
Ga0114951_104813222 | 3300009502 | Freshwater | MVVELLIAGFFSAIGWWGANHYVIEPYLPPPIERKEV |
Ga0114964_100035023 | 3300010157 | Freshwater Lake | MILEIFVAGMITAFGWWTSTHYIIEPYFPPPVERKADKKEEDKK* |
Ga0114964_100141171 | 3300010157 | Freshwater Lake | MILEIFVAGMITAFGWWTSTHYIIEPYFPPPIERKAEDKK* |
Ga0114964_100373214 | 3300010157 | Freshwater Lake | MIIEIFCYGFITAFGWWTANHYVIEPHFPPSVLEQKEDHKK* |
Ga0114964_102879622 | 3300010157 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKKDDTK* |
Ga0114964_103735552 | 3300010157 | Freshwater Lake | MILEIFVAGMITAFGWWTANHYVIEPYFPPPIEKKAEQK* |
Ga0114967_100005717 | 3300010160 | Freshwater Lake | VILEVFLYGFITAFGWWSANHYVIEPYFPPPIEKVESKNKEKQKEN* |
Ga0114967_100197805 | 3300010160 | Freshwater Lake | MVLEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKVEQK* |
Ga0114967_101418824 | 3300010160 | Freshwater Lake | IMGIVEVIVYGFFTAFGWWGANHYVIEPHFPPPIERKEEKKEDKK* |
Ga0114967_101724153 | 3300010160 | Freshwater Lake | MIVLEIICYGFITAFGWWGANHYVIEPYFPPPIEKKIDAK* |
Ga0136644_101250912 | 3300010334 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPLERKVEDKKDDKK* |
Ga0136644_102284462 | 3300010334 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPAIERKDEKKE* |
Ga0136644_107094302 | 3300010334 | Freshwater Lake | MILQVFLYGFITAFGWWSANHYVIEPYFPPPIEKVESKNKEKQKEN* |
Ga0129333_102008982 | 3300010354 | Freshwater To Marine Saline Gradient | MVLEVVLWGFLSAFGWWGANHYVIEPYFPPPIEKKKEDK* |
Ga0133913_1002976715 | 3300010885 | Freshwater Lake | MILEVFLYGFITAFGWWSAQHYVIEPHFPPPIEKKVEK* |
Ga0133913_1007323412 | 3300010885 | Freshwater Lake | MILEIFCYGFISAFGWWTANHYVIEPHFPPAIEKKVEEK* |
Ga0133913_101950606 | 3300010885 | Freshwater Lake | MGIAEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKKEEAK* |
Ga0133913_105954187 | 3300010885 | Freshwater Lake | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKKEDIK* |
Ga0133913_106210034 | 3300010885 | Freshwater Lake | MIIEIFLAGMITAFGWWTATHYVIEPHFPPPIEKKAEQK* |
Ga0133913_108632255 | 3300010885 | Freshwater Lake | MVLEIFFAGIITALGWWTGNHYIIEPYFPDPIVKEKKADASGASKD* |
Ga0133913_108942612 | 3300010885 | Freshwater Lake | MIIEIFCYGFITAFGWWTANHYVIEPHFPPSVLEQKEDKKK* |
Ga0133913_109273752 | 3300010885 | Freshwater Lake | MILEIFVAGMITAFGWWTATHYVIEPYFPPPIEKKVEQK* |
Ga0133913_110030914 | 3300010885 | Freshwater Lake | MVLEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKVENK* |
Ga0133913_111486642 | 3300010885 | Freshwater Lake | VVLEIFMYGFITAFGWWSANHYVIEPHFPPPIEKKVETKEQAK* |
Ga0133913_114099562 | 3300010885 | Freshwater Lake | MMIVEIFFYGFITAFGWWSANHYVIEPYFPPPIEKKVDLN* |
Ga0133913_115158964 | 3300010885 | Freshwater Lake | MILEIFVAGMITAFGWWTATHYVIEPHFPPPIEKKVEQK* |
Ga0133913_117192483 | 3300010885 | Freshwater Lake | MVLEIFVAGIITAFGWWTANHYVIEPYFPPPIEKKAEDK* |
Ga0133913_118109953 | 3300010885 | Freshwater Lake | VIIEIFLYGFITAFGWWTANHYVIEPHFPPSIEKKDK* |
Ga0133913_118830124 | 3300010885 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYVIEPYFPPQIEKKVEEKK* |
Ga0133913_119064753 | 3300010885 | Freshwater Lake | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKKEDVK* |
Ga0133913_125043683 | 3300010885 | Freshwater Lake | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPAIERKETEK* |
Ga0133913_130719222 | 3300010885 | Freshwater Lake | MVIEIFLYGFITAFGWWTANHYVIEPHFPPSVLEQKEEPKKK* |
Ga0133913_135205322 | 3300010885 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPLERKAEEKKDDKK* |
Ga0133913_136367062 | 3300010885 | Freshwater Lake | MVIEIFLYGFITAFGWWSATHYVIEPYFPPPIEKQVEKSK* |
Ga0139557_10481041 | 3300011010 | Freshwater | MVIEIFMYGFITAFGWWTANHYVIEPHFPPSVLEKKEEVKKNS |
Ga0151517_100188 | 3300011113 | Freshwater | MILEIFLAGMITAFGWWTSTHYIIEPYFPPPIEKKVEQK* |
Ga0151620_11885102 | 3300011268 | Freshwater | MILEIFMYGFITAFGWWSANHYVIEPYFPPPIEKVESKNKEKQKEN* |
Ga0153800_10175422 | 3300011995 | Freshwater | MVIEIFMYGFITAFGWWTANHYVIEPHFPPSLLEKKEEVKKNSN* |
Ga0119951_10407332 | 3300012000 | Freshwater | MILEVFLYGFITAFGWWSANHYVIEPYFPPPIEKVESKNKEKQKEN* |
Ga0119951_11488072 | 3300012000 | Freshwater | MIIEIFFYGFVTAFGWWSANHYVIEPHFPPPIERKKEETK* |
Ga0157203_10080366 | 3300012663 | Freshwater | MILEVFLYGFITAFGWWSANHYVIDPYFPPPIEKVESKNKAKQKEN* |
Ga0157203_10094973 | 3300012663 | Freshwater | MIFEIFLYGFITAFGWWGANHYVIDPYFPPPIERKDEKKDDKK* |
Ga0157203_10619721 | 3300012663 | Freshwater | MILEIFMYGFITAFGWWSANHYVIEPYFPPPIEKVESKNKVKQKEN* |
Ga0164293_107082182 | 3300013004 | Freshwater | MFEILVWGFFSAFGWWGANHYVIEPYFPPPIERKKEDVK* |
Ga0164292_101129105 | 3300013005 | Freshwater | MFEILVWGFFSAFGWWGANHYVIGPYFPPPIERKKEDVK* |
Ga0164294_100205687 | 3300013006 | Freshwater | MIVEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQK* |
Ga0164294_100492833 | 3300013006 | Freshwater | MILEIFLYGFISAFGWWSATHYVIEPHFPPSIEKKAEQK* |
Ga0164294_103874852 | 3300013006 | Freshwater | MGILEVVVYGFFTAFGWWGANHYVIEPHFPPPIERKKEEKKDDKK* |
Ga0164295_100271365 | 3300013014 | Freshwater | MVLEIFLYGFISAFGWWSATHYVIEPHFPPSIEKKAEQK* |
Ga0136642_100078817 | 3300013285 | Freshwater | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKEESKNERSKEK* |
Ga0136642_10021309 | 3300013285 | Freshwater | MIVELLLYGFITAFGWWGANHYVIEPYFPPPIERKQEIKKE* |
Ga0136641_10115014 | 3300013286 | Freshwater | MILQIFVAGMITAFGWWTATHYVIEPHFPPPIEKKAEQK* |
Ga0136641_10669382 | 3300013286 | Freshwater | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPMERKVEEKKDDKK* |
Ga0136641_11999032 | 3300013286 | Freshwater | MGILEVVVYGFFTAFGWWSANHYVIEPYFPPPIERKVEEKKADTK* |
Ga0177922_101352502 | 3300013372 | Freshwater | MFEIFIWGFVSAFGWWGANHYVIEPYFPPPIERKKEDVK* |
Ga0177922_104608322 | 3300013372 | Freshwater | MLVEMLLYGFISAFGWWGANHYIIEPYFPPPTEESKKIKKE* |
Ga0181347_11159522 | 3300017722 | Freshwater Lake | MVLEIFLYGFITAFGWWTATHYVIEPHFPLPIEKKADQK |
Ga0181347_11628303 | 3300017722 | Freshwater Lake | MILEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQK |
Ga0181343_11620662 | 3300017766 | Freshwater Lake | MIFEFLVYGFISAFGWWGANHYVIEPYFPPPIEKKEEKK |
Ga0181343_11988722 | 3300017766 | Freshwater Lake | MIIEIVMWGFLSAFGWWGANHYVIEPYFPPPIERKKEDAK |
Ga0181346_12454583 | 3300017780 | Freshwater Lake | MVFEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQ |
Ga0181348_10788174 | 3300017784 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYVIEPYFPSPIEKKVDEKK |
Ga0181355_10781674 | 3300017785 | Freshwater Lake | VLEIFLYGFIIAFGWWTATHYVIEPHFPLPIEKKAEQK |
Ga0181563_107640052 | 3300018420 | Salt Marsh | MVAEIIVAGFLSAIGWYGANHFVIEPYFPPPIERKKEKANENS |
Ga0187844_101605522 | 3300018868 | Freshwater | MIIEIFLYGFITAFGWWTATHYVIEPYFPPAIERPAEKK |
Ga0187843_101496283 | 3300019093 | Freshwater | MVLEIFLAGMITAFGWWTSTHYIIEPYFPPPIEKKTEQK |
Ga0181359_10055162 | 3300019784 | Freshwater Lake | MIIEIFFAGFITAFGWWTATHYVIEPHFPPPIEKKAEQK |
Ga0181359_10236053 | 3300019784 | Freshwater Lake | MVLEIVMWGFLSAFGWWGAQHYVIEPYFPPPIEKKETK |
Ga0181359_10654803 | 3300019784 | Freshwater Lake | MVFEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQK |
Ga0181359_11052023 | 3300019784 | Freshwater Lake | MVLEIFLYGFITAFGWWTATHYVIEPHFPLPIEKKAEQK |
Ga0181359_11381632 | 3300019784 | Freshwater Lake | MVLEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQK |
Ga0211732_12727293 | 3300020141 | Freshwater | VYGFFTAFGWWGANHYVIEPYLPPPIERKKEEKKDDKK |
Ga0211736_105609994 | 3300020151 | Freshwater | TAFGWWGANHYVIEPYFPPPIERKEEKKDEKKNGQ |
Ga0211736_109884896 | 3300020151 | Freshwater | MIVEIFLYGFISAFGWWSATHYVIEPHFPPPIEKKAEQK |
Ga0211733_103802777 | 3300020160 | Freshwater | MILEIFLYGFITAFGWWSANHYIIEPYFPPPIERKAEEK |
Ga0211733_110079484 | 3300020160 | Freshwater | MGILEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKKEEKKDDKK |
Ga0211726_1091215311 | 3300020161 | Freshwater | MILEVIVYGFFTAFGWWGANHYVIEPYFPPPMEKKENSK |
Ga0211726_109836662 | 3300020161 | Freshwater | MMVLEIICYGFITAFGWWGANHYVIEPYFPPPIEKKINEK |
Ga0211735_107096852 | 3300020162 | Freshwater | MIVEIFLYGFISAFGWWSATHYVIEPHFPPPIEKKTEQK |
Ga0211729_103733662 | 3300020172 | Freshwater | MILEVIVYGFFTAFGWWGANHYVIEPYFPPPMENKENSK |
Ga0211729_105862873 | 3300020172 | Freshwater | MVLEIFLYGFISAFGWWGATHYVIEPHFPPPIEKKKAEQK |
Ga0214206_100084215 | 3300021131 | Freshwater | MILEVFIAGVITALGWWTSNHYIIEPYFPPPIERKEKE |
Ga0214206_10070732 | 3300021131 | Freshwater | MVVEYIVIGFLSALGWWGANHYIIEPYAPPPIERKKDEVK |
Ga0214206_10106332 | 3300021131 | Freshwater | MVLEIFFAGIITALGWWTGNHYIIEPYFPDPIVKEKKVEDK |
Ga0194047_102730752 | 3300021354 | Anoxic Zone Freshwater | MIIEIFVAGMITAFGWWTATHYVIEPHFPPPIEKKVESK |
Ga0194117_100097514 | 3300021424 | Freshwater Lake | MILEIVMWGFFSALGWWGAQHYIIEPYLPPPMERKDERPKETERKL |
Ga0194048_100159766 | 3300021519 | Anoxic Zone Freshwater | MVLEILLYGFVTAFGWWGANHYVIEPYFPPPIEKKIEQK |
Ga0194048_101185214 | 3300021519 | Anoxic Zone Freshwater | MIVEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKAEQK |
Ga0194048_101460612 | 3300021519 | Anoxic Zone Freshwater | MILEVFVYGFITAFGWWSATHYVIEPYFPPPIEKLEKKVEAK |
Ga0194048_101504252 | 3300021519 | Anoxic Zone Freshwater | MGIVEVIVYGFFTAFGWWGANHYVIEPHFPPPIERKEEKKEDKK |
Ga0194048_103757061 | 3300021519 | Anoxic Zone Freshwater | MILEILAYGFITAFGWWGANHYVIEPYFPPPIERKVETKEQPKKE |
Ga0213922_10234295 | 3300021956 | Freshwater | MTILTVVVYGFFTAFGWWGAQHYVIEPYFPEPIKKEVKNGDQ |
Ga0222715_104754112 | 3300021960 | Estuarine Water | MILEILAYGFFSAFGWWAANHYVIEPHFPPPIEKKIEEDKKDK |
Ga0222714_100822277 | 3300021961 | Estuarine Water | MVFEVVLWGFLSAFGWWGAQHYVIEPYFPPPIEKKTDKKAE |
Ga0222714_102002902 | 3300021961 | Estuarine Water | MIVEIFLYGFITAFGWWTANHYVIEPYFPPPVEQVEKKTEGKK |
Ga0222714_106349432 | 3300021961 | Estuarine Water | MILEIFMYGFITAFGWWSANHYVIEPYFPPAIERKKEESK |
Ga0222713_104671241 | 3300021962 | Estuarine Water | MVIEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEEKNGLDP |
Ga0222712_102149542 | 3300021963 | Estuarine Water | MIAELLLYGFITAFGWWGANHYVIEPYFPPPIERKKEETK |
Ga0181351_10777554 | 3300022407 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYVIEPYFPSPIEKKVEEKK |
Ga0181351_12612882 | 3300022407 | Freshwater Lake | MIVEIFLYGFISAFGWWSATHYVIEPHFPPSIEKKAEQK |
Ga0236341_10086769 | 3300022591 | Freshwater | MVLEIFVAGMITAFGWWTSNHYIIEPYFPPPIERKDDTSTKH |
Ga0236341_10103875 | 3300022591 | Freshwater | MVVEYIFIGFLSALGWWGANHYVIEPYAPPPIERKKDEVK |
Ga0236340_10395822 | 3300022594 | Freshwater | MMVLEIFVAGMITAFGWWTSTHYIIEPYFPAPIERADAKKTTDASKD |
Ga0228702_10163224 | 3300022748 | Freshwater | MIIEIFLYGFITAFGWWTANHYIIEPHFPPPIEKKQEEK |
Ga0214917_10000002288 | 3300022752 | Freshwater | MIVEIFLYGFISAFGWWTATHYVIEPHFPPSIEKKAEQK |
Ga0214917_104515503 | 3300022752 | Freshwater | MILEIFLFGFISAFGWWTANHYIIDPHFPPPIEKKAEEKK |
Ga0214921_10000015235 | 3300023174 | Freshwater | MILEVFLYGFITAFGWWSANHYVIEPYFPPPIEKVESKNKEKQKEN |
Ga0214921_100404296 | 3300023174 | Freshwater | MVLEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKVEQK |
Ga0214921_100783245 | 3300023174 | Freshwater | MIIEIFFAGFITAFGWWTATHYVIEPHFPPPIEKKVEQK |
Ga0214921_101523303 | 3300023174 | Freshwater | MIIEIFFYGFVTAFGWWSANHYVIEPHFPPPIERKKEETK |
Ga0214921_102987802 | 3300023174 | Freshwater | MIVEFLLYGFISAFGWWTANHYVIEPYFPPPIEKKVEEKK |
Ga0214921_104156412 | 3300023174 | Freshwater | MMILEIFVAGMITAFGWWTSTHYIIEPYFPPPVEKKVEQK |
Ga0214921_104465223 | 3300023174 | Freshwater | MVLEIVLWGFLSAFGWWGANHYVIEPYFPPPIEKKKEDK |
Ga0214923_100209966 | 3300023179 | Freshwater | MILEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKENSK |
Ga0214919_1000278820 | 3300023184 | Freshwater | MIVEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKVEKNDTSK |
Ga0214919_1001744414 | 3300023184 | Freshwater | MILEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKEQNGK |
Ga0214919_100509575 | 3300023184 | Freshwater | MVLEIFLAGMITAFGWWTSTHYIIEPYFPPPIEKKVEQK |
Ga0214919_100651834 | 3300023184 | Freshwater | MVLEILLYGFISAFGWWGANHYVIEPYFPPAIEKKEDK |
Ga0214919_101174961 | 3300023184 | Freshwater | MIIEIFVAGMITAFGWWTSTHYIIEPYFPPPVEKKVEQK |
Ga0214919_101879623 | 3300023184 | Freshwater | MIIEIFCYGFITAFGWWTANHYVIEPYFPPAIEKKVEEK |
Ga0214919_102090124 | 3300023184 | Freshwater | MVEIFIYGFISAFGWWTANHYIIEPHFPPAIEKKEEKKEKSNEK |
Ga0214919_104719382 | 3300023184 | Freshwater | MEMILEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKENSK |
Ga0256681_107896892 | 3300023311 | Freshwater | MVLEIFVAGMITAFGWWTATHYVIEPYFPEPIVKEKKVEQK |
Ga0255147_100016117 | 3300024289 | Freshwater | MVLEIFFYGFVTAFGWWSANHYVIEPYFPPPIERKKEEVKKENP |
Ga0255147_100124914 | 3300024289 | Freshwater | MVIEIVMWGFLSAFGWWGANHYVIEPYFPPPIEKKKEDNGIDSK |
Ga0255147_10018654 | 3300024289 | Freshwater | MILEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEEKNGLDPK |
Ga0255147_10804462 | 3300024289 | Freshwater | MILEYIFIGFLSALGWWGANHYVIEPYAPPPIERKKEEK |
Ga0255178_100049325 | 3300024298 | Freshwater | MVIEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEEKNGLDPK |
Ga0244775_110909922 | 3300024346 | Estuarine | MVLEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEEVK |
Ga0244775_113597101 | 3300024346 | Estuarine | MIIEIFLYGFISAFGWWSATHYVIEPHFPPPIEKKAEQK |
Ga0244776_108974751 | 3300024348 | Estuarine | VFLYGFITAFGWWSANHYVIDPYFPPPIEKVQSKNKEKQKEN |
Ga0255141_10319941 | 3300024351 | Freshwater | EIMILEYIFIGFLSALGWWGANHYVIEPYAPPPIERKKEEK |
Ga0208250_10064293 | 3300025383 | Freshwater | MIIEWTLIGFFSALGWWGANHYVIEPYFPPPIEIKEEK |
Ga0208622_10302721 | 3300025430 | Freshwater | MGIAEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKDET |
Ga0208103_10489211 | 3300025436 | Freshwater | MIIEIFLAGMITAFGWWTSTHYIIEPYFPPPIERKDGTPTK |
Ga0208613_10358823 | 3300025616 | Freshwater | MILEIFVAGIITAFGWWTANHYVIEPHFPPPIEKKVEQK |
Ga0208613_10362192 | 3300025616 | Freshwater | MIIEIFLAGMITAFGWWTSTHYIIEPYFPPPIERKNDTSTK |
Ga0208613_10620852 | 3300025616 | Freshwater | MVLEIFVAGMITAFGWWTANHYVIEPYFPPPIEKKVEQK |
Ga0208784_10558722 | 3300025732 | Aqueous | MAILTVVVYGFFTAFGWWGAQHYVIEPYFPEPIKKEAKTNE |
Ga0208499_10745832 | 3300025789 | Freshwater | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKEERNDRT |
Ga0208644_13617821 | 3300025889 | Aqueous | MILEIIAWGFFSAFGWWGAQHYVIEPYFPPPIERKQEKNLTTESK |
Ga0255090_10218623 | 3300027123 | Freshwater | MIVELLLYGFITAFGWWGANHYVIEPYFPPPMERKKEETK |
Ga0255107_10347153 | 3300027136 | Freshwater | VVVYGFFTAFGWWGANHYVIEPYFPPKIERKVEKKDDQK |
Ga0208966_100000881 | 3300027586 | Freshwater Lentic | MIVEIFLYGFITAFGWWTAQHYVIEPHFPPPIEKKVEK |
Ga0208966_10017732 | 3300027586 | Freshwater Lentic | MILEVIVYGFFTAFGWWGANHYIIEPYFPPPIEKKEDSKK |
Ga0208966_10247175 | 3300027586 | Freshwater Lentic | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKEEKKNEK |
Ga0255079_10314034 | 3300027601 | Freshwater | LLLYGFITAFGWWGANHYVIEPYFPPPMERKKEETK |
Ga0208974_10160103 | 3300027608 | Freshwater Lentic | MVEIFLYGFISAFGWWTANHYIIEPHFPPAVEKKEEKKEKPNEK |
Ga0208974_10981402 | 3300027608 | Freshwater Lentic | MILEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKVEEKK |
Ga0208975_12176242 | 3300027659 | Freshwater Lentic | MILEIFLYGFITAFGWWTANHYVIEPHFPPSVVEKKEDKK |
Ga0209769_11743582 | 3300027679 | Freshwater Lake | MVFLEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKKEESK |
Ga0209188_100004160 | 3300027708 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYVIEPYFPESKKIERKKDD |
Ga0209188_1000121134 | 3300027708 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPQPIERKEESKNERSKEK |
Ga0209188_10020994 | 3300027708 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYLPPPMERKVEEKKDDKK |
Ga0209188_10024494 | 3300027708 | Freshwater Lake | MVLEIFVAGMITAFGWWTANHYVIEPYFPPPIEKKVEDK |
Ga0209188_10182112 | 3300027708 | Freshwater Lake | MMILEIFVAGMITAFGWWTSTHYIIEPYFPPPIEKKETK |
Ga0209188_10302734 | 3300027708 | Freshwater Lake | MIILEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKEAKKDDKK |
Ga0209188_10320344 | 3300027708 | Freshwater Lake | MIFEALLFGFFSAFGWWGANHYAIEPHFPPPIERKEEKKDESK |
Ga0209188_10389614 | 3300027708 | Freshwater Lake | MILEIFCYGFISAFGWWTANHYVIEPHFPPAIEKKVEKND |
Ga0209188_10770192 | 3300027708 | Freshwater Lake | MGILEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKEEKKDDKK |
Ga0209188_11040642 | 3300027708 | Freshwater Lake | MIIEYIIIGFLSAIGWWGANHYVIEPYFPPPIETKKEK |
Ga0209188_11058271 | 3300027708 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKDIKAEEKKMIKNDLLHRDI |
Ga0209188_12334493 | 3300027708 | Freshwater Lake | MIVEIFLYGFITAFGWWSATHYVIEPYFPPPIEKKVEQK |
Ga0209188_12502322 | 3300027708 | Freshwater Lake | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKEEKKDDKK |
Ga0209188_12813451 | 3300027708 | Freshwater Lake | SMILQVFLYGFITAFGWWSANHYVIEPYFPPPIEKVESKNKEKQKEN |
Ga0209188_13025242 | 3300027708 | Freshwater Lake | MVLEILLYGFVTAFGWWGANHYVIEPYFPPPIEKKVEQK |
(restricted) Ga0247836_100529812 | 3300027728 | Freshwater | MIAEIFLYGFITAFGWWTANHYVIEPHFPPPIEKKINDK |
(restricted) Ga0247836_10766873 | 3300027728 | Freshwater | MILEIFLYGFISAFGWWSATHYVIEPHFPQPIEKKAEQK |
Ga0209297_10202573 | 3300027733 | Freshwater Lake | MILEIFVAGMITAFGWWTSTHYIIEPYFPPPIEKKVEQK |
Ga0209297_11730582 | 3300027733 | Freshwater Lake | MGILEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKVEEKKDDKK |
Ga0209297_12002361 | 3300027733 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYVIEPYFPPPIEKKENS |
Ga0209087_1000021176 | 3300027734 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPMERKVEEKKEKKEDKK |
Ga0209087_11914972 | 3300027734 | Freshwater Lake | MIIEIFFYGFVTAFGWWSANHYVIEPYFPPPIERKVEDK |
Ga0209087_12802162 | 3300027734 | Freshwater Lake | MGIAEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKKEE |
Ga0209190_10253233 | 3300027736 | Freshwater Lake | MIIEIFFAGFITAFGWWTATHYVIEPHFPPPIEKKVESK |
Ga0209190_10740384 | 3300027736 | Freshwater Lake | MIIEIFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQK |
Ga0209190_11771652 | 3300027736 | Freshwater Lake | MIVLEIICYGFITAFGWWGANHYVIEPYFPPPIEKKIDAK |
Ga0209190_12046633 | 3300027736 | Freshwater Lake | MVLEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKAEQK |
Ga0209085_100084134 | 3300027741 | Freshwater Lake | MVLEIFLAGMITAFGWWTSTHYIIEPYFPPPIEKKVESK |
Ga0209597_10000233 | 3300027746 | Freshwater Lake | MILEVFLYGFITAFGWWSANHYVIDPYFPPPIEKVESKNKEKQKEN |
Ga0209189_10446612 | 3300027747 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPLERKVEDKKDDKK |
Ga0209189_12406812 | 3300027747 | Freshwater Lake | MILEIFLYGFITAFGWWTANHYVIEPHFPPPIEKKEEK |
Ga0209189_12736722 | 3300027747 | Freshwater Lake | MVIEYIVIGFLSALGWWGANHYVIEPYFPPPIIKQEVKKDDEKNSK |
Ga0209084_10200262 | 3300027749 | Freshwater Lake | MGIAEVIVYGFFTAFGWWGANHYVIEPYFPPPVERKVEKKEDKK |
Ga0209084_10925262 | 3300027749 | Freshwater Lake | MILEIFVAGMITAFGWWTANHYVIEPYFPPPIEKKAEQK |
Ga0209084_11459501 | 3300027749 | Freshwater Lake | NERTHTMGILEVVVYGFFTAFGWWGANHYVIEPYLPPPMERKVEEKKDDKK |
Ga0209596_100032727 | 3300027754 | Freshwater Lake | MLLEVIIYGFFTAFGWWGANHYVIEPYFPPPIEKKETK |
Ga0209596_13663852 | 3300027754 | Freshwater Lake | LEIFVAGMITAFGWWTANHYVIEPYFPPPIEKKAEQK |
Ga0209444_103187302 | 3300027756 | Freshwater Lake | VFLEVVVYGFFTAFGWWGANHYVIEPYLPPPIERKKEESK |
Ga0209296_10018287 | 3300027759 | Freshwater Lake | MVLEIVMWGFLSAFGWWGANHYVIEPYFPPPIEKKESK |
Ga0209296_10097834 | 3300027759 | Freshwater Lake | MGIAEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKKEEAK |
Ga0209296_10246644 | 3300027759 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKVEKKDDQK |
Ga0209296_10441483 | 3300027759 | Freshwater Lake | MEMILEVIVYGFFTAFGWWGANHYVIEPYFPPPMEKKENSK |
Ga0209296_11143713 | 3300027759 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPMERKVEEKKEDKK |
Ga0209296_11458572 | 3300027759 | Freshwater Lake | VILEIFLYGFITAFGWWSANHYVIEPYFPPPIEKAESKNKEKQKEN |
Ga0209296_12975473 | 3300027759 | Freshwater Lake | ELFLAGMISALGWWTSNHYIIEPHLPPPIERKKEEKK |
Ga0209296_13867543 | 3300027759 | Freshwater Lake | MVLELFLAGMISALGWWTSNHYIIEPHLPPPIERKKEEKK |
Ga0209088_101717223 | 3300027763 | Freshwater Lake | VNKMIIEYILIGFLSAIGWWGATHYVIEPYFPPPLERKVEEKKEEKK |
Ga0209088_102363052 | 3300027763 | Freshwater Lake | MIIEIFLYGFITAFGWWSATHYVIEPHFPPPIEKKAEQK |
Ga0209088_103425431 | 3300027763 | Freshwater Lake | MIIEYILIGFLSAIGWWGATHYVIEPYFPPPIERKVEEKKDDKK |
Ga0209770_101797132 | 3300027769 | Freshwater Lake | MILEVFLYGFITAFGWWSANHYVIDPYFPPPIEKVESKNKAKQKEN |
Ga0209770_103048782 | 3300027769 | Freshwater Lake | MVLEIFLYGFISAFGWWSATHYVIEPHFPPPIEKKVENK |
Ga0209086_100683202 | 3300027770 | Freshwater Lake | MILEIFVAGMITAFGWWTATHYVIEPHFPPPIEKKVESK |
Ga0209829_103787732 | 3300027777 | Freshwater Lake | MMILEIFVAGMITAFGWWTSTHYIIEPYFPAPIERADAKKTIDASKD |
Ga0209500_100019236 | 3300027782 | Freshwater Lake | MILEVFLYGFITAFGWWSAQHYVIEPHFPPPIEKKVEK |
Ga0209500_101296133 | 3300027782 | Freshwater Lake | MGILEVVVYGFFTAFGWWGANHYVIEPYFPPPMERKVEEKKEKKDDKK |
Ga0209990_100570733 | 3300027816 | Freshwater Lake | MVLEIFLYGFISAFGWWSATHYVIEPHFPPPIEKKVEQK |
Ga0209550_104102922 | 3300027892 | Freshwater Lake | GSMIVEIFLYGFITAFGWWTAQHYVIEPHFPPPIEKKVEK |
Ga0209191_100023626 | 3300027969 | Freshwater Lake | MILEVIVYGFFTAFGWWGANHYVIEPYFPPSIEKKEESKK |
Ga0209191_100065842 | 3300027969 | Freshwater Lake | MGIAEVIVYGFFTAFGWWGANHYVIEPYFPPPIERKKEETK |
Ga0209191_10011204 | 3300027969 | Freshwater Lake | MGLLEVVVYGFFTAFGWWGANHYVIEPYFPPPIERKVEKKDGQK |
Ga0209191_10098318 | 3300027969 | Freshwater Lake | MILEVFLYGFITAFGWWSANHYVIDPYFPAPIEKVESKNKEKQKEN |
Ga0304729_1000001493 | 3300028392 | Freshwater Lake | MIIEIFFYGFVTAFGWWTANHYVIEPYFPPSVLEQREDKKKEDKKD |
Ga0304729_10097506 | 3300028392 | Freshwater Lake | MILEIFVAGMITAFGWWTSTHYIIEPYFPPPIERKAEDKK |
Ga0304729_10294602 | 3300028392 | Freshwater Lake | MIIEIFCYGFITAFGWWTANHYVIEPHFPPSVLEQKEDHKK |
Ga0304729_11073472 | 3300028392 | Freshwater Lake | MILEIFVAGMITAFGWWTSTHYIIEPYFPPPVERKADKKEEDKK |
Ga0304730_100002780 | 3300028394 | Freshwater Lake | VILEVFLYGFITAFGWWSANHYVIEPYFPPPIEKVESKNKEKQKEN |
Ga0315907_100456133 | 3300031758 | Freshwater | MVLEIFLYGFISAFGWWSATHYVIEPHFPPSVIEKKMEQQK |
Ga0315899_101333682 | 3300031784 | Freshwater | MIAEVILWGFFSAFGWWGAQHYIIEPYFPPPIERKQEKNLTSESK |
Ga0315908_107179051 | 3300031786 | Freshwater | MILEIVMWGFLSAFGWWGAQHYVIEPYFPPPIERKKEDVLNSK |
Ga0315900_111244283 | 3300031787 | Freshwater | MVLEIVMWGFLSAFGWWGANHYVIEPYFPPPIEKNQEKK |
Ga0315909_1000447326 | 3300031857 | Freshwater | MIIEIFLYGFISAFGWWTAQHYVIEPHFPPPIEKKEDKKQ |
Ga0315909_100184026 | 3300031857 | Freshwater | MILEIVMWGFLSAFGWWGAQHYVIEPYFPKHETKVEEVKTDKK |
Ga0315909_100588345 | 3300031857 | Freshwater | MIVELFLYGFITAFGWWTANHYVIEPYFPPPIERKQDEQK |
Ga0315901_102802154 | 3300031963 | Freshwater | MILEILAYGFFSAFGWWAANHYIIEPHFPPRIERKE |
Ga0315905_103748962 | 3300032092 | Freshwater | MVLEIVMWGFLSAFGWWGANHYVIEPYFPPPIEKKKAE |
Ga0315905_107103272 | 3300032092 | Freshwater | MKGSTMGILEVVIYGFFTAFGWWGANHYVIEPYLPPPIERKVEKKDDQK |
Ga0315903_106783102 | 3300032116 | Freshwater | MIAEVILWGFFSAFGWWGAQHYIIEPYFPPPIERK |
Ga0334995_0220983_1193_1300 | 3300034062 | Freshwater | IFLYGFITAFGWWTATHYVIEPHFPPPIEKKAEQK |
Ga0335010_0399048_155_274 | 3300034092 | Freshwater | MVLEIFLYGFISAFGWWSATHYVIEPHFPPPIEKKAEQK |
⦗Top⦘ |