Basic Information | |
---|---|
Family ID | F006087 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 382 |
Average Sequence Length | 43 residues |
Representative Sequence | QAAHAAIRSVCPTMDKDRVMYQDFARIAELIASGKVAAALR |
Number of Associated Samples | 293 |
Number of Associated Scaffolds | 382 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.26 % |
% of genes near scaffold ends (potentially truncated) | 98.95 % |
% of genes from short scaffolds (< 2000 bps) | 87.70 % |
Associated GOLD sequencing projects | 273 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.937 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.162 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.775 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.550 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 382 Family Scaffolds |
---|---|---|
PF01894 | UPF0047 | 10.47 |
PF01966 | HD | 10.21 |
PF14235 | DUF4337 | 4.19 |
PF01381 | HTH_3 | 3.66 |
PF02554 | CstA | 3.66 |
PF13519 | VWA_2 | 3.14 |
PF07179 | SseB | 3.14 |
PF09286 | Pro-kuma_activ | 2.09 |
PF13231 | PMT_2 | 1.57 |
PF13432 | TPR_16 | 1.31 |
PF13181 | TPR_8 | 1.05 |
PF11304 | DUF3106 | 0.79 |
PF07676 | PD40 | 0.79 |
PF13520 | AA_permease_2 | 0.79 |
PF16861 | Carbam_trans_C | 0.79 |
PF00218 | IGPS | 0.79 |
PF00072 | Response_reg | 0.52 |
PF00092 | VWA | 0.52 |
PF02446 | Glyco_hydro_77 | 0.52 |
PF01112 | Asparaginase_2 | 0.52 |
PF14581 | SseB_C | 0.52 |
PF14559 | TPR_19 | 0.52 |
PF01850 | PIN | 0.52 |
PF00202 | Aminotran_3 | 0.52 |
PF01797 | Y1_Tnp | 0.52 |
PF12867 | DinB_2 | 0.52 |
PF00561 | Abhydrolase_1 | 0.52 |
PF01541 | GIY-YIG | 0.26 |
PF02604 | PhdYeFM_antitox | 0.26 |
PF04471 | Mrr_cat | 0.26 |
PF00873 | ACR_tran | 0.26 |
PF13616 | Rotamase_3 | 0.26 |
PF05443 | ROS_MUCR | 0.26 |
PF00903 | Glyoxalase | 0.26 |
PF01041 | DegT_DnrJ_EryC1 | 0.26 |
PF02771 | Acyl-CoA_dh_N | 0.26 |
PF03712 | Cu2_monoox_C | 0.26 |
PF13570 | PQQ_3 | 0.26 |
PF03544 | TonB_C | 0.26 |
PF02371 | Transposase_20 | 0.26 |
PF01435 | Peptidase_M48 | 0.26 |
PF13714 | PEP_mutase | 0.26 |
PF03992 | ABM | 0.26 |
PF01408 | GFO_IDH_MocA | 0.26 |
PF16499 | Melibiase_2 | 0.26 |
PF05726 | Pirin_C | 0.26 |
PF01011 | PQQ | 0.26 |
PF00498 | FHA | 0.26 |
PF02517 | Rce1-like | 0.26 |
PF04325 | DUF465 | 0.26 |
PF13424 | TPR_12 | 0.26 |
PF07638 | Sigma70_ECF | 0.26 |
PF13473 | Cupredoxin_1 | 0.26 |
PF01411 | tRNA-synt_2c | 0.26 |
PF05063 | MT-A70 | 0.26 |
PF01476 | LysM | 0.26 |
PF13365 | Trypsin_2 | 0.26 |
PF13411 | MerR_1 | 0.26 |
COG ID | Name | Functional Category | % Frequency in 382 Family Scaffolds |
---|---|---|---|
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 10.47 |
COG1966 | Carbon starvation protein CstA (peptide/pyruvate transporter) | Energy production and conversion [C] | 3.66 |
COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 2.09 |
COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.79 |
COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.52 |
COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.52 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.52 |
COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 0.52 |
COG0013 | Alanyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.26 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.26 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.26 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.26 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.26 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.26 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.26 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.26 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.26 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.26 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.26 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.26 |
COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.94 % |
Unclassified | root | N/A | 18.06 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_104321183 | Not Available | 603 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105031982 | Not Available | 619 | Open in IMG/M |
3300001082|JGI12664J13189_1000189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8752 | Open in IMG/M |
3300001593|JGI12635J15846_10401500 | Not Available | 827 | Open in IMG/M |
3300001593|JGI12635J15846_10504845 | Not Available | 713 | Open in IMG/M |
3300001867|JGI12627J18819_10236365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 735 | Open in IMG/M |
3300001867|JGI12627J18819_10310172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100241066 | All Organisms → cellular organisms → Bacteria | 1697 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100488414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101754155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 521 | Open in IMG/M |
3300002911|JGI25390J43892_10122647 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300004091|Ga0062387_100421982 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300004091|Ga0062387_100518578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 836 | Open in IMG/M |
3300004091|Ga0062387_101525120 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300004479|Ga0062595_102574502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
3300004633|Ga0066395_10258271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 937 | Open in IMG/M |
3300005331|Ga0070670_100047804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3682 | Open in IMG/M |
3300005338|Ga0068868_102225153 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005353|Ga0070669_100340995 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300005435|Ga0070714_100473300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1192 | Open in IMG/M |
3300005435|Ga0070714_100836250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 892 | Open in IMG/M |
3300005445|Ga0070708_101177942 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300005468|Ga0070707_101889321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 564 | Open in IMG/M |
3300005518|Ga0070699_101480096 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300005526|Ga0073909_10485477 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300005529|Ga0070741_10091722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3271 | Open in IMG/M |
3300005529|Ga0070741_10199373 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
3300005529|Ga0070741_11035652 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300005539|Ga0068853_100909236 | Not Available | 845 | Open in IMG/M |
3300005541|Ga0070733_10202664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1297 | Open in IMG/M |
3300005542|Ga0070732_10691976 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300005543|Ga0070672_101404130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 624 | Open in IMG/M |
3300005546|Ga0070696_100303045 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
3300005547|Ga0070693_100799064 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300005560|Ga0066670_10438526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 804 | Open in IMG/M |
3300005564|Ga0070664_100195775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1802 | Open in IMG/M |
3300005575|Ga0066702_10018434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3346 | Open in IMG/M |
3300005575|Ga0066702_10390487 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300005577|Ga0068857_100921151 | Not Available | 839 | Open in IMG/M |
3300005591|Ga0070761_10062999 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
3300005591|Ga0070761_10272219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1015 | Open in IMG/M |
3300005712|Ga0070764_10840325 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005713|Ga0066905_100926181 | Not Available | 764 | Open in IMG/M |
3300005719|Ga0068861_100773965 | Not Available | 898 | Open in IMG/M |
3300005719|Ga0068861_101726135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 619 | Open in IMG/M |
3300005764|Ga0066903_101616043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1230 | Open in IMG/M |
3300006031|Ga0066651_10118149 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300006052|Ga0075029_100044007 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
3300006052|Ga0075029_101112705 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300006086|Ga0075019_10178182 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300006102|Ga0075015_100256829 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300006162|Ga0075030_100031730 | All Organisms → cellular organisms → Bacteria | 4508 | Open in IMG/M |
3300006172|Ga0075018_10810665 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300006173|Ga0070716_101226869 | Not Available | 603 | Open in IMG/M |
3300006174|Ga0075014_100617798 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300006176|Ga0070765_100611218 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300006176|Ga0070765_101459069 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300006237|Ga0097621_101007060 | Not Available | 779 | Open in IMG/M |
3300006794|Ga0066658_10393525 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300006796|Ga0066665_10080787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2335 | Open in IMG/M |
3300006796|Ga0066665_11453366 | Not Available | 533 | Open in IMG/M |
3300006797|Ga0066659_11494766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
3300006800|Ga0066660_11143129 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300006804|Ga0079221_11139982 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300006854|Ga0075425_102180905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 617 | Open in IMG/M |
3300006914|Ga0075436_100959810 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300007255|Ga0099791_10082538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1466 | Open in IMG/M |
3300007255|Ga0099791_10102254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
3300007265|Ga0099794_10586515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300009012|Ga0066710_103324391 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300009038|Ga0099829_10284360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1354 | Open in IMG/M |
3300009088|Ga0099830_10349770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1188 | Open in IMG/M |
3300009088|Ga0099830_10753880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
3300009089|Ga0099828_10884077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
3300009090|Ga0099827_11201525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300009093|Ga0105240_11539661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 697 | Open in IMG/M |
3300009098|Ga0105245_10222403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1822 | Open in IMG/M |
3300009101|Ga0105247_11723012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300009177|Ga0105248_10386124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
3300009520|Ga0116214_1029001 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1988 | Open in IMG/M |
3300009520|Ga0116214_1306702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300009521|Ga0116222_1052853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1769 | Open in IMG/M |
3300009522|Ga0116218_1154133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1043 | Open in IMG/M |
3300009545|Ga0105237_10601015 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300009551|Ga0105238_10065675 | All Organisms → cellular organisms → Bacteria | 3630 | Open in IMG/M |
3300009624|Ga0116105_1081972 | Not Available | 785 | Open in IMG/M |
3300009624|Ga0116105_1162544 | Not Available | 598 | Open in IMG/M |
3300009624|Ga0116105_1244476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 509 | Open in IMG/M |
3300009632|Ga0116102_1109110 | Not Available | 789 | Open in IMG/M |
3300009637|Ga0116118_1140773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
3300009640|Ga0116126_1069657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1317 | Open in IMG/M |
3300009645|Ga0116106_1184883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
3300010043|Ga0126380_10512010 | Not Available | 924 | Open in IMG/M |
3300010301|Ga0134070_10038166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1602 | Open in IMG/M |
3300010301|Ga0134070_10166373 | Not Available | 797 | Open in IMG/M |
3300010321|Ga0134067_10331446 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300010323|Ga0134086_10098666 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300010343|Ga0074044_10099080 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
3300010358|Ga0126370_11143807 | Not Available | 720 | Open in IMG/M |
3300010361|Ga0126378_10071693 | All Organisms → cellular organisms → Bacteria | 3321 | Open in IMG/M |
3300010362|Ga0126377_12839286 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 558 | Open in IMG/M |
3300010362|Ga0126377_13338989 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300010366|Ga0126379_10229842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1809 | Open in IMG/M |
3300010366|Ga0126379_11810812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 714 | Open in IMG/M |
3300010376|Ga0126381_100231802 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
3300010376|Ga0126381_103611630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 606 | Open in IMG/M |
3300010379|Ga0136449_100469163 | All Organisms → cellular organisms → Bacteria | 2200 | Open in IMG/M |
3300010379|Ga0136449_101562646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1005 | Open in IMG/M |
3300010396|Ga0134126_11486826 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300010396|Ga0134126_12250948 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300010397|Ga0134124_12132251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 599 | Open in IMG/M |
3300011269|Ga0137392_10630178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
3300011270|Ga0137391_10595044 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300011270|Ga0137391_11352908 | Not Available | 559 | Open in IMG/M |
3300011271|Ga0137393_10863803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300012096|Ga0137389_11773593 | Not Available | 513 | Open in IMG/M |
3300012189|Ga0137388_11375724 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300012202|Ga0137363_11696306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
3300012206|Ga0137380_10473607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1105 | Open in IMG/M |
3300012206|Ga0137380_10622849 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300012208|Ga0137376_10368054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
3300012208|Ga0137376_10626863 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300012209|Ga0137379_10307710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1495 | Open in IMG/M |
3300012212|Ga0150985_121181061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 744 | Open in IMG/M |
3300012361|Ga0137360_10009264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6203 | Open in IMG/M |
3300012361|Ga0137360_11262743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300012362|Ga0137361_11022753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
3300012363|Ga0137390_10809824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
3300012363|Ga0137390_11019477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
3300012685|Ga0137397_11231108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
3300012922|Ga0137394_10351440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1258 | Open in IMG/M |
3300012927|Ga0137416_10648707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
3300012927|Ga0137416_12008309 | Not Available | 530 | Open in IMG/M |
3300012930|Ga0137407_10590726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
3300012955|Ga0164298_10130379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
3300012955|Ga0164298_11055314 | Not Available | 605 | Open in IMG/M |
3300012961|Ga0164302_10851793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 694 | Open in IMG/M |
3300012985|Ga0164308_10854513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 798 | Open in IMG/M |
3300013100|Ga0157373_10251197 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300013296|Ga0157374_10091051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2908 | Open in IMG/M |
3300013296|Ga0157374_10412386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1349 | Open in IMG/M |
3300014152|Ga0181533_1036700 | All Organisms → cellular organisms → Bacteria | 2731 | Open in IMG/M |
3300014155|Ga0181524_10260271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
3300014159|Ga0181530_10341124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
3300014167|Ga0181528_10325691 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300014167|Ga0181528_10578846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300014169|Ga0181531_10236357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1113 | Open in IMG/M |
3300014169|Ga0181531_10508551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300014169|Ga0181531_10547500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 716 | Open in IMG/M |
3300014200|Ga0181526_10192130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1307 | Open in IMG/M |
3300014325|Ga0163163_10202788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2032 | Open in IMG/M |
3300014325|Ga0163163_10242485 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
3300014325|Ga0163163_10526720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1244 | Open in IMG/M |
3300014495|Ga0182015_10440036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
3300014497|Ga0182008_10818732 | Not Available | 542 | Open in IMG/M |
3300014502|Ga0182021_12668377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
3300014502|Ga0182021_13547918 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300014657|Ga0181522_10217309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1126 | Open in IMG/M |
3300014657|Ga0181522_10921923 | Not Available | 539 | Open in IMG/M |
3300014839|Ga0182027_10934725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 894 | Open in IMG/M |
3300014969|Ga0157376_11388777 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300015167|Ga0167661_1064902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300015242|Ga0137412_10167751 | Not Available | 1765 | Open in IMG/M |
3300015242|Ga0137412_10684865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
3300015358|Ga0134089_10002226 | All Organisms → cellular organisms → Bacteria | 5443 | Open in IMG/M |
3300015371|Ga0132258_12440654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
3300015373|Ga0132257_103660542 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300015374|Ga0132255_106301064 | Not Available | 502 | Open in IMG/M |
3300016371|Ga0182034_11051472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 705 | Open in IMG/M |
3300016730|Ga0181515_1480013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1983 | Open in IMG/M |
3300017657|Ga0134074_1080821 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300017822|Ga0187802_10219590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
3300017822|Ga0187802_10439751 | Not Available | 518 | Open in IMG/M |
3300017823|Ga0187818_10146033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1029 | Open in IMG/M |
3300017823|Ga0187818_10512630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300017823|Ga0187818_10550637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300017933|Ga0187801_10159415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300017934|Ga0187803_10015558 | All Organisms → cellular organisms → Bacteria | 3034 | Open in IMG/M |
3300017934|Ga0187803_10134845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 970 | Open in IMG/M |
3300017935|Ga0187848_10297656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
3300017936|Ga0187821_10239410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300017939|Ga0187775_10440114 | Not Available | 547 | Open in IMG/M |
3300017970|Ga0187783_10208636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1434 | Open in IMG/M |
3300017972|Ga0187781_11310624 | Not Available | 534 | Open in IMG/M |
3300017975|Ga0187782_11678474 | Not Available | 503 | Open in IMG/M |
3300017988|Ga0181520_10207050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1536 | Open in IMG/M |
3300017993|Ga0187823_10062163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1050 | Open in IMG/M |
3300018006|Ga0187804_10057563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1534 | Open in IMG/M |
3300018006|Ga0187804_10475710 | Not Available | 559 | Open in IMG/M |
3300018013|Ga0187873_1083256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1293 | Open in IMG/M |
3300018013|Ga0187873_1244876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300018013|Ga0187873_1394274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300018017|Ga0187872_10061846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1964 | Open in IMG/M |
3300018017|Ga0187872_10448447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300018017|Ga0187872_10504488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300018019|Ga0187874_10021640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3342 | Open in IMG/M |
3300018025|Ga0187885_10513212 | Not Available | 534 | Open in IMG/M |
3300018032|Ga0187788_10256317 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300018033|Ga0187867_10758551 | Not Available | 528 | Open in IMG/M |
3300018034|Ga0187863_10139998 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
3300018035|Ga0187875_10555030 | Not Available | 607 | Open in IMG/M |
3300018037|Ga0187883_10366980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300018037|Ga0187883_10404334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300018038|Ga0187855_10694069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300018047|Ga0187859_10050598 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
3300018047|Ga0187859_10136579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1296 | Open in IMG/M |
3300018058|Ga0187766_10017370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4111 | Open in IMG/M |
3300018060|Ga0187765_11270565 | Not Available | 520 | Open in IMG/M |
3300018062|Ga0187784_11524587 | Not Available | 529 | Open in IMG/M |
3300018085|Ga0187772_10322277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
3300018085|Ga0187772_10939949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300018086|Ga0187769_10608563 | Not Available | 826 | Open in IMG/M |
3300018086|Ga0187769_10774136 | Not Available | 725 | Open in IMG/M |
3300018090|Ga0187770_11254400 | Not Available | 600 | Open in IMG/M |
3300019275|Ga0187798_1555527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1507 | Open in IMG/M |
3300019284|Ga0187797_1886652 | Not Available | 787 | Open in IMG/M |
3300019789|Ga0137408_1356647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1251 | Open in IMG/M |
3300019886|Ga0193727_1123214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300020579|Ga0210407_11016777 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300020583|Ga0210401_10380686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1273 | Open in IMG/M |
3300021168|Ga0210406_10280064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1361 | Open in IMG/M |
3300021170|Ga0210400_11576923 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300021171|Ga0210405_10789097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300021178|Ga0210408_10721727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
3300021178|Ga0210408_10911102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300021178|Ga0210408_11246503 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300021402|Ga0210385_10417341 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300021402|Ga0210385_11005614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
3300021405|Ga0210387_10351560 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300021405|Ga0210387_10376604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1256 | Open in IMG/M |
3300021407|Ga0210383_10953403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
3300021418|Ga0193695_1105086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300021420|Ga0210394_10592701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
3300021432|Ga0210384_11447411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. RAC05 | 592 | Open in IMG/M |
3300021432|Ga0210384_11683709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300021433|Ga0210391_10013657 | All Organisms → cellular organisms → Bacteria | 6551 | Open in IMG/M |
3300021433|Ga0210391_10295506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1271 | Open in IMG/M |
3300021433|Ga0210391_10722422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 780 | Open in IMG/M |
3300021474|Ga0210390_10663227 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300021477|Ga0210398_11420729 | Not Available | 542 | Open in IMG/M |
3300021479|Ga0210410_11621661 | Not Available | 540 | Open in IMG/M |
3300021559|Ga0210409_10116882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2454 | Open in IMG/M |
3300021559|Ga0210409_10163775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2034 | Open in IMG/M |
3300021560|Ga0126371_11056696 | Not Available | 952 | Open in IMG/M |
3300022518|Ga0224548_1007539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1239 | Open in IMG/M |
3300022528|Ga0242669_1030257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 842 | Open in IMG/M |
3300022531|Ga0242660_1160138 | Not Available | 595 | Open in IMG/M |
3300022873|Ga0224550_1021334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
3300025480|Ga0208688_1034284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
3300025504|Ga0208356_1063244 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300025612|Ga0208691_1005783 | All Organisms → cellular organisms → Bacteria | 3481 | Open in IMG/M |
3300025612|Ga0208691_1069755 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300025899|Ga0207642_10018037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2699 | Open in IMG/M |
3300025903|Ga0207680_10761234 | Not Available | 694 | Open in IMG/M |
3300025916|Ga0207663_11257375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
3300025922|Ga0207646_10136214 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
3300025923|Ga0207681_10195827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1549 | Open in IMG/M |
3300025925|Ga0207650_11905195 | Not Available | 502 | Open in IMG/M |
3300025926|Ga0207659_10153919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1798 | Open in IMG/M |
3300025929|Ga0207664_10419491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1192 | Open in IMG/M |
3300025929|Ga0207664_11357454 | Not Available | 631 | Open in IMG/M |
3300025931|Ga0207644_10052838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2921 | Open in IMG/M |
3300025933|Ga0207706_10324540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1340 | Open in IMG/M |
3300025933|Ga0207706_11711716 | Not Available | 506 | Open in IMG/M |
3300025934|Ga0207686_10121658 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
3300025939|Ga0207665_10404125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
3300025939|Ga0207665_10701520 | Not Available | 796 | Open in IMG/M |
3300025942|Ga0207689_10331388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1264 | Open in IMG/M |
3300025944|Ga0207661_10486348 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300025949|Ga0207667_11820290 | Not Available | 573 | Open in IMG/M |
3300025986|Ga0207658_10726397 | Not Available | 898 | Open in IMG/M |
3300026023|Ga0207677_10022772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3857 | Open in IMG/M |
3300026023|Ga0207677_10283544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1361 | Open in IMG/M |
3300026035|Ga0207703_10759199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 924 | Open in IMG/M |
3300026088|Ga0207641_10482660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1201 | Open in IMG/M |
3300026318|Ga0209471_1024268 | All Organisms → cellular organisms → Bacteria | 3026 | Open in IMG/M |
3300026326|Ga0209801_1210943 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300026502|Ga0255350_1102777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300026515|Ga0257158_1097979 | Not Available | 578 | Open in IMG/M |
3300026547|Ga0209156_10032541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2945 | Open in IMG/M |
3300026552|Ga0209577_10276813 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
3300026557|Ga0179587_11166893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300027034|Ga0209730_1004052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1220 | Open in IMG/M |
3300027174|Ga0207948_1038940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300027330|Ga0207777_1005383 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
3300027370|Ga0209010_1016426 | Not Available | 1310 | Open in IMG/M |
3300027370|Ga0209010_1074498 | Not Available | 578 | Open in IMG/M |
3300027502|Ga0209622_1062073 | Not Available | 680 | Open in IMG/M |
3300027545|Ga0209008_1051850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
3300027559|Ga0209222_1103989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 549 | Open in IMG/M |
3300027562|Ga0209735_1079094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300027635|Ga0209625_1066837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 804 | Open in IMG/M |
3300027645|Ga0209117_1175008 | Not Available | 551 | Open in IMG/M |
3300027674|Ga0209118_1065682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
3300027678|Ga0209011_1197692 | Not Available | 549 | Open in IMG/M |
3300027795|Ga0209139_10040089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1656 | Open in IMG/M |
3300027824|Ga0209040_10334748 | Not Available | 724 | Open in IMG/M |
3300027853|Ga0209274_10114143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1341 | Open in IMG/M |
3300027854|Ga0209517_10066085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2599 | Open in IMG/M |
3300027854|Ga0209517_10283504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
3300027867|Ga0209167_10090992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1550 | Open in IMG/M |
3300027867|Ga0209167_10566065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 622 | Open in IMG/M |
3300027867|Ga0209167_10678421 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300027867|Ga0209167_10811973 | Not Available | 509 | Open in IMG/M |
3300027869|Ga0209579_10390042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300027882|Ga0209590_10394018 | Not Available | 894 | Open in IMG/M |
3300027889|Ga0209380_10584673 | Not Available | 647 | Open in IMG/M |
3300027894|Ga0209068_10113293 | Not Available | 1442 | Open in IMG/M |
3300027894|Ga0209068_10181647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1151 | Open in IMG/M |
3300027905|Ga0209415_10624597 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300027908|Ga0209006_10505756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
3300027911|Ga0209698_10015702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7364 | Open in IMG/M |
3300028047|Ga0209526_10118836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1857 | Open in IMG/M |
3300028047|Ga0209526_10307020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1072 | Open in IMG/M |
3300028572|Ga0302152_10138467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 776 | Open in IMG/M |
3300028784|Ga0307282_10480723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300028788|Ga0302189_10444118 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300028792|Ga0307504_10225970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 675 | Open in IMG/M |
3300028806|Ga0302221_10234869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 801 | Open in IMG/M |
3300028906|Ga0308309_10039391 | All Organisms → cellular organisms → Bacteria | 3321 | Open in IMG/M |
3300028906|Ga0308309_10075744 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
3300028906|Ga0308309_10452904 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300028906|Ga0308309_10467092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1088 | Open in IMG/M |
3300029636|Ga0222749_10830411 | Not Available | 505 | Open in IMG/M |
3300029951|Ga0311371_10381779 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
3300029951|Ga0311371_11160517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
3300029990|Ga0311336_11193836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 664 | Open in IMG/M |
3300029993|Ga0302304_10211473 | Not Available | 719 | Open in IMG/M |
3300029999|Ga0311339_11845787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 523 | Open in IMG/M |
3300029999|Ga0311339_11971844 | Not Available | 501 | Open in IMG/M |
3300030007|Ga0311338_12018918 | Not Available | 512 | Open in IMG/M |
3300030057|Ga0302176_10036649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1869 | Open in IMG/M |
3300030507|Ga0302192_10237681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 774 | Open in IMG/M |
3300030617|Ga0311356_10049072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4510 | Open in IMG/M |
3300030618|Ga0311354_10026235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7083 | Open in IMG/M |
3300030706|Ga0310039_10122346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1071 | Open in IMG/M |
3300030707|Ga0310038_10002537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13368 | Open in IMG/M |
3300030760|Ga0265762_1109777 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300030943|Ga0311366_10963358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 738 | Open in IMG/M |
3300030943|Ga0311366_11241785 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300031018|Ga0265773_1020122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
3300031057|Ga0170834_107209936 | Not Available | 596 | Open in IMG/M |
3300031057|Ga0170834_110329914 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
3300031057|Ga0170834_113520522 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300031090|Ga0265760_10316300 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300031231|Ga0170824_110233807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1102 | Open in IMG/M |
3300031234|Ga0302325_10314282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2527 | Open in IMG/M |
3300031236|Ga0302324_101347886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
3300031261|Ga0302140_10419462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1070 | Open in IMG/M |
3300031446|Ga0170820_14206380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 990 | Open in IMG/M |
3300031720|Ga0307469_11670447 | Not Available | 613 | Open in IMG/M |
3300031753|Ga0307477_10717175 | Not Available | 668 | Open in IMG/M |
3300031754|Ga0307475_10048502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3181 | Open in IMG/M |
3300031754|Ga0307475_10318748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1249 | Open in IMG/M |
3300031754|Ga0307475_10333064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1219 | Open in IMG/M |
3300031754|Ga0307475_10823460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
3300031819|Ga0318568_10879518 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300031820|Ga0307473_11051504 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300031823|Ga0307478_10279664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1362 | Open in IMG/M |
3300031823|Ga0307478_10469857 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300031902|Ga0302322_102114750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 692 | Open in IMG/M |
3300031912|Ga0306921_10339431 | All Organisms → cellular organisms → Bacteria | 1757 | Open in IMG/M |
3300031938|Ga0308175_100196463 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
3300031962|Ga0307479_11500498 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300032001|Ga0306922_12375214 | Not Available | 507 | Open in IMG/M |
3300032059|Ga0318533_10172528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1539 | Open in IMG/M |
3300032160|Ga0311301_10343143 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
3300032180|Ga0307471_100024965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4478 | Open in IMG/M |
3300032180|Ga0307471_100971724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
3300032515|Ga0348332_14216074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300032770|Ga0335085_12097946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
3300032782|Ga0335082_11207039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 624 | Open in IMG/M |
3300032805|Ga0335078_10079829 | All Organisms → cellular organisms → Bacteria | 4767 | Open in IMG/M |
3300032829|Ga0335070_10050919 | All Organisms → cellular organisms → Bacteria | 4558 | Open in IMG/M |
3300032897|Ga0335071_11021097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 773 | Open in IMG/M |
3300032955|Ga0335076_11659868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300033134|Ga0335073_10064973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4821 | Open in IMG/M |
3300033290|Ga0318519_10576292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. BK069 | 682 | Open in IMG/M |
3300033405|Ga0326727_11037262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300033829|Ga0334854_032318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
3300034065|Ga0334827_030054 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
3300034282|Ga0370492_0265986 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.02% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.93% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.40% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.14% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.14% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.14% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.62% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.62% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.57% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.31% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.31% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.31% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.05% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.05% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.05% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.05% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.05% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.52% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.26% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.26% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.26% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.26% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.26% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.26% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.26% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.26% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.26% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.26% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.26% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.26% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028572 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1043211831 | 3300000364 | Soil | IRAVSPPVEKDRVMYQDFARIAEVIASGKIAEALG* |
INPhiseqgaiiFebDRAFT_1050319821 | 3300000364 | Soil | AHAAIRSVCPTMDKDRVMYTDLARIAELIANGRLAEPLR* |
JGI12664J13189_10001891 | 3300001082 | Forest Soil | AHGAIRAVCATMEKDRVMYKDFARLAELIAGGSVAEVLR* |
JGI12635J15846_104015002 | 3300001593 | Forest Soil | GQAAHGAIRAVCATMEKDRVMYKDFARLAELIASGSVAAVLP* |
JGI12635J15846_105048451 | 3300001593 | Forest Soil | GQAAHGAIRAVCATMEKDRVMYKDFARLAELIAGGSVAEVLR* |
JGI12627J18819_102363652 | 3300001867 | Forest Soil | QRAHAAIRAVSPALEKDRAMYQDFARIADVIAAGKLAEALR* |
JGI12627J18819_103101722 | 3300001867 | Forest Soil | SKRGQAAHAAIRAVCPTMEKDRVMYKDFARLAELITSGKLAGILL* |
JGIcombinedJ26739_1002410661 | 3300002245 | Forest Soil | AQAAIRSVCPTMEKDRVMYGDFARIAALIASGKVAEALR* |
JGIcombinedJ26739_1004884142 | 3300002245 | Forest Soil | DFYLHGEKALKTSKRGQAAHGAIRAVCATMEKDRVMYKDFARLSELIAGGSVAAVLR* |
JGIcombinedJ26739_1017541552 | 3300002245 | Forest Soil | FLAPLKTSKRGQAAHTAIRSVCPTMAKDRVMYADFARLAEFIASGRIAEALR* |
JGI25390J43892_101226472 | 3300002911 | Grasslands Soil | PLKTSKRGQAAHAAIRAVCPTMERDRVMYQDFVRIAEVIARGNVAEVLR* |
Ga0062387_1004219822 | 3300004091 | Bog Forest Soil | KRGQAAHAAIRSVCPTMDKDRVMYQDFARIAELIASGKLAQALR* |
Ga0062387_1005185781 | 3300004091 | Bog Forest Soil | LKTSKRGQAAHAAIRSVCPTMEKDRVMYKDFARIAELIQSGRVAEVLR* |
Ga0062387_1015251202 | 3300004091 | Bog Forest Soil | QAHAAIRSVCATMDKDRVMYKDFASISELIASRELAKLVR* |
Ga0062595_1025745022 | 3300004479 | Soil | LLAAHKAIRVVCPPMDKDRVMYQDFVRIADTIRSGKLAAALH* |
Ga0066395_102582713 | 3300004633 | Tropical Forest Soil | GQAAHAVIRSTCPAMEKDRAMYADLARIRDLIASGKLAEILR* |
Ga0070670_1000478041 | 3300005331 | Switchgrass Rhizosphere | LIAPLATSKRGQRARAAIRSVSPKLDKDRVMYQDFVRIADVIASGKIQEALE* |
Ga0068868_1022251531 | 3300005338 | Miscanthus Rhizosphere | RGQSAHRAIRAVSPAMEKDRVMYKDFASIAEVIEAGHLSVVLKQ* |
Ga0070669_1003409951 | 3300005353 | Switchgrass Rhizosphere | APLKTSKRGQTAHAAIRSVCATMEEDRVMYQDFARLADLIASGKVAEVLR* |
Ga0070714_1004733001 | 3300005435 | Agricultural Soil | KRGQAAHAAIRGVCPTMEKDRVMYPDLARIVGLISSGKVAEVLR* |
Ga0070714_1008362501 | 3300005435 | Agricultural Soil | RLQRAHAAIRAVSPMLEKDRVMYQDFARIADVIASGNVAEALR* |
Ga0070708_1011779421 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | AHAAIRAVCPTMEKDRVMYGDFARIAVVIARGRIAEALQ* |
Ga0070707_1018893211 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | FLAPLKTSKRGQAAQAAIRSVCPTMEKDRVMYADFARLSALIASGKVADALR* |
Ga0070699_1014800962 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | KPLQQAHAAIRSVCRTMEKDRVMYHDFARIAALIASGKVADVVR* |
Ga0073909_104854772 | 3300005526 | Surface Soil | AAIRSVCPTMDKDRVMYTDLARIAELIANGRLAEPLR* |
Ga0070741_100917221 | 3300005529 | Surface Soil | RSVCPSVDKDRAMSGDFERLSKLIASGKVAEALR* |
Ga0070741_101993731 | 3300005529 | Surface Soil | APLKTSKRGLIAYSAIRAVCPSVEKDRVMYPDFARIAEVIASGKIAEALR* |
Ga0070741_110356521 | 3300005529 | Surface Soil | APLKTSKRGLIAYSAIRAVCPSVEKDRVMYPDFARIAEVIASGKIAEALI* |
Ga0068853_1009092361 | 3300005539 | Corn Rhizosphere | GLIAHNAIRAVCPTMEKDRVMYHDFARIADVIASGKIADALR* |
Ga0070733_102026641 | 3300005541 | Surface Soil | QAAHAAIRSVCPTMDKDRVMYQDFARIAELIASGKVAAALR* |
Ga0070732_106919762 | 3300005542 | Surface Soil | LKTSKRGQAAQAAIRSVCPTMEKDRVMYADFARLAALIASGKVAEALR* |
Ga0070672_1014041301 | 3300005543 | Miscanthus Rhizosphere | AAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR* |
Ga0070696_1003030452 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | IAPLATSKRGQRARAAIRSVSPKLDKDRVMYQDFVRIADVIASGKIQEALE* |
Ga0070693_1007990641 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | AAHAAIRSVCATMDKDRVMYQDFAKVADLIASGMVAAALR* |
Ga0066670_104385261 | 3300005560 | Soil | TSKRLQSAHAAIRSVSPTMDKDRVMYGDFARIADVIAARKLVESLL* |
Ga0070664_1001957753 | 3300005564 | Corn Rhizosphere | FLAPLKTSKRGLIAHNAIRAVCPTMEKDRVMYHDFARIADVIASGKIADALR* |
Ga0066702_100184341 | 3300005575 | Soil | AAIRAVCPTMEKDRVMYGDFARVAEVIASGKVAEALR* |
Ga0066702_103904871 | 3300005575 | Soil | RGLKAHAAIRSVCAAMDKDRVMYEDFARMAKLIGDGKLAEAVR* |
Ga0068857_1009211511 | 3300005577 | Corn Rhizosphere | IAHNAIRAVCPTMEKDRVMYHDFARIADVIASGKIADALR* |
Ga0070761_100629992 | 3300005591 | Soil | HAAIRGVCATMEKDRVMYQDFVRIAELIASGKLAELVR* |
Ga0070761_102722192 | 3300005591 | Soil | AAIRSVCPTMEKDRIMYKDFARLAELIASGKVAEVIR* |
Ga0070764_108403252 | 3300005712 | Soil | GKRGLAAYAAIRSVCPTMDKDRVMYRDFARIADLIASGKVAEALR* |
Ga0066905_1009261811 | 3300005713 | Tropical Forest Soil | AIRSVCPTMEKDRVMYQDFARISEVIGSAKLANILR* |
Ga0068861_1007739652 | 3300005719 | Switchgrass Rhizosphere | QAHAAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR* |
Ga0068861_1017261351 | 3300005719 | Switchgrass Rhizosphere | KTSKLLQQAHAAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR* |
Ga0066903_1016160432 | 3300005764 | Tropical Forest Soil | FLAPLKTSKRLQGAHAAIRAVCPTMEKDRVMYQDFVRIAEVIAGGKIAEAVR* |
Ga0066651_101181492 | 3300006031 | Soil | ALDFLAPLRTSKRLQSAHAAIRSVSPTMDKDRVMYGDFARIADVIAARKLVESLL* |
Ga0075029_1000440072 | 3300006052 | Watersheds | KPLQRAHSAIRSVCATMDRDRVMYPDFARIAEVIAKGHLADLVR* |
Ga0075029_1011127051 | 3300006052 | Watersheds | LAPLKTSKRGQAAQAAIRSVCPTMEKDRVMYTDLARISDLIANGRVAEALR* |
Ga0075019_101781823 | 3300006086 | Watersheds | IRSVCPLVDKDRVMYTDLARTAELIAAGKIAAALM* |
Ga0075015_1002568291 | 3300006102 | Watersheds | AAIRTVCPTMEKDRVMYQDFARIAELIASGKVAEVLL* |
Ga0075030_1000317305 | 3300006162 | Watersheds | SKRGQAAHAAIRAVCPTMVKDRVMYTDLARIAALISSGKVAEALR* |
Ga0075018_108106651 | 3300006172 | Watersheds | KRGQAAHAAIRSVCPTMEKDRVMYEDFARIAALIASGKVAETLR* |
Ga0070716_1012268692 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AAIRAVSNSLERDRVMYQDFARIAEVIASGKVAEALR* |
Ga0075014_1006177981 | 3300006174 | Watersheds | QAAHAAIRAVCPTMVKDRVMYTDLARIAALISSGKVAEALR* |
Ga0070765_1006112183 | 3300006176 | Soil | HAAIRSVCPTIAKDRVMYPDVARVAEMIGAGKLAATLR* |
Ga0070765_1014590692 | 3300006176 | Soil | LDFLAPLKTSNRGQMAHAAIRSVCGAMDKDRVMYQDFARVSDLIASGKVAEALR* |
Ga0097621_1010070602 | 3300006237 | Miscanthus Rhizosphere | RAVCPTMEKDRVMYKDFARISELLASGKVAEAVR* |
Ga0066658_103935252 | 3300006794 | Soil | ALAAIRAVCPTMEKDRVMYKDFARLAELIASGRVAEALR* |
Ga0066665_100807875 | 3300006796 | Soil | KTSKRGQAAHAAIRAVCPTMERDRVMYQDVVRIAEVIASGNVAEVLR* |
Ga0066665_114533662 | 3300006796 | Soil | APLKTSKHGQTAHAAIRAVCPTMDKDRAMSGDLARLAGLIQRGKLAEMLR* |
Ga0066659_114947662 | 3300006797 | Soil | KAYEAIRAVCPPMERDRVMYGDFAKVAALIAGSEVSDALR* |
Ga0066660_111431291 | 3300006800 | Soil | KTGRRGLKAHAAIRSVCAAMDRDRVMYEDFARTAKLISEGKLAEALR* |
Ga0079221_111399822 | 3300006804 | Agricultural Soil | AHAAIRAVCPTMEKDRVMYQDFVHIAEVIAGGKIADTLR* |
Ga0075425_1021809052 | 3300006854 | Populus Rhizosphere | LQQAHAAIRGVCPTMEKDRVMYKDFARISELLASGKVAEAVR* |
Ga0075436_1009598102 | 3300006914 | Populus Rhizosphere | SKRGQAAHAAIRAVCPTIEKDRVMYPDLARIAELIESGKIAAALR* |
Ga0099791_100825383 | 3300007255 | Vadose Zone Soil | IRAVCPTMERDRVMYQDFVRIAEVIARGNVAEVLR* |
Ga0099791_101022541 | 3300007255 | Vadose Zone Soil | KTSRRGQAAHAAIRSVCATMDKDRVMYRDFARIAELIASGKVAEALR* |
Ga0099794_105865151 | 3300007265 | Vadose Zone Soil | QAHAAIRAVCATMEKDRVMYQDFARLAALIASGKVAEVVR* |
Ga0066710_1033243911 | 3300009012 | Grasslands Soil | AIRSVCAAMEKDRVMYGDFTKVADIIAKGQIAASLV |
Ga0099829_102843602 | 3300009038 | Vadose Zone Soil | LQQAHAAIRSVCATMEKDRVMYRDFARIAELIASGKLAEVMR* |
Ga0099830_103497701 | 3300009088 | Vadose Zone Soil | LKTSKRGQAHAAILCVCPTMEKDRVMYKDFARLAERIASGKVAAALR* |
Ga0099830_107538801 | 3300009088 | Vadose Zone Soil | QQAHAAIRSVCATMEKDRVMYRDFARIAELIASGKLAEVMR* |
Ga0099828_108840772 | 3300009089 | Vadose Zone Soil | LKTSKRGQAHAAILCVCPTMEKDRGMHKDFARLAERIASGKVAAALR* |
Ga0099827_112015252 | 3300009090 | Vadose Zone Soil | AAIRAVSPKLEKDRVMYQDFARIADVIASGKIANALR* |
Ga0105240_115396611 | 3300009093 | Corn Rhizosphere | LKTSPRGQAAHSAIREVCPTMNKDRVMYPDFARIAKLIESGKISAALD* |
Ga0105245_102224031 | 3300009098 | Miscanthus Rhizosphere | AIRAVCPTMERDRVMYKDFARISELLASGKVAEVVR* |
Ga0105247_117230121 | 3300009101 | Switchgrass Rhizosphere | KTSKRGQAAHAAIRSVSATMDKDRVMYQDFARISDLIASGRVAEALR* |
Ga0105248_103861241 | 3300009177 | Switchgrass Rhizosphere | QQAHAAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR* |
Ga0116214_10290011 | 3300009520 | Peatlands Soil | LKTGKRGLAAYAAIRSVCATMDKDRVMYQDFARIADLIASGKVAEALR* |
Ga0116214_13067022 | 3300009520 | Peatlands Soil | LAPLKTSKPLREAHAAIRAVCATMDRDRVMYQDFARIAELIASGKVTEALR* |
Ga0116222_10528532 | 3300009521 | Peatlands Soil | KSSKRGQAAHTEIRSVCPTMEKDRGMYKDFARFAELIAGGKVAEALR* |
Ga0116218_11541332 | 3300009522 | Peatlands Soil | PLQQAHAAIRAVCATMERDRVMYQDFARIAELIASGKVAEVLR* |
Ga0105237_106010151 | 3300009545 | Corn Rhizosphere | LDLIAPLATSKRGQRARAAIRSVSPKLDKDRVMYQDFVRIADVIASGKIQEALE* |
Ga0105238_100656751 | 3300009551 | Corn Rhizosphere | IRSVSATMDKDRVMYQDFARIAELIASGKFREVLE* |
Ga0116105_10819723 | 3300009624 | Peatland | KTSKRGQAAHAAIRSVCPIMEKDRVMYNDLSRIAELLAGGKIAESLH* |
Ga0116105_11625442 | 3300009624 | Peatland | LKTSKRGQMAHAAIRSVCPTMEKDRVMYGDFARIAALIASGRVAEALR* |
Ga0116105_12444761 | 3300009624 | Peatland | TSKPLQQAHAAIRGVCRTMDKDRVMYQDFARLAELIASGKLAEVVH* |
Ga0116102_11091102 | 3300009632 | Peatland | PLQQAHAAIRGVCATMEKDRVMYQDFARVAELIASGKIAEVVR* |
Ga0116118_11407732 | 3300009637 | Peatland | KTSKPLRQAHAAIRAVCATMDRDRVMYQDFARIAELIASGKVAEVLR* |
Ga0116126_10696571 | 3300009640 | Peatland | PLKTSKPLREAHAAIRSVCATMDKDRVMYQDFARIAELIASGKVAEVLR* |
Ga0116106_11848831 | 3300009645 | Peatland | RQAHAAIRAVCATMDRDRVMYQDFARIAELIASGKVAEVLR* |
Ga0126380_105120101 | 3300010043 | Tropical Forest Soil | RGLLAYQAIRAVCPTMEKDRIMYPDFARIANVIGEGKLAEALI* |
Ga0134070_100381661 | 3300010301 | Grasslands Soil | IRSVSPTMDKDRVMYGDFAHISELIASRRLADTLL* |
Ga0134070_101663731 | 3300010301 | Grasslands Soil | QTAHAAIRAVCPTMDKDRAMSGDLARLAGLIQRGKLAEMLR* |
Ga0134067_103314461 | 3300010321 | Grasslands Soil | FVAPLKTGRRGLKAHAAIRSVCAAMDKDRVMYEDFARMAKLIGDGKLAEAVR* |
Ga0134086_100986662 | 3300010323 | Grasslands Soil | RLQSAHAAIRSVSPTMDKDRVMYGDFARIADVIAARKLVESLL* |
Ga0074044_100990803 | 3300010343 | Bog Forest Soil | DFLAPLKTSKRGQIAHAAIRSVCPTVDKDRVMYKDFARITELIASGKVAEALR* |
Ga0126370_111438073 | 3300010358 | Tropical Forest Soil | AAIRSVCPAIDKDRVLYQDLVRVAAMIATGKLAEAIRQTR* |
Ga0126378_100716931 | 3300010361 | Tropical Forest Soil | IRSVSPTVEKDRIMYPETARIAEIIAAGKLAALLD* |
Ga0126377_128392861 | 3300010362 | Tropical Forest Soil | AHAAIRSVCPTMEKDRVMYQDFARISELISGARLATILR* |
Ga0126377_133389892 | 3300010362 | Tropical Forest Soil | LKTSKRLHFAHAAIRSVCSTMGRDRVMYGDFVRIAEAIGSGKISEAVR* |
Ga0126379_102298421 | 3300010366 | Tropical Forest Soil | KTSKRLQQAHAAIRSVSTKLEKDRVMYQDFSRIAEVIANGKIADALR* |
Ga0126379_118108121 | 3300010366 | Tropical Forest Soil | TSKRGQAAHAAIRSVCPTMDKDRVMYQDFARIAELIGSGKIADALR* |
Ga0126381_1002318024 | 3300010376 | Tropical Forest Soil | GQTAHAVIRSVCPTMEKDRVMYPDLIRISELIASGRIAEVLR* |
Ga0126381_1036116301 | 3300010376 | Tropical Forest Soil | KTSKRLQRAHEAIRAVSSVLDKDRVMYQDFARIAEVIASGRIAGALR* |
Ga0136449_1004691631 | 3300010379 | Peatlands Soil | HAAIRSVCPTMDKDRVMYEDFARIAELIASGRVAEVLR* |
Ga0136449_1015626462 | 3300010379 | Peatlands Soil | LRQAHAAIRAVCATMDRDRVMYQDFARIAELIASGKVAEVLR* |
Ga0134126_114868261 | 3300010396 | Terrestrial Soil | KAYAAIRSVCAAMNKDRVMYEDFARAAKLIAEGKLAAALN* |
Ga0134126_122509481 | 3300010396 | Terrestrial Soil | KAYAAIRSVCAAMDQDRVMYEDFARTAKLIAEGKLAAALN* |
Ga0134124_121322511 | 3300010397 | Terrestrial Soil | LKTSKRGLIAHNAIRAVCPTMEKDRVMYQDFARIADVIGSGRIADALR* |
Ga0137392_106301781 | 3300011269 | Vadose Zone Soil | KTSKRGQAAHAAIRSVCPTMENDRVMYKDFARLSELIASGKVAEALR* |
Ga0137391_105950442 | 3300011270 | Vadose Zone Soil | KTGKRGQKAHDAIRSVCAAMDKDRVMYKDFARVAGIIAEGKISEVLD* |
Ga0137391_113529081 | 3300011270 | Vadose Zone Soil | PLKTSKPLQQAHAAIRSVCATMEKDRVMYRDFARIAELIATGKVAEVVR* |
Ga0137393_108638032 | 3300011271 | Vadose Zone Soil | SKRGQAAHAAIRSVCPTMENDRVMYKDFARLAELIASGRLAESLR* |
Ga0137389_117735931 | 3300012096 | Vadose Zone Soil | RSVCPTMDKDRVMSGDFARIAELIASGKVAEVLR* |
Ga0137388_113757241 | 3300012189 | Vadose Zone Soil | PLKTSKPLQQAHAAIRAVCATMEKDRVMYQDFARIAALIASGKVAEVVR* |
Ga0137363_116963061 | 3300012202 | Vadose Zone Soil | HAHAKIRSVCATMDKDRVMYQDFSRIAEVIAAGKVAEAVR* |
Ga0137380_104736072 | 3300012206 | Vadose Zone Soil | RGQAAHAAIRAVCPTMEKDRVMYQDFARVAEVIASGKLAEVLR* |
Ga0137380_106228492 | 3300012206 | Vadose Zone Soil | LKTGKRGQKALQEIRSVCPTMDKDRVMYRDFARIADLISGGKLAEVLA* |
Ga0137376_103680541 | 3300012208 | Vadose Zone Soil | KRGQAAHAAIRTVCATMDKDRVMYQDFARIAELIASGRVADVLR* |
Ga0137376_106268632 | 3300012208 | Vadose Zone Soil | APLKTGKRGQKAHAAIRTVCPTMEKDRVMYNDFANVAQLIASRRVAEVLD* |
Ga0137379_103077101 | 3300012209 | Vadose Zone Soil | AHAAIRAVCPTMEKDRVMYQDFARIAEVIAVGKVAEVVR* |
Ga0150985_1211810611 | 3300012212 | Avena Fatua Rhizosphere | VQAAIRSVCPTMEKDRVMYMDFVRIAEVIASGRIADALR* |
Ga0137360_100092646 | 3300012361 | Vadose Zone Soil | LKTSKRGQVAHAAIRSVCATMDRDRVMYQDFARIAELIASGKVAEALR* |
Ga0137360_112627432 | 3300012361 | Vadose Zone Soil | IRSVCATMDKDRVMYQDFSRIAEVIAAGKVAEAVR* |
Ga0137361_110227532 | 3300012362 | Vadose Zone Soil | KTSKRGQAAHEAIRSVSPTVEKDRAMSDDFAKIAHIISSGRLAEVLR* |
Ga0137390_108098242 | 3300012363 | Vadose Zone Soil | RGQAAHAAIRAVCPTMVRDRVMYQDFARLAELIASGKVAAVVR* |
Ga0137390_110194772 | 3300012363 | Vadose Zone Soil | SKRGQVAHAAIRSVSATMDKDRVMYQDFARIAELIASGKVAAALR* |
Ga0137397_112311081 | 3300012685 | Vadose Zone Soil | RLQQAHAAIRAVSPLVEKDRVMYQDFARIADVINSGKVAEALR* |
Ga0137394_103514402 | 3300012922 | Vadose Zone Soil | KTSKPLQHAHAAIRAVCATMDKDRVMYQDFARIAEAIAAGKVAEALR* |
Ga0137416_106487071 | 3300012927 | Vadose Zone Soil | ALDFLAPLKTSKRGQAAHATIRSVCATMVKDRVMYQDFARVANLIASGKVAEALR* |
Ga0137416_120083092 | 3300012927 | Vadose Zone Soil | VAHAAVRSVGPTMEKDRVVYKGFARLAELISTGKVAEALR* |
Ga0137407_105907262 | 3300012930 | Vadose Zone Soil | LSPLKTSKRGQAAHEAIRSVSPTVEKDRAMSDDFAKIAHIISSGRLAEVLR* |
Ga0164298_101303791 | 3300012955 | Soil | AHTAIRSVVAVMEQDRVMYQDFARIAELITSGKLAGSAR* |
Ga0164298_110553141 | 3300012955 | Soil | TAHAAIRSVSAAMDKDRVMYPDFVRLSQLLASGKIAEALR* |
Ga0164302_108517931 | 3300012961 | Soil | QAAHSAIREVCPTMNKDRVMYPDFARIAKLIESGKISAALD* |
Ga0164308_108545133 | 3300012985 | Soil | DFLAPLKTSKRGQAAHASIRSVSAAMDKDRVMYPDFVRLSQLLASGKIAEALR* |
Ga0157373_102511972 | 3300013100 | Corn Rhizosphere | HNAIRAVCPKMEKDRVMYQDFARIADVIATGKIADALR* |
Ga0157374_100910514 | 3300013296 | Miscanthus Rhizosphere | HAAIRSVCPTMEKDRVMYQDFARISGLIADGKLAEVAR* |
Ga0157374_104123861 | 3300013296 | Miscanthus Rhizosphere | HAAIRGVCPTMEKDRVMYKDFARISELLASGKVAEAVR* |
Ga0181533_10367002 | 3300014152 | Bog | AHAAIRGVCATMEKDRVMYQDFARVAELIASGKIAEVVR* |
Ga0181524_102602712 | 3300014155 | Bog | HAAIRAVCATMDKDRVMYQDFARIAELIASGKVAAVLH* |
Ga0181530_103411242 | 3300014159 | Bog | IRAVCRTMEKDRVMYQDFARIAELIASGRLADVVR* |
Ga0181528_103256911 | 3300014167 | Bog | IRAVCRTMEKDRVMYQDFQRLSDLIESGKLAAVLR* |
Ga0181528_105788462 | 3300014167 | Bog | PLKPSKPLQQAHAAIRAVCATMQQDRVMYKDFERIAQLIASGRLAAALQ* |
Ga0181531_102363573 | 3300014169 | Bog | AAHAAIRSVCPVVDKDRVMYKDFARLAELIADGKVAEAVR* |
Ga0181531_105085512 | 3300014169 | Bog | AAIRSVCAIMQKDRVMYQDFARIAELIAAGKLAAVLQ* |
Ga0181531_105475003 | 3300014169 | Bog | KRGQMAHAAIRSVCPTMEKDRVMYGDFARIAALIASGRVAETLR* |
Ga0181526_101921304 | 3300014200 | Bog | PLKTSKRGQAAQAAIRSVCPTMEKDRVMYGDFARIAALIAGGKVAAVLR* |
Ga0163163_102027883 | 3300014325 | Switchgrass Rhizosphere | SKPLQQAHAAIRAVCPTMEKDRVMYKDFARISELLASGKVADVVR* |
Ga0163163_102424851 | 3300014325 | Switchgrass Rhizosphere | IRAVCPTMEKDRVMYHDFARIADVIASGKIADALR* |
Ga0163163_105267203 | 3300014325 | Switchgrass Rhizosphere | SKPLQQAHAAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR* |
Ga0182015_104400362 | 3300014495 | Palsa | TSKRGQAVVTAIRSVCPAMDKDRVMYGDFARLAELIASGKAAEALR* |
Ga0182008_108187321 | 3300014497 | Rhizosphere | KTSKRGLIAHNAIRAVCPTMEKDRVMYHDFARIADVIGSGRIADALR* |
Ga0182021_126683772 | 3300014502 | Fen | TSKPLQQAHAAIRAVCATMEKDRVMYQDFARIAELIASGKIAAVLR* |
Ga0182021_135479182 | 3300014502 | Fen | GQAAHAAIRSVSPAMEKDRVMQGDFVRIAELIESGRVAEAVR* |
Ga0181522_102173092 | 3300014657 | Bog | TSKLGEAAHTAIRSVCPTMEKDRVMYKDFGRIAELIASGKIAEVIR* |
Ga0181522_109219232 | 3300014657 | Bog | AAHAAIRSVCATMEKDRVMYQDFARLAELIASGKLAEIVR* |
Ga0182027_109347252 | 3300014839 | Fen | TSKPLQQAHAAIRAVCRTMEKDRVMYQDFARIAELIASGKLAEAVR* |
Ga0157376_113887771 | 3300014969 | Miscanthus Rhizosphere | SKRGQRARAAIRSVSPKLDKDRVMYQDFVRIADVIASGKIQEALE* |
Ga0167661_10649021 | 3300015167 | Glacier Forefield Soil | QRAHAAIRALCATMDKDRVMYLDFARIAEMIATGKVAEALQ* |
Ga0137412_101677511 | 3300015242 | Vadose Zone Soil | QAAQAAIRSVCPTMEKDRVMYKDFARLADLIASGKVAEALR* |
Ga0137412_106848652 | 3300015242 | Vadose Zone Soil | AAIRAVSPPVEKDRVMYQDFARIAEVIASGKVSDALR* |
Ga0134089_100022267 | 3300015358 | Grasslands Soil | APLRTSKRLQSAHAAIRSVSPTMDKDRVMYGDFAHISELIASRRLADTLL* |
Ga0132258_124406543 | 3300015371 | Arabidopsis Rhizosphere | IRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR* |
Ga0132257_1036605421 | 3300015373 | Arabidopsis Rhizosphere | RLQQAHAAIRVVSPAVEKDRVMYRDFARIAEVIASSKIAEALR* |
Ga0132255_1063010641 | 3300015374 | Arabidopsis Rhizosphere | LLQQAHAAIRAVCPTMEKDRVMYTDFVRIAEVIASGKIADALR* |
Ga0182034_110514721 | 3300016371 | Soil | AAHAAIRSVCPTIDKDRVMYSDQGRVAELIASGKVAEALR |
Ga0181515_14800134 | 3300016730 | Peatland | QQAHAAIRAVCATMDRDRVMYQDFARIAELIASGKVAEALR |
Ga0134074_10808211 | 3300017657 | Grasslands Soil | FLAPLRTSKRLQSAHAAIRSVSPTMDKDRVMYGDFARIADVIAARKLVESLL |
Ga0187802_102195902 | 3300017822 | Freshwater Sediment | AAIRSVCPTMDKDRVMYQDFVRIAELIASGKVAEVLR |
Ga0187802_104397512 | 3300017822 | Freshwater Sediment | AIRSVCPTMEKDRVMYQDFARIAELIASGKILEALR |
Ga0187818_101460333 | 3300017823 | Freshwater Sediment | IRSVCPTMEKDRVMYTDLARLSDLIASGRIADALR |
Ga0187818_105126301 | 3300017823 | Freshwater Sediment | PLQEVHASIRAVCRAMNKDRVMYQDFARIAELIASGKVAEVVR |
Ga0187818_105506372 | 3300017823 | Freshwater Sediment | QVHAAIRAVCPTMEKDRVMYQDFARIAELIASGKVAAVVR |
Ga0187801_101594152 | 3300017933 | Freshwater Sediment | LKPSKPLQQVHAAIRTVCATMQHDRVMYADFARIAELIASGKIAAVIQ |
Ga0187803_100155583 | 3300017934 | Freshwater Sediment | SKPLQQAHAAIRAVCATMEKDRVIYQDFARIAELIASGKVAAVVR |
Ga0187803_101348451 | 3300017934 | Freshwater Sediment | PSKRLQQAHAAIRAVCPTMDKDRVMYQDFARIAETIAAGKLAEVVR |
Ga0187848_102976561 | 3300017935 | Peatland | QQAHAAIRTVCATMTKDRVMYQDFARIAELIASGKVADVLR |
Ga0187821_102394102 | 3300017936 | Freshwater Sediment | AQAAIRAVSPKLEKDRVMYQDFARIAEVIASGKVAAALR |
Ga0187775_104401141 | 3300017939 | Tropical Peatland | QQAQAAIRAVCPTMDKDRVMYKDFERIAEVIASGTLAEALR |
Ga0187783_102086361 | 3300017970 | Tropical Peatland | IRSVCPTMDKDRVMYGDFARIAQLIASGKLAHVLR |
Ga0187781_113106242 | 3300017972 | Tropical Peatland | SAIRAVCAPMQKDRVMYRDFERIAELIAHGDLAQLAR |
Ga0187782_116784741 | 3300017975 | Tropical Peatland | KRGQAAHAAIRSVCPTMEKDRVMYADLARVAELIESGKVAEALR |
Ga0181520_102070501 | 3300017988 | Bog | LKTGKRGLAAYAAIRSACATMDKDRVMYQDFARIADLIASGKVAEVLK |
Ga0187823_100621631 | 3300017993 | Freshwater Sediment | TSKRGQAAQAAIRSVCPTMEKDRVMYQDFARLAALIASGKVAEALR |
Ga0187804_100575631 | 3300018006 | Freshwater Sediment | LKPSKRGQAAHAAIRSVCPTMEKDRVMYQDFARIAELIANGKVAEALR |
Ga0187804_104757101 | 3300018006 | Freshwater Sediment | SKRGQAAHAAIRSVCPTMNKDRVMYGDFARLSELIASGKVAETLR |
Ga0187873_10832561 | 3300018013 | Peatland | AAIRSVCATMDKDRVMYQDFARIAELIASGKVAEVLR |
Ga0187873_12448761 | 3300018013 | Peatland | PLQQAHAAIRAVCATMDRDRVMYQDFARIAELIASGKVAEVVR |
Ga0187873_13942741 | 3300018013 | Peatland | LQKAHAAIRAVCATMDRDRVMYQDFACIAELIASGNVAEVVR |
Ga0187872_100618461 | 3300018017 | Peatland | QAHAAIRAVCRTMERDRAMYQDFARIAELIASGKLAEVVR |
Ga0187872_104484472 | 3300018017 | Peatland | PLREAHAAIRSVCATMDKDRVMYQDFARIAELIASGKVAEVLR |
Ga0187872_105044881 | 3300018017 | Peatland | RGQAAHAAIRSVCPAMEKDRVMYKDFARLADLIASGKVAEALR |
Ga0187874_100216401 | 3300018019 | Peatland | PLQQAHAAIRGVCATMEKDRVMYQDFARVAELIASGKIAEVVR |
Ga0187885_105132122 | 3300018025 | Peatland | IRSVCPTMEKDRVMYGDFARIAALIAGGKVAAVLR |
Ga0187788_102563172 | 3300018032 | Tropical Peatland | MIKPGKRGQAAYSAIRSVCPTMDKDRVMYGDFERIARLIADGKLAQLLR |
Ga0187867_107585511 | 3300018033 | Peatland | IRAVCATMDKDRVMYQDFARVAELIGSGKLAAVLR |
Ga0187863_101399981 | 3300018034 | Peatland | KTSKRGQMAHAAIRSVCPTMEKDRVMYGDFARIAALIASGRVAETLR |
Ga0187875_105550302 | 3300018035 | Peatland | AVRAVCATMEKDRVMYQDFARIAEVIARGDLAHVLC |
Ga0187883_103669801 | 3300018037 | Peatland | AIRAVCPTVDKDRVMYKDFARLAELIANGKVAEVAR |
Ga0187883_104043341 | 3300018037 | Peatland | LKTSKPLQQAHAAIRAVCATMDRDRVMYQDFARIAELIASGKVAEALR |
Ga0187855_106940691 | 3300018038 | Peatland | GQAAHAAIRSVCPTMEKDRVMYKDFERLAELIASGKVAKVLL |
Ga0187859_100505981 | 3300018047 | Peatland | LAPLKTSKPLRQAHASIRAVCATMDRDRVMYQDFARIAELIASGKVAEALR |
Ga0187859_101365791 | 3300018047 | Peatland | IDFLAPLKTSKRGQAAHAAIRSVCPTVEKDRVMYKDFARIAELIASRKVAEVIS |
Ga0187766_100173701 | 3300018058 | Tropical Peatland | QAAQTAIRSVCPTMEKDRVMYADLARIANLIATDKLANIIR |
Ga0187765_112705652 | 3300018060 | Tropical Peatland | LKTSKRGLSAHAAIRAVCPTMEKDRVVYADLARIAEVIRSGKLAEVLR |
Ga0187784_115245871 | 3300018062 | Tropical Peatland | IGFLAPLKTSRRGQAAHSAIRSVCATMERDRALYGDFARIAEMIAIGKLAEALR |
Ga0187772_103222771 | 3300018085 | Tropical Peatland | PSRALQQAHSAIRSVCATMDKDRVMYGDFVKVAEVIASGKLSAVLGKA |
Ga0187772_109399491 | 3300018085 | Tropical Peatland | LQQAHAAIRSICPTMDRDRVMYADFARIAEVIGNGKLAELVQ |
Ga0187769_106085631 | 3300018086 | Tropical Peatland | HTAIRAVCPTVDKDRVMYTDFARIAELIASGRLAEMLR |
Ga0187769_107741362 | 3300018086 | Tropical Peatland | AIRSVCPTMDKDRVMYQDFAKIAELIASRNLADALR |
Ga0187770_112544002 | 3300018090 | Tropical Peatland | LDFLLPLKPSKRGQAAYAAIRSVCATVEKDRVFYGDIARAAEMIASGKVADALR |
Ga0187798_15555271 | 3300019275 | Peatland | SKRAQAAHAAIRSVCPTMDKDRVMYQDFAKIAELIASRNLADALR |
Ga0187797_18866521 | 3300019284 | Peatland | PSKRGQAAYAAIRSVCPTMNKDRVMYQDFAKIAELIASRNLADALR |
Ga0137408_13566471 | 3300019789 | Vadose Zone Soil | AAHAAIRAVCPTMDRDRVMYQDFVRIAEVIADGKVAEVLR |
Ga0193727_11232142 | 3300019886 | Soil | LKTSKPLQHAHAAIREVCATMDKDRVMYKDFARIAEVIAAGKVAEAAR |
Ga0210407_110167771 | 3300020579 | Soil | HAAIRAVCATMEKDRVMYRDFARIADLIASGKLADVVR |
Ga0210401_103806863 | 3300020583 | Soil | SKRGQAAHAAIRSVCPTMDKDRVMYQDFARIAELVASGKVADALR |
Ga0210406_102800643 | 3300021168 | Soil | HPSVCPTMEKDRVMYKDFARIAELIAGGKVADALL |
Ga0210400_115769232 | 3300021170 | Soil | IRSVCPTMDKDRVMYQDFARIAELIASGRMAEVLR |
Ga0210405_107890971 | 3300021171 | Soil | TSKRGQAAHAAIRSVCATMDKDRVMYQDFARIAELIASGKVAAALK |
Ga0210408_107217272 | 3300021178 | Soil | GQAAHAAIRSVCATMDRDRVMYQDFARIAELIASGKVAEALR |
Ga0210408_109111022 | 3300021178 | Soil | KPLQQAHAAIRAVCATMEKDRVMYQDFARIAALIASGKVAEVVR |
Ga0210408_112465031 | 3300021178 | Soil | IDFLAPLKTSKPLQQAHAAIRAVCATMDKDRVMYQDFARIAETIAAGAIGEILR |
Ga0210385_104173412 | 3300021402 | Soil | LKTSKPLQQTHGAIRSVCATMEKDRVMYQDFARIADLIASGKIAAVVR |
Ga0210385_110056142 | 3300021402 | Soil | KRGQAAHAAIRSVCATMDKDRVMYQDFARIAELIASGKVAAALK |
Ga0210387_103515604 | 3300021405 | Soil | LKSSKPGQAAHAAIRSVCPTMETDRVMYKDLERISTLIASGKVAEAIR |
Ga0210387_103766041 | 3300021405 | Soil | LDFLAPLKTSKRGQAAHTAIRSVCPTMEKDRVMYADFARLAEFIASGKIAEALR |
Ga0210383_109534032 | 3300021407 | Soil | APLKTSKPLRQAHAAIRSVCATMEKDRVMYKDFANIADLIASRELAKLVR |
Ga0193695_11050862 | 3300021418 | Soil | LPLKTSKRGQAAHAAIRSVCATMEKDRVMYQDFARIAALIASGKVAEALR |
Ga0210394_105927011 | 3300021420 | Soil | LKTSKRGQAAHAAIRSVCATMEKDRVMYKDFARLAELIASGKVAEALR |
Ga0210384_114474112 | 3300021432 | Soil | AHAAIRSVCATMDKDRVMYKDFARVADLIASGKVAEALR |
Ga0210384_116837091 | 3300021432 | Soil | SKRGQTAHAAIRSVCATMDRDRVMYHDFVRIAELIASGKVAEMLR |
Ga0210391_100136571 | 3300021433 | Soil | LAPLKTSKPLQKAHAAIRTVCASMDKDRVMYQDFARIAQLIAGGKLAALVR |
Ga0210391_102955061 | 3300021433 | Soil | QAAHAAIRSVCATMETDRVMYQDFARLAELIASGKLAEILR |
Ga0210391_107224223 | 3300021433 | Soil | IRSVCPTMEKDRVMYADFARIATLISRGEVAEALR |
Ga0210390_106632271 | 3300021474 | Soil | LAPLKTSKPLQQTHGAIRSVCATMEKDRVMYQDFARIADLIVSGKIAAVVR |
Ga0210398_114207291 | 3300021477 | Soil | YLHAAMPLKTSKRGQVAHTTIRSVCATMEKDRVMYQDFARLAELIASGKLAQIVR |
Ga0210410_116216611 | 3300021479 | Soil | KRGQAAQAAIRSVCPTMEKDRVMYADFARIATLISRGEVAEALR |
Ga0210409_101168821 | 3300021559 | Soil | AAHAAIRAVCPTMEKDRVMYKDLERIAGVIQSGKIAEVVR |
Ga0210409_101637751 | 3300021559 | Soil | AAIRSVCATMDKDRVMYQDFARIAELIASGKVAAALK |
Ga0126371_110566962 | 3300021560 | Tropical Forest Soil | LLAPLKTSKRLQQAHTAIRSVSAKLEKDRVMYSDFAKIAEVIASGKVAAALR |
Ga0224548_10075391 | 3300022518 | Soil | NRGQAAYAAVRSVCLTMDKDRVMYPDFARIAALIASGKVAQTLR |
Ga0242669_10302573 | 3300022528 | Soil | LKTSKRGQAAHAAIRSVCAPMEKDRVMYADLERTAELIAKGKVAAALA |
Ga0242660_11601381 | 3300022531 | Soil | QAAHAAIRSVCAPIEKDRVMYADLERTAELIAKGKVAAALA |
Ga0224550_10213342 | 3300022873 | Soil | AAHAAIRGVCPTVDKDRVMYKDFARIAELIGSGKVAEVIR |
Ga0208688_10342841 | 3300025480 | Peatland | IRAVCATMDKDRVMYQDFARIAELIASGKVAEVLR |
Ga0208356_10632441 | 3300025504 | Arctic Peat Soil | RGQAAYAAIRSVSPTMEKDRVMYEDFAKIAELISNKTIADVLR |
Ga0208691_10057833 | 3300025612 | Peatland | QAAQTAIRSVCPTVNKDRIMYKDFARIAELIASGKLAAPLR |
Ga0208691_10697552 | 3300025612 | Peatland | MAAYAAIRSVCPTMDKDRVMYQDFARIADLIASGKVAEVLK |
Ga0207642_100180371 | 3300025899 | Miscanthus Rhizosphere | AAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207680_107612341 | 3300025903 | Switchgrass Rhizosphere | AIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207663_112573751 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KTSKRGQAAHAAIRAVCATMNIDRVMYQDFARISDLIASGKVAAALR |
Ga0207646_101362141 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AHAAIRSVSPTMDKDRVMYGDFARIADVIAARKLVESLF |
Ga0207681_101958271 | 3300025923 | Switchgrass Rhizosphere | KLLQQAHAAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207650_119051952 | 3300025925 | Switchgrass Rhizosphere | LIAPLATSKRGQRARAAIRSVSPKLDKDRVMYQDFVRIADVIASGKIQEALE |
Ga0207659_101539191 | 3300025926 | Miscanthus Rhizosphere | IRGVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207664_104194911 | 3300025929 | Agricultural Soil | KRGQAAHAAIRGVCPTMEKDRVMYPDLARIVGLISSGKVAEVLR |
Ga0207664_113574541 | 3300025929 | Agricultural Soil | LAPLKTSKRGQAAHAAIRSVCPTMQKDRVMYTDFARLATLIAGGKVAEALR |
Ga0207644_100528384 | 3300025931 | Switchgrass Rhizosphere | QAHAAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207706_103245401 | 3300025933 | Corn Rhizosphere | PLKTSKLLQQAHAAIRGVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207706_117117161 | 3300025933 | Corn Rhizosphere | ATSKRGQRARAAIRSVSPKLDKDRVMYQDFVRIADVIASGKIQEALE |
Ga0207686_101216582 | 3300025934 | Miscanthus Rhizosphere | APLATSKRGQRARAAIRSVSPKLDKDRVMYQDFVRIADVIASGKIQEALE |
Ga0207665_104041251 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | FLAPLKTSKRLQSAHAAIRSVCPTMDKDRVMYSDFGRITELIAGQRLAQVLL |
Ga0207665_107015202 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AAIRAVSNSLERDRVMYQDFARIAEVIASGKVAEALR |
Ga0207689_103313881 | 3300025942 | Miscanthus Rhizosphere | HAAIRGVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207661_104863481 | 3300025944 | Corn Rhizosphere | TSKRGLIAHNAIRAVCPTMEKDRVMYHDFARIADVIASGKIADALR |
Ga0207667_118202901 | 3300025949 | Corn Rhizosphere | IRAVCPTMEKDRVMYQDFARIADVIATGKIADALR |
Ga0207658_107263972 | 3300025986 | Switchgrass Rhizosphere | GQMAHAAIRSVCATMDKDRVMYQDFARIAELIASGKVVEALR |
Ga0207677_100227721 | 3300026023 | Miscanthus Rhizosphere | KTSKLLQQAHAAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207677_102835443 | 3300026023 | Miscanthus Rhizosphere | LQQAHAAIRGVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207703_107591992 | 3300026035 | Switchgrass Rhizosphere | QAHAAIRGVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0207641_104826601 | 3300026088 | Switchgrass Rhizosphere | LQQAHAAIRAVCPTMEKDRVMYKDFARISELLASGKVAEAVR |
Ga0209471_10242681 | 3300026318 | Soil | AAIRSVSPTMDKDRVMYGDFARIADVIAARKLVESLL |
Ga0209801_12109431 | 3300026326 | Soil | KRGQKAFQEIRSVCPTMDKDRVMYRDFARIADLISGGKLAEVLA |
Ga0255350_11027771 | 3300026502 | Soil | APLKPSKPLQQAHSAIRAVCATMEKDRVMYQDFARIAEVIATGKVAAALR |
Ga0257158_10979791 | 3300026515 | Soil | LAPLKTSKRGQAAHTAIRSVCPTMEKDRVMYADFARLAEFIASGKIAEALR |
Ga0209156_100325415 | 3300026547 | Soil | SKRGQTAHAAIRAVCPTMDKDRAMSGDFVRLAELIQRGKLAEVLR |
Ga0209577_102768133 | 3300026552 | Soil | SKRGQAAHAAIRAVCPTMDRDRVMYQDFVRIAEVIASGKVAEVLR |
Ga0179587_111668931 | 3300026557 | Vadose Zone Soil | AHAAIRSVCPTVEKDRVMYKDFARLAELIGSGKLAETIR |
Ga0209730_10040521 | 3300027034 | Forest Soil | IRVASPKLEKDRVMYQDFARIAEVIASGKVAAAIR |
Ga0207948_10389401 | 3300027174 | Forest Soil | IRAVSPALEKDRVMYQDFARIADVITAGKLAEALR |
Ga0207777_10053834 | 3300027330 | Tropical Forest Soil | GQAAHEAIRSACPAMEKDRVMYQDFARIAALIASGKVAQTLR |
Ga0209010_10164263 | 3300027370 | Forest Soil | SKRGQAAHGAIRAVCATMEKDRVMYKDFARLAELIASGSVAAVLP |
Ga0209010_10744981 | 3300027370 | Forest Soil | SKRGQAAHGAIRAVCATMEKDRVMYKDFARLAELIAGGSVAEVLR |
Ga0209622_10620733 | 3300027502 | Forest Soil | TSKRGQAAQAAIRSVCPSMEKDRVMYADFARIAALIASGKVAEALR |
Ga0209008_10518501 | 3300027545 | Forest Soil | HAAIRSVCAIMEKDRVMYQDFERISELIAGGKLAAVLQ |
Ga0209222_11039891 | 3300027559 | Forest Soil | KPLQQAHAAIRSVCATMEKDRVMYQDFVRIAELIASGKIAAVLR |
Ga0209735_10790941 | 3300027562 | Forest Soil | TSKPLQQAHAAIRAVCATMEKDRVMYRDFARIAVLIASGKLADVVR |
Ga0209625_10668373 | 3300027635 | Forest Soil | KTSKRGQAAHTAIRSVCPTMEKDRVMYADFARLAGFIASGKIAEALR |
Ga0209117_11750081 | 3300027645 | Forest Soil | FLAPLNTSKRGQAAQAAIRSVCPTMEKDRVMYGDFARIAALIASGKVAEALR |
Ga0209118_10656821 | 3300027674 | Forest Soil | QQAHAAIRSVCATMEKDRVMYQDFARIAALIASGKVAEVVR |
Ga0209011_11976922 | 3300027678 | Forest Soil | HAAIRSVCRTMEKDRVMYQDFARIAELIASGKVAAVVR |
Ga0209139_100400891 | 3300027795 | Bog Forest Soil | AHAAIRSVCATMDKDRVMYKDFANISELIASRELAKLVR |
Ga0209040_103347483 | 3300027824 | Bog Forest Soil | LQRAHVAIRSVCAVMQKDRVMYRDFARISELIASGRLAAVLQ |
Ga0209274_101141433 | 3300027853 | Soil | IRSVCPTMDKDRVMYQDFARIADLIASGKVAAVLK |
Ga0209517_100660851 | 3300027854 | Peatlands Soil | GQAAVAAIRSVCPAMEKDRAMSGDFAGVAELVASGKLAEAIR |
Ga0209517_102835042 | 3300027854 | Peatlands Soil | KTSKRGQAAHSAIRSVCPTVDKDRVMYKDLARLSELIASGKLAETSK |
Ga0209167_100909922 | 3300027867 | Surface Soil | IRSVCPMVEKDRVMYKDFESISELIASGKIAQVIR |
Ga0209167_105660652 | 3300027867 | Surface Soil | QAAHAAIRSVCPTMDKDRVMYQDFARIAELIASGKVAAALR |
Ga0209167_106784213 | 3300027867 | Surface Soil | IRAVSPKMEKDRVMYEDFARIAEVIASGKISDTLA |
Ga0209167_108119732 | 3300027867 | Surface Soil | GQAAHAAIRSVCPTMEHDRVMYGDLARIADLLASGKIAEALR |
Ga0209579_103900422 | 3300027869 | Surface Soil | KRLQQAQAAIRSVSAKLEKDRVMYPDFVKIADVIANGKVAAALR |
Ga0209590_103940182 | 3300027882 | Vadose Zone Soil | HAAIRSVCPTVEKDRVMYKDFARIAELIASGKLAEMVR |
Ga0209380_105846731 | 3300027889 | Soil | SKRGQAAHAAIRSVCATMDTDRVMYQDFARLAELIASGKLAEILR |
Ga0209068_101132931 | 3300027894 | Watersheds | KTSKLLQQAHAAIRAVCATMEKDRVMYQDFARIAEMIAAGKVAQALQ |
Ga0209068_101816472 | 3300027894 | Watersheds | QAAHAAIRSVCATMDKDRVMYQDFARVADLIASGKVAEALR |
Ga0209415_106245972 | 3300027905 | Peatlands Soil | KRGQAAHAAIRAVCPTMDKDRVMYNDLARIAEVIRSGKLAEVLR |
Ga0209006_105057562 | 3300027908 | Forest Soil | KPLQRAHAAIRSVCAIMEKDRVMYQDFERISELIAGGKLAAVLQ |
Ga0209698_100157028 | 3300027911 | Watersheds | AIRSVCATMEKDRVMYPDFARIAELIAGGKVSAVLQ |
Ga0209526_101188364 | 3300028047 | Forest Soil | AAIRSVCPTMEKDRVMYGDFARIAALIASGKVAEALR |
Ga0209526_103070203 | 3300028047 | Forest Soil | QASHAAIRSVCSTMEKDRVMYQDFARIAELIASGKVADALR |
Ga0302152_101384671 | 3300028572 | Bog | SKALQQAHAAIRTVSAPMDKDRVMYQDFARIAELIASGRIAAVLR |
Ga0307282_104807232 | 3300028784 | Soil | LAPLKTSTRGQAAHSAIRAVCATMGKDRIMYPDFARIAKLIETGKISAVLD |
Ga0302189_104441181 | 3300028788 | Bog | GQAAHAAIRSVCPIVDKDRVMYKDFAKLAELIASGRVAEVLR |
Ga0307504_102259701 | 3300028792 | Soil | AHAAIRSVCPTIEKDRVMYTDVARTAELITEGKIAAALM |
Ga0302221_102348691 | 3300028806 | Palsa | SKSGQAAYTAIRSVCPTVEKDRVFYGDITRTSEIIASGKVAEALR |
Ga0308309_100393911 | 3300028906 | Soil | PLKTSKPLQKAHAAIRTVCASMDKDRVMYQDFARIAQLIAGGKLAALVR |
Ga0308309_100757441 | 3300028906 | Soil | AIRSVCPTMDKDRVMYQDFARIAELIANAKISAILD |
Ga0308309_104529041 | 3300028906 | Soil | IRSVCPTMDKDRVMYRDFARIADLIASGKVAEALR |
Ga0308309_104670923 | 3300028906 | Soil | AHAAIRSVCPTIAKDRVMYPDVARVAEMIGAGKLAATLR |
Ga0222749_108304111 | 3300029636 | Soil | PLKTSKRGQAAHAAIRSVCPTMEKDRVMYEDFARIATLIASGKVAETLR |
Ga0311371_103817791 | 3300029951 | Palsa | AIRSVCPTVEKDRVFYGDITRTSEIIASGKVAEALR |
Ga0311371_111605172 | 3300029951 | Palsa | LQQAHAAIRAVCATIEKDRVMYQDVSRVADLIASGKLAGLVR |
Ga0311336_111938361 | 3300029990 | Fen | TSKPLQHAHAAIRAVCATMDKDRVMYQDFARISEAVAAGKIVEALR |
Ga0302304_102114733 | 3300029993 | Palsa | DFLAPLKTSKRGQMAHASIRSVCPTMEKDRVMYGDFARIAALLGSGKVAEALR |
Ga0311339_118457872 | 3300029999 | Palsa | DFLAPLKTSKPLQQAHAAIRAVCATMANDRVMYQDFARIAESIASGKIAAALR |
Ga0311339_119718442 | 3300029999 | Palsa | AHAAIRSVCATMVNDRVMYQDFARIARLIAGGKLAAVVR |
Ga0311338_120189182 | 3300030007 | Palsa | MAAAQAIDFYLHGEKALKTSKRGQAAHGAIRAVCATMEKDRVMYKDFARLAELIAGGSVDALLR |
Ga0302176_100366492 | 3300030057 | Palsa | TSKRGQAAHAAIRGVCPTVDKDRVMYKDFARIAELIGSGKVAEVIR |
Ga0302192_102376812 | 3300030507 | Bog | TSKALQQAHAAIRTVSAPMDKDRVMYQDFARIAELIASGRIAAVLR |
Ga0311356_100490726 | 3300030617 | Palsa | RGQAAHAAIRSVCPTVEKDRVMYQDFVRVAELIAGGKVAGVLR |
Ga0311354_100262351 | 3300030618 | Palsa | HAAIRGVSATMEADRVMYQDFTRIADLIATGRLAALVR |
Ga0310039_101223461 | 3300030706 | Peatlands Soil | APLKTSKPLQQAHAAIRAVCATMDRDRVMYQDFARIAELIASGKVTEALR |
Ga0310038_100025371 | 3300030707 | Peatlands Soil | KRGQAVHAAIRSVSPTMDKDRAMYGDFARIAELIGSGKVAEALR |
Ga0265762_11097771 | 3300030760 | Soil | PLKTGKRGLAAYAAIRSVCPTMDKDRVMYQDFARISELIASGKVAEALK |
Ga0311366_109633581 | 3300030943 | Fen | KTSKPLQHAHAAIRAVCATMDKDRVMYQDFARISEAVAAGKIVEALR |
Ga0311366_112417851 | 3300030943 | Fen | SIRGQAAHEAIRSVCPTMEKDRVMYEDFVKIAEVIASRKIADVFR |
Ga0265773_10201222 | 3300031018 | Soil | AIRSVCPTMDKDRVMYQDFARIAELIANGKVAEALR |
Ga0170834_1072099362 | 3300031057 | Forest Soil | LKTSKPGQSAHAAIRSVCPTMEKDRVMYADFARLAEFIASGKIAEALR |
Ga0170834_1103299141 | 3300031057 | Forest Soil | LDFLAPLKTPKRGQAAHAAIRSVCSTMEKDRVMYADFARIAKLIAAGRVAEVLR |
Ga0170834_1135205222 | 3300031057 | Forest Soil | DFVAPLKTGPRGRKAHEAIRSVCATMEKDRVMYEDFARTAKLIADGKVAAALR |
Ga0265760_103163002 | 3300031090 | Soil | AAYAAIRSVCPTMDKDRVMYRDFARIAELIASGKVAEVLK |
Ga0170824_1102338071 | 3300031231 | Forest Soil | AAIRSVCPTMEKDRVMYKDFARIAELIAAGKVAEALR |
Ga0302325_103142825 | 3300031234 | Palsa | HAAIRAVCRTMEKDRVMYQDFARIAELIASGKLAAMVR |
Ga0302324_1013478862 | 3300031236 | Palsa | SKPLQRAHTAIRAVCATMEKDRVMYQDFVRISELIASGKLAELVR |
Ga0302140_104194623 | 3300031261 | Bog | IRSVSAPMDKDRVMYQDFARIAELIASGRIAAVLR |
Ga0170820_142063801 | 3300031446 | Forest Soil | AAIRSVSATMDKDRVMYQDFVRIADLIASGKVAEALR |
Ga0307469_116704471 | 3300031720 | Hardwood Forest Soil | LKTSKALQQAHAAIRSVCTTMDKDRVMYQDFARLAELIAGGKLAEIVR |
Ga0307477_107171753 | 3300031753 | Hardwood Forest Soil | GQTAHAAIRSVCPTMEKDRVMYGDFARLTELIASGKIAAALR |
Ga0307475_100485025 | 3300031754 | Hardwood Forest Soil | KTSKRLQQAHAAIRVVSPKLEKDRVMYQDFARIAEVIASGKVAAALR |
Ga0307475_103187482 | 3300031754 | Hardwood Forest Soil | QAHAAIRAVSAKLEKDRVMYPDFVKIAEVIASGKVAAALR |
Ga0307475_103330641 | 3300031754 | Hardwood Forest Soil | LAPLKTSKRLQQAHAAIRAVSAKIEKDRVMYQDFARIAEVIAMGKVASALR |
Ga0307475_108234601 | 3300031754 | Hardwood Forest Soil | AHAAIRSVCRTMEKDRVMYQDFARIAALIASGKVAEVVR |
Ga0318568_108795181 | 3300031819 | Soil | LDFLAPLKTSKRLERAHAAIRAVCATMNKDRVMYHDFVRIAEAIAIGKLAEPLR |
Ga0307473_110515041 | 3300031820 | Hardwood Forest Soil | PLKTSKPLQQAHAAIRAVCRTMEKDRVMYQDFARIAALIASGKVAEVVR |
Ga0307478_102796642 | 3300031823 | Hardwood Forest Soil | IRSVCPTVDKDRVMYKDFARLSELIASGMMAEIIR |
Ga0307478_104698571 | 3300031823 | Hardwood Forest Soil | PLRTGNRGQKAHQAIRSVCPAMDKDRVMYEDFARTAKLIADGKVAEALR |
Ga0302322_1021147502 | 3300031902 | Fen | QAAHAAIRTVCATMDKDRVMYKDFARISDLIASGKVAEALR |
Ga0306921_103394311 | 3300031912 | Soil | AAIRAVCATMNKDRVMYHDFVRIAEAIAIGKLAEPLR |
Ga0308175_1001964631 | 3300031938 | Soil | QAAYTAIRSVCPSMEKDRVMYMDFARISDLLASGRIAEALR |
Ga0307479_115004982 | 3300031962 | Hardwood Forest Soil | CAAIRAVSPKMEKDRVMYEDFARIAEVIANGKISNALA |
Ga0306922_123752141 | 3300032001 | Soil | LDFLAPLKTSKLGQQAHTANRSACPPIEKDRVMYQDIARVADLIASGKVAAVLR |
Ga0318533_101725281 | 3300032059 | Soil | AAYSAIRSVCPTMDKDRVMYGDFERIAQLISSGKLAQVLL |
Ga0311301_103431433 | 3300032160 | Peatlands Soil | HAAIRSVCPTMDKDRVMYEDFARIAELIASGRVAEVLR |
Ga0307471_1000249651 | 3300032180 | Hardwood Forest Soil | GQAAHAAIRSVCATMDKDRVMYQDFARIAELIANAKISAILD |
Ga0307471_1009717241 | 3300032180 | Hardwood Forest Soil | AAIRAVCATMEKDRVMYQDFARIAALIASGKVAEVVR |
Ga0348332_142160741 | 3300032515 | Plant Litter | AIRSVCPTMDKDRVMYQDFARIADLIASGKVAEVLK |
Ga0335085_120979462 | 3300032770 | Soil | AAIREVSPAMENDRVMYGDFARIADAIGTQRLSEILG |
Ga0335082_112070392 | 3300032782 | Soil | KRGQAAHAAIRSVCATMDKDRVMYQDFARLAELIASGKVAAALS |
Ga0335078_100798291 | 3300032805 | Soil | PLRTSKRGQAAHAAIRSVCPTMEKDRVMYPDFARIASLIASGKVAEALR |
Ga0335070_100509191 | 3300032829 | Soil | GGARRIRAVCPTMEKDRVMYQDFARIAEVIAAGKLAKSVR |
Ga0335071_110210971 | 3300032897 | Soil | AIRSVCPTMEKDRVMYQDFARIADMIASGKLANILR |
Ga0335076_116598681 | 3300032955 | Soil | LQAAHAAIRAVCPTMEKDRVMYQDFARIAEVITSGQLAGALR |
Ga0335073_100649731 | 3300033134 | Soil | AHAEIRSIVPTMDRDRVMYQDFARIAEMIGRGRLAEALQ |
Ga0318519_105762921 | 3300033290 | Soil | AIRAVCATMNKDRVMYHDFVRIAEAIAIGKLAEPLR |
Ga0326727_110372622 | 3300033405 | Peat Soil | AIRTVCRTTEKDRVMYQDFARIAELIASGKLAEVVR |
Ga0334854_032318_2_115 | 3300033829 | Soil | AAIRSVCPTMEKDRIMYKDFARIAELIASGKVADVIR |
Ga0334827_030054_12_140 | 3300034065 | Soil | LQQAHAAIRGVCRTMDKDRVMYQDFARLAELIASGKLADVVH |
Ga0370492_0265986_1_150 | 3300034282 | Untreated Peat Soil | PLKTSKRGQAAHAAIRSVCPTMEKDRVMYKDFARLAELMASGKVAEALR |
⦗Top⦘ |