Basic Information | |
---|---|
Family ID | F005931 |
Family Type | Metagenome |
Number of Sequences | 386 |
Average Sequence Length | 43 residues |
Representative Sequence | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT |
Number of Associated Samples | 217 |
Number of Associated Scaffolds | 386 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 85.71 % |
% of genes near scaffold ends (potentially truncated) | 22.54 % |
% of genes from short scaffolds (< 2000 bps) | 80.57 % |
Associated GOLD sequencing projects | 185 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.788 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (11.140 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.674 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.026 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 386 Family Scaffolds |
---|---|---|
PF00486 | Trans_reg_C | 39.64 |
PF07690 | MFS_1 | 16.32 |
PF00557 | Peptidase_M24 | 2.85 |
PF13432 | TPR_16 | 2.33 |
PF13414 | TPR_11 | 1.55 |
PF01321 | Creatinase_N | 1.30 |
PF00005 | ABC_tran | 0.78 |
PF13181 | TPR_8 | 0.78 |
PF12833 | HTH_18 | 0.78 |
PF00497 | SBP_bac_3 | 0.52 |
PF13620 | CarboxypepD_reg | 0.52 |
PF07719 | TPR_2 | 0.52 |
PF00857 | Isochorismatase | 0.52 |
PF04365 | BrnT_toxin | 0.26 |
PF01734 | Patatin | 0.26 |
PF07498 | Rho_N | 0.26 |
PF02371 | Transposase_20 | 0.26 |
PF02954 | HTH_8 | 0.26 |
PF00113 | Enolase_C | 0.26 |
PF00528 | BPD_transp_1 | 0.26 |
PF02653 | BPD_transp_2 | 0.26 |
PF10099 | RskA | 0.26 |
PF12849 | PBP_like_2 | 0.26 |
PF13640 | 2OG-FeII_Oxy_3 | 0.26 |
PF13424 | TPR_12 | 0.26 |
PF01256 | Carb_kinase | 0.26 |
PF02687 | FtsX | 0.26 |
PF13347 | MFS_2 | 0.26 |
PF01464 | SLT | 0.26 |
COG ID | Name | Functional Category | % Frequency in 386 Family Scaffolds |
---|---|---|---|
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 1.30 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.52 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
COG0063 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain | Nucleotide transport and metabolism [F] | 0.26 |
COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.26 |
COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.26 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.26 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.26 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.26 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.26 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.79 % |
Unclassified | root | N/A | 13.21 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459019|G14TP7Y01AZHS7 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2366484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 664 | Open in IMG/M |
3300000531|CNBas_1000057 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
3300000532|CNAas_1000227 | All Organisms → cellular organisms → Bacteria | 5269 | Open in IMG/M |
3300000787|JGI11643J11755_11465783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 530 | Open in IMG/M |
3300000891|JGI10214J12806_12556033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 569 | Open in IMG/M |
3300000956|JGI10216J12902_101491138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
3300000956|JGI10216J12902_101668591 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300000956|JGI10216J12902_108564958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2051 | Open in IMG/M |
3300000956|JGI10216J12902_114924550 | Not Available | 734 | Open in IMG/M |
3300001116|JGI12627J13344_102669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1179 | Open in IMG/M |
3300001464|JGI12363J15224_100189 | All Organisms → cellular organisms → Bacteria | 13600 | Open in IMG/M |
3300003203|JGI25406J46586_10023741 | All Organisms → cellular organisms → Bacteria | 2419 | Open in IMG/M |
3300003203|JGI25406J46586_10217641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 558 | Open in IMG/M |
3300003267|soilL1_10008190 | All Organisms → cellular organisms → Bacteria | 14079 | Open in IMG/M |
3300003267|soilL1_10038977 | All Organisms → cellular organisms → Bacteria | 2626 | Open in IMG/M |
3300003319|soilL2_10097603 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
3300003320|rootH2_10314449 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300003321|soilH1_10005660 | All Organisms → cellular organisms → Bacteria | 4018 | Open in IMG/M |
3300003999|Ga0055469_10003187 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
3300004016|Ga0058689_10125323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 569 | Open in IMG/M |
3300004081|Ga0063454_101133775 | Not Available | 641 | Open in IMG/M |
3300004114|Ga0062593_100249621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1465 | Open in IMG/M |
3300004114|Ga0062593_100317086 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300004114|Ga0062593_101152333 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
3300004114|Ga0062593_101712802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 687 | Open in IMG/M |
3300004114|Ga0062593_101975639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 647 | Open in IMG/M |
3300004156|Ga0062589_100127038 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
3300004156|Ga0062589_100927770 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300004156|Ga0062589_101897129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 601 | Open in IMG/M |
3300004157|Ga0062590_101806034 | Not Available | 627 | Open in IMG/M |
3300004479|Ga0062595_100328452 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300004479|Ga0062595_101307294 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300004479|Ga0062595_101741117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 589 | Open in IMG/M |
3300004479|Ga0062595_102092205 | Not Available | 550 | Open in IMG/M |
3300004480|Ga0062592_101527986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 642 | Open in IMG/M |
3300004643|Ga0062591_100354069 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300004643|Ga0062591_100728719 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300004643|Ga0062591_101138782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 755 | Open in IMG/M |
3300005093|Ga0062594_102017235 | Not Available | 617 | Open in IMG/M |
3300005093|Ga0062594_102368599 | Not Available | 579 | Open in IMG/M |
3300005184|Ga0066671_10020937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2890 | Open in IMG/M |
3300005238|Ga0073692_1040934 | Not Available | 758 | Open in IMG/M |
3300005288|Ga0065714_10002276 | All Organisms → cellular organisms → Bacteria | 28876 | Open in IMG/M |
3300005289|Ga0065704_10075325 | All Organisms → cellular organisms → Bacteria | 5644 | Open in IMG/M |
3300005290|Ga0065712_10492327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 655 | Open in IMG/M |
3300005293|Ga0065715_10126145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2115 | Open in IMG/M |
3300005293|Ga0065715_10198114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1376 | Open in IMG/M |
3300005293|Ga0065715_10459588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 817 | Open in IMG/M |
3300005293|Ga0065715_10463669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 813 | Open in IMG/M |
3300005293|Ga0065715_10694444 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300005294|Ga0065705_10009779 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
3300005294|Ga0065705_11015623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 543 | Open in IMG/M |
3300005295|Ga0065707_10961925 | Not Available | 549 | Open in IMG/M |
3300005331|Ga0070670_100000358 | All Organisms → cellular organisms → Bacteria | 38172 | Open in IMG/M |
3300005331|Ga0070670_100016693 | All Organisms → cellular organisms → Bacteria | 6301 | Open in IMG/M |
3300005331|Ga0070670_100308270 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
3300005331|Ga0070670_100896825 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300005331|Ga0070670_101845664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 557 | Open in IMG/M |
3300005332|Ga0066388_102459296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300005332|Ga0066388_102834594 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300005334|Ga0068869_100403548 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300005334|Ga0068869_100824576 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300005336|Ga0070680_101586359 | Not Available | 567 | Open in IMG/M |
3300005337|Ga0070682_100003227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9042 | Open in IMG/M |
3300005337|Ga0070682_100261900 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300005338|Ga0068868_101134026 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005338|Ga0068868_101384408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 656 | Open in IMG/M |
3300005341|Ga0070691_10272636 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300005345|Ga0070692_10020046 | All Organisms → cellular organisms → Bacteria | 3236 | Open in IMG/M |
3300005345|Ga0070692_10248879 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300005354|Ga0070675_100439174 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300005364|Ga0070673_100121973 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
3300005364|Ga0070673_100708610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 925 | Open in IMG/M |
3300005364|Ga0070673_100963780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 793 | Open in IMG/M |
3300005364|Ga0070673_101636774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 609 | Open in IMG/M |
3300005365|Ga0070688_101076332 | Not Available | 642 | Open in IMG/M |
3300005406|Ga0070703_10531163 | Not Available | 534 | Open in IMG/M |
3300005438|Ga0070701_10055428 | All Organisms → cellular organisms → Bacteria | 2071 | Open in IMG/M |
3300005438|Ga0070701_10714102 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300005440|Ga0070705_100092141 | All Organisms → cellular organisms → Bacteria | 1891 | Open in IMG/M |
3300005440|Ga0070705_100363430 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300005440|Ga0070705_100385295 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300005440|Ga0070705_101642676 | Not Available | 542 | Open in IMG/M |
3300005441|Ga0070700_100093546 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
3300005441|Ga0070700_100344998 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300005441|Ga0070700_101966593 | Not Available | 507 | Open in IMG/M |
3300005441|Ga0070700_101971606 | Not Available | 506 | Open in IMG/M |
3300005444|Ga0070694_100328751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
3300005444|Ga0070694_100644537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
3300005444|Ga0070694_101560680 | Not Available | 560 | Open in IMG/M |
3300005458|Ga0070681_10052420 | All Organisms → cellular organisms → Bacteria | 4068 | Open in IMG/M |
3300005458|Ga0070681_10338122 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
3300005458|Ga0070681_10710970 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300005458|Ga0070681_10795495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 863 | Open in IMG/M |
3300005459|Ga0068867_100034816 | All Organisms → cellular organisms → Bacteria | 3651 | Open in IMG/M |
3300005466|Ga0070685_10907340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 656 | Open in IMG/M |
3300005467|Ga0070706_100000044 | All Organisms → cellular organisms → Bacteria | 146303 | Open in IMG/M |
3300005468|Ga0070707_100020631 | All Organisms → cellular organisms → Bacteria | 6218 | Open in IMG/M |
3300005468|Ga0070707_100888201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
3300005471|Ga0070698_100074685 | All Organisms → cellular organisms → Bacteria | 3395 | Open in IMG/M |
3300005530|Ga0070679_101156972 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300005536|Ga0070697_101089601 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300005539|Ga0068853_100521294 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300005545|Ga0070695_100478614 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300005545|Ga0070695_101007267 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300005545|Ga0070695_101235012 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300005545|Ga0070695_101475257 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005545|Ga0070695_101518603 | Not Available | 558 | Open in IMG/M |
3300005545|Ga0070695_101720519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 525 | Open in IMG/M |
3300005546|Ga0070696_100464663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
3300005546|Ga0070696_101922741 | Not Available | 513 | Open in IMG/M |
3300005546|Ga0070696_101963208 | Not Available | 508 | Open in IMG/M |
3300005547|Ga0070693_100075373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1997 | Open in IMG/M |
3300005547|Ga0070693_100704469 | Not Available | 740 | Open in IMG/M |
3300005549|Ga0070704_100108500 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
3300005549|Ga0070704_101748666 | Not Available | 575 | Open in IMG/M |
3300005563|Ga0068855_100113506 | All Organisms → cellular organisms → Bacteria | 3108 | Open in IMG/M |
3300005564|Ga0070664_101533425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 631 | Open in IMG/M |
3300005566|Ga0066693_10374331 | Not Available | 576 | Open in IMG/M |
3300005577|Ga0068857_100196609 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
3300005577|Ga0068857_100472321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
3300005577|Ga0068857_100629560 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300005577|Ga0068857_101495224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 658 | Open in IMG/M |
3300005577|Ga0068857_101567471 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300005578|Ga0068854_100137339 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
3300005615|Ga0070702_101286733 | Not Available | 593 | Open in IMG/M |
3300005615|Ga0070702_101880625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 501 | Open in IMG/M |
3300005617|Ga0068859_100261270 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300005617|Ga0068859_102219810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 606 | Open in IMG/M |
3300005618|Ga0068864_100147188 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
3300005618|Ga0068864_101355055 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
3300005618|Ga0068864_101659860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 643 | Open in IMG/M |
3300005618|Ga0068864_101711927 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300005618|Ga0068864_102639883 | Not Available | 508 | Open in IMG/M |
3300005719|Ga0068861_100527217 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300005841|Ga0068863_100468494 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300005841|Ga0068863_101683913 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300005842|Ga0068858_100429802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
3300005843|Ga0068860_101325730 | Not Available | 741 | Open in IMG/M |
3300005844|Ga0068862_101512819 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300005873|Ga0075287_1025304 | Not Available | 755 | Open in IMG/M |
3300005878|Ga0075297_1010101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 906 | Open in IMG/M |
3300005884|Ga0075291_1009298 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300005985|Ga0081539_10122522 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300006049|Ga0075417_10164484 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300006169|Ga0082029_1183833 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
3300006169|Ga0082029_1418406 | All Organisms → cellular organisms → Bacteria | 2463 | Open in IMG/M |
3300006169|Ga0082029_1466184 | All Organisms → cellular organisms → Bacteria | 50214 | Open in IMG/M |
3300006169|Ga0082029_1620731 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300006173|Ga0070716_100817121 | Not Available | 723 | Open in IMG/M |
3300006237|Ga0097621_100009220 | All Organisms → cellular organisms → Bacteria | 7157 | Open in IMG/M |
3300006237|Ga0097621_101137250 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300006358|Ga0068871_101318590 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300006755|Ga0079222_10007832 | All Organisms → cellular organisms → Bacteria | 3708 | Open in IMG/M |
3300006755|Ga0079222_10445553 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300006755|Ga0079222_10483748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 899 | Open in IMG/M |
3300006755|Ga0079222_11136271 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300006755|Ga0079222_11640844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 612 | Open in IMG/M |
3300006806|Ga0079220_10518331 | Not Available | 821 | Open in IMG/M |
3300006806|Ga0079220_10594446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 785 | Open in IMG/M |
3300006806|Ga0079220_11475091 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300006845|Ga0075421_100088846 | All Organisms → cellular organisms → Bacteria | 3894 | Open in IMG/M |
3300006845|Ga0075421_102069229 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300006846|Ga0075430_100675483 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300006846|Ga0075430_100676617 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300006847|Ga0075431_100276286 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
3300006847|Ga0075431_101782266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 572 | Open in IMG/M |
3300006847|Ga0075431_102101401 | Not Available | 519 | Open in IMG/M |
3300006852|Ga0075433_10017457 | All Organisms → cellular organisms → Bacteria | 5944 | Open in IMG/M |
3300006852|Ga0075433_10093988 | All Organisms → cellular organisms → Bacteria | 2653 | Open in IMG/M |
3300006852|Ga0075433_10136749 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
3300006852|Ga0075433_11636741 | Not Available | 555 | Open in IMG/M |
3300006854|Ga0075425_100102105 | All Organisms → cellular organisms → Bacteria | 3261 | Open in IMG/M |
3300006854|Ga0075425_101648486 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300006876|Ga0079217_10011204 | All Organisms → cellular organisms → Bacteria | 2892 | Open in IMG/M |
3300006876|Ga0079217_11160581 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300006894|Ga0079215_10073383 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
3300006903|Ga0075426_10054160 | All Organisms → cellular organisms → Bacteria | 2866 | Open in IMG/M |
3300006904|Ga0075424_100297677 | Not Available | 1717 | Open in IMG/M |
3300006904|Ga0075424_101295982 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300006918|Ga0079216_10222506 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300006954|Ga0079219_10030298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2130 | Open in IMG/M |
3300006954|Ga0079219_10064948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1642 | Open in IMG/M |
3300006954|Ga0079219_10407768 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300007004|Ga0079218_10666160 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300007004|Ga0079218_11730272 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300009101|Ga0105247_10961735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 664 | Open in IMG/M |
3300009101|Ga0105247_11445518 | Not Available | 558 | Open in IMG/M |
3300009147|Ga0114129_12547554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 611 | Open in IMG/M |
3300009148|Ga0105243_12153761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 594 | Open in IMG/M |
3300009162|Ga0075423_10015140 | All Organisms → cellular organisms → Bacteria | 7543 | Open in IMG/M |
3300009174|Ga0105241_10708508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
3300009174|Ga0105241_11376208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 675 | Open in IMG/M |
3300009176|Ga0105242_11181367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 783 | Open in IMG/M |
3300009545|Ga0105237_10104512 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
3300009545|Ga0105237_11623759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 653 | Open in IMG/M |
3300009551|Ga0105238_12775800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 526 | Open in IMG/M |
3300009553|Ga0105249_10125838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2440 | Open in IMG/M |
3300009789|Ga0126307_10706288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 813 | Open in IMG/M |
3300009789|Ga0126307_11130331 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300009792|Ga0126374_10368569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
3300010036|Ga0126305_10553491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 770 | Open in IMG/M |
3300010036|Ga0126305_10883100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 610 | Open in IMG/M |
3300010036|Ga0126305_10905674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 602 | Open in IMG/M |
3300010040|Ga0126308_10897880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 617 | Open in IMG/M |
3300010044|Ga0126310_10839057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 710 | Open in IMG/M |
3300010046|Ga0126384_10136543 | Not Available | 1869 | Open in IMG/M |
3300010166|Ga0126306_11752575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 519 | Open in IMG/M |
3300010358|Ga0126370_10772472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 853 | Open in IMG/M |
3300010359|Ga0126376_11035008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 824 | Open in IMG/M |
3300010360|Ga0126372_11521082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 706 | Open in IMG/M |
3300010375|Ga0105239_10960030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
3300010375|Ga0105239_12578626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 593 | Open in IMG/M |
3300010396|Ga0134126_10896791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 997 | Open in IMG/M |
3300010399|Ga0134127_10265911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
3300010399|Ga0134127_11621687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 721 | Open in IMG/M |
3300010401|Ga0134121_10864459 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300011993|Ga0120182_1009701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 700 | Open in IMG/M |
3300012899|Ga0157299_10087666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 781 | Open in IMG/M |
3300012955|Ga0164298_10598127 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300012957|Ga0164303_10674387 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300012960|Ga0164301_10937841 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300012986|Ga0164304_11634314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 538 | Open in IMG/M |
3300013100|Ga0157373_11061346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 606 | Open in IMG/M |
3300013100|Ga0157373_11242000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 563 | Open in IMG/M |
3300013306|Ga0163162_10489576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1361 | Open in IMG/M |
3300013307|Ga0157372_10142747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2760 | Open in IMG/M |
3300013308|Ga0157375_10184842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2237 | Open in IMG/M |
3300014745|Ga0157377_11521922 | Not Available | 533 | Open in IMG/M |
3300014965|Ga0120193_10044825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 619 | Open in IMG/M |
3300015261|Ga0182006_1323640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 507 | Open in IMG/M |
3300017792|Ga0163161_10942132 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300018422|Ga0190265_10020228 | All Organisms → cellular organisms → Bacteria | 5301 | Open in IMG/M |
3300018422|Ga0190265_10185002 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
3300018422|Ga0190265_11509085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 785 | Open in IMG/M |
3300018422|Ga0190265_13593184 | Not Available | 517 | Open in IMG/M |
3300018429|Ga0190272_11004534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 797 | Open in IMG/M |
3300018432|Ga0190275_10317957 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
3300018466|Ga0190268_10187971 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300018466|Ga0190268_10359183 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300018466|Ga0190268_10622954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 771 | Open in IMG/M |
3300018466|Ga0190268_10978842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 670 | Open in IMG/M |
3300018466|Ga0190268_11605003 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300018469|Ga0190270_13343661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 509 | Open in IMG/M |
3300018476|Ga0190274_10903369 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300018476|Ga0190274_11739267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 718 | Open in IMG/M |
3300019360|Ga0187894_10001309 | All Organisms → cellular organisms → Bacteria | 32175 | Open in IMG/M |
3300019361|Ga0173482_10735873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 515 | Open in IMG/M |
3300019377|Ga0190264_10216093 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
3300020146|Ga0196977_1000225 | All Organisms → cellular organisms → Bacteria | 34201 | Open in IMG/M |
3300021412|Ga0193736_1012159 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300021445|Ga0182009_10002494 | All Organisms → cellular organisms → Bacteria | 5227 | Open in IMG/M |
3300021445|Ga0182009_10025484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2303 | Open in IMG/M |
3300021445|Ga0182009_10085801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1410 | Open in IMG/M |
3300021445|Ga0182009_10122619 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300021445|Ga0182009_10375030 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300021445|Ga0182009_10475663 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300021445|Ga0182009_10775592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 523 | Open in IMG/M |
3300021445|Ga0182009_10823522 | Not Available | 509 | Open in IMG/M |
3300024179|Ga0247695_1007941 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
3300025315|Ga0207697_10504714 | Not Available | 534 | Open in IMG/M |
3300025321|Ga0207656_10017194 | All Organisms → cellular organisms → Bacteria | 2829 | Open in IMG/M |
3300025885|Ga0207653_10142202 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300025899|Ga0207642_10058338 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
3300025900|Ga0207710_10001732 | All Organisms → cellular organisms → Bacteria | 10548 | Open in IMG/M |
3300025900|Ga0207710_10045804 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
3300025900|Ga0207710_10255608 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300025901|Ga0207688_10165398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
3300025904|Ga0207647_10006661 | All Organisms → cellular organisms → Bacteria | 8395 | Open in IMG/M |
3300025908|Ga0207643_10021579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3539 | Open in IMG/M |
3300025908|Ga0207643_10165757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
3300025908|Ga0207643_10987934 | Not Available | 545 | Open in IMG/M |
3300025910|Ga0207684_10000117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 148207 | Open in IMG/M |
3300025911|Ga0207654_10114005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. TLI_235 | 1686 | Open in IMG/M |
3300025911|Ga0207654_10118578 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
3300025911|Ga0207654_10127599 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
3300025911|Ga0207654_10298105 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300025911|Ga0207654_10348312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1019 | Open in IMG/M |
3300025911|Ga0207654_10708451 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300025911|Ga0207654_11058447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 591 | Open in IMG/M |
3300025911|Ga0207654_11222386 | Not Available | 548 | Open in IMG/M |
3300025912|Ga0207707_10747908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 818 | Open in IMG/M |
3300025912|Ga0207707_10900955 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300025918|Ga0207662_10028283 | All Organisms → cellular organisms → Bacteria | 3240 | Open in IMG/M |
3300025918|Ga0207662_10493142 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300025920|Ga0207649_10519346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 908 | Open in IMG/M |
3300025921|Ga0207652_11637585 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300025923|Ga0207681_10074101 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
3300025924|Ga0207694_10017552 | All Organisms → cellular organisms → Bacteria | 5410 | Open in IMG/M |
3300025924|Ga0207694_11161153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 653 | Open in IMG/M |
3300025925|Ga0207650_10000028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 236867 | Open in IMG/M |
3300025925|Ga0207650_10769410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 815 | Open in IMG/M |
3300025925|Ga0207650_11461500 | Not Available | 581 | Open in IMG/M |
3300025930|Ga0207701_10785899 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300025932|Ga0207690_10761068 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300025933|Ga0207706_10449780 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1114 | Open in IMG/M |
3300025933|Ga0207706_10496739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
3300025933|Ga0207706_11561066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 536 | Open in IMG/M |
3300025935|Ga0207709_10030798 | All Organisms → cellular organisms → Bacteria | 3125 | Open in IMG/M |
3300025935|Ga0207709_10599370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 872 | Open in IMG/M |
3300025935|Ga0207709_11252090 | Not Available | 612 | Open in IMG/M |
3300025936|Ga0207670_10372160 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300025938|Ga0207704_11043286 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300025939|Ga0207665_10031787 | All Organisms → cellular organisms → Bacteria | 3493 | Open in IMG/M |
3300025939|Ga0207665_11436396 | Not Available | 549 | Open in IMG/M |
3300025940|Ga0207691_10499765 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300025940|Ga0207691_10510875 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300025941|Ga0207711_11553037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 605 | Open in IMG/M |
3300025942|Ga0207689_10122679 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
3300025942|Ga0207689_10141206 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
3300025942|Ga0207689_11004598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus antarcticus | 704 | Open in IMG/M |
3300025942|Ga0207689_11218825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 633 | Open in IMG/M |
3300025942|Ga0207689_11415462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 582 | Open in IMG/M |
3300025944|Ga0207661_11231878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 688 | Open in IMG/M |
3300025945|Ga0207679_11691894 | Not Available | 579 | Open in IMG/M |
3300025949|Ga0207667_10134154 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
3300025960|Ga0207651_11307290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 652 | Open in IMG/M |
3300025961|Ga0207712_11131724 | Not Available | 697 | Open in IMG/M |
3300025981|Ga0207640_10605423 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300025981|Ga0207640_10854302 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300026035|Ga0207703_10252910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1589 | Open in IMG/M |
3300026035|Ga0207703_11264751 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300026035|Ga0207703_12279426 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 517 | Open in IMG/M |
3300026041|Ga0207639_10951950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 803 | Open in IMG/M |
3300026067|Ga0207678_10810810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 826 | Open in IMG/M |
3300026075|Ga0207708_10088616 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
3300026088|Ga0207641_10256035 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300026088|Ga0207641_10940693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 859 | Open in IMG/M |
3300026088|Ga0207641_11581688 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300026088|Ga0207641_12030622 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300026095|Ga0207676_10229939 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
3300026095|Ga0207676_10323038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1417 | Open in IMG/M |
3300026095|Ga0207676_11635334 | Not Available | 642 | Open in IMG/M |
3300026116|Ga0207674_10713085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 968 | Open in IMG/M |
3300026116|Ga0207674_10798419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 911 | Open in IMG/M |
3300026116|Ga0207674_10951464 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300026535|Ga0256867_10012048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3777 | Open in IMG/M |
3300027266|Ga0209215_1000035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 130044 | Open in IMG/M |
3300027266|Ga0209215_1009166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
3300027326|Ga0209731_1019446 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300027530|Ga0209216_1002951 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
3300027639|Ga0209387_1025508 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
3300027718|Ga0209795_10016225 | All Organisms → cellular organisms → Bacteria | 2762 | Open in IMG/M |
3300027775|Ga0209177_10017659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1717 | Open in IMG/M |
3300027775|Ga0209177_10074840 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300027775|Ga0209177_10136980 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300027880|Ga0209481_10013655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3530 | Open in IMG/M |
3300027886|Ga0209486_10163395 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300027907|Ga0207428_10276989 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300027909|Ga0209382_10227313 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
3300027909|Ga0209382_10492991 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
3300028379|Ga0268266_12087711 | Not Available | 540 | Open in IMG/M |
3300028381|Ga0268264_12094101 | Not Available | 574 | Open in IMG/M |
3300028381|Ga0268264_12332556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 542 | Open in IMG/M |
3300028381|Ga0268264_12494614 | Not Available | 522 | Open in IMG/M |
3300030499|Ga0268259_10112328 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300030511|Ga0268241_10016107 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
3300030511|Ga0268241_10066375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 796 | Open in IMG/M |
3300030511|Ga0268241_10174049 | Not Available | 536 | Open in IMG/M |
3300031455|Ga0307505_10000089 | All Organisms → cellular organisms → Bacteria | 116210 | Open in IMG/M |
3300031548|Ga0307408_100082167 | All Organisms → cellular organisms → Bacteria | 2411 | Open in IMG/M |
3300031716|Ga0310813_10201045 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
3300031716|Ga0310813_10374416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
3300031716|Ga0310813_10544033 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300031716|Ga0310813_10545910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
3300031716|Ga0310813_10594194 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300031716|Ga0310813_10880140 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300031716|Ga0310813_11821175 | Not Available | 572 | Open in IMG/M |
3300031716|Ga0310813_12252570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 516 | Open in IMG/M |
3300031716|Ga0310813_12293117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 512 | Open in IMG/M |
3300031740|Ga0307468_100226189 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
3300031740|Ga0307468_100342958 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300031740|Ga0307468_101706557 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300031852|Ga0307410_11726161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 555 | Open in IMG/M |
3300031854|Ga0310904_11114679 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300031901|Ga0307406_11272405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 641 | Open in IMG/M |
3300031903|Ga0307407_11589655 | Not Available | 519 | Open in IMG/M |
3300031911|Ga0307412_10566002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300031939|Ga0308174_10775363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 804 | Open in IMG/M |
3300031995|Ga0307409_101041471 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300031996|Ga0308176_12996555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 500 | Open in IMG/M |
3300032002|Ga0307416_101388662 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 808 | Open in IMG/M |
3300032144|Ga0315910_10242620 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300033475|Ga0310811_11329334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 567 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.07% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.22% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.40% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.11% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.33% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.07% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.07% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.07% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.30% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.30% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.30% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.30% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.04% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 1.04% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.04% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.78% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.52% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.52% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.26% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.26% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.26% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.26% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.26% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.26% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.26% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.26% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.26% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001116 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 | Environmental | Open in IMG/M |
3300001464 | Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 | Environmental | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005238 | Microbial communities on the surface of aged kaolinite enhanced biochar from soil in Sydney, Australia | Environmental | Open in IMG/M |
3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
3300005878 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104 | Environmental | Open in IMG/M |
3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027530 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4MG_01772860 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGLGH |
ICChiseqgaiiDRAFT_23664842 | 3300000033 | Soil | MIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA* |
CNBas_10000572 | 3300000531 | Quercus Rhizosphere | MINQKRCSEFVETSLIYLLSAAVAVGAFVLVWLLSALLGLGQA* |
CNAas_10002274 | 3300000532 | Quercus Rhizosphere | MINEKKTSDLIETSLIYLLSAGVAVGAFLLVWLIAHLLGLGQA* |
JGI11643J11755_114657832 | 3300000787 | Soil | MLNEKKTSELIETSLIYLLSAAVAAGAFVLVGLVALLFGFSQT* |
JGI10214J12806_125560332 | 3300000891 | Soil | MINEKKTSDLIETSLIYLLSAAVAVGAFLLVWLISHILGLGQA* |
JGI10216J12902_1014911381 | 3300000956 | Soil | MIEEKKTSELVETWLVYLLSVAVAAGAFLLVWFVSLLAGANRA |
JGI10216J12902_1016685912 | 3300000956 | Soil | MMNQKKSSELIETSLIYLLSAVVAAGGFFFVWLVSSLLCLARR* |
JGI10216J12902_1085649582 | 3300000956 | Soil | MINEKKSSDLFETWAIYLLSAAVAAGAFLLVWFISLLASPGAT* |
JGI10216J12902_1149245502 | 3300000956 | Soil | MINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGRGPA* |
JGI12627J13344_1026693 | 3300001116 | Forest Soil | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSTFLGLGQT* |
JGI12363J15224_1001896 | 3300001464 | Soil | MINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSPA* |
JGI25406J46586_100237411 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MINQKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT* |
JGI25406J46586_102176412 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MIDNKKCSDLVETWLIYLLSAAVAVGAFLLVWLISLMTGIGPA* |
soilL1_1000819013 | 3300003267 | Sugarcane Root And Bulk Soil | MINQKKNSELIETSLIYLLSAAVAVGAFVLVWLISMLLGSSQT* |
soilL1_100389773 | 3300003267 | Sugarcane Root And Bulk Soil | MIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLLSTLAGIGWA* |
soilL2_100976032 | 3300003319 | Sugarcane Root And Bulk Soil | MIDHKKSSELLETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT* |
rootH2_103144492 | 3300003320 | Sugarcane Root And Bulk Soil | MINQKKNSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT* |
soilH1_100056603 | 3300003321 | Sugarcane Root And Bulk Soil | ILKVKDLPMIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISTLTGRGWA* |
Ga0055469_100031874 | 3300003999 | Natural And Restored Wetlands | MMNQKKSSELLEASLIYLLSTVVAAGGFFFVWLISSLLCLGCR* |
Ga0058689_101253232 | 3300004016 | Agave | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSQT* |
Ga0063454_1011337752 | 3300004081 | Soil | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHA* |
Ga0062593_1002496211 | 3300004114 | Soil | MINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGSG |
Ga0062593_1003170862 | 3300004114 | Soil | MTDQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA* |
Ga0062593_1011523332 | 3300004114 | Soil | MIEEKKTSELIETWLVYLLSAAVAVGAFLLVWLISALAVPQWS* |
Ga0062593_1017128021 | 3300004114 | Soil | MIDNKKYSDLVETWLIYLLSAAVAVGAFLLVWLISLVTGISAA* |
Ga0062593_1019756392 | 3300004114 | Soil | MINEKKNSEFVETSLIYLLSAAVAVGAFVLVYLISLLLGMGQA* |
Ga0062589_1001270382 | 3300004156 | Soil | MINSKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSLLLGFGQA* |
Ga0062589_1009277702 | 3300004156 | Soil | MIDGKKTSEFVETSLVYLLSAAVAVGAFLLVGLIFLVAGLARS* |
Ga0062589_1018971291 | 3300004156 | Soil | MINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGSGWS* |
Ga0062590_1018060341 | 3300004157 | Soil | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVALLLGSSPT* |
Ga0062595_1003284522 | 3300004479 | Soil | MINEKKNSEVIETSLIYLLSAAVAVGAFILVWLISLLLGSGRA* |
Ga0062595_1013072942 | 3300004479 | Soil | MIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGLSQG* |
Ga0062595_1017411172 | 3300004479 | Soil | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGFGHA* |
Ga0062595_1020922052 | 3300004479 | Soil | MIDEKKSSELLETSLIYLLSAAVAVGAFVLVWLISLLLGFGQA* |
Ga0062592_1015279862 | 3300004480 | Soil | MINQKKTSELIETSLVYLLSTAVALGAFVLVWLVSLLLGSSPT* |
Ga0062591_1003540691 | 3300004643 | Soil | MINEKKNSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA* |
Ga0062591_1007287191 | 3300004643 | Soil | KKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSHT* |
Ga0062591_1011387822 | 3300004643 | Soil | MIDEKKTSEVVETWLVYLLSAAVAVGAFLLVFVISLLASVNGA* |
Ga0062594_1020172352 | 3300005093 | Soil | MINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGPGRS* |
Ga0062594_1023685991 | 3300005093 | Soil | MALKVKDLPMINGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT* |
Ga0066671_100209372 | 3300005184 | Soil | MINDKKTSELIETSLIYLLSAAVAAAAFVLVWLISSLLGFGRA* |
Ga0073692_10409342 | 3300005238 | Soil | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT* |
Ga0065714_1000227620 | 3300005288 | Miscanthus Rhizosphere | MINEKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGFGQA* |
Ga0065704_100753253 | 3300005289 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFFGLSHA* |
Ga0065712_104923272 | 3300005290 | Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFVLNFGRA* |
Ga0065715_101261452 | 3300005293 | Miscanthus Rhizosphere | MIDQKKTSELIETSFIYLLSAAVAVGAFVLVWLISLFLGFSQT* |
Ga0065715_101981142 | 3300005293 | Miscanthus Rhizosphere | MINHKKSSEFLETSLIYLLSTAVAVGAFVLVWLISLLLGPSQT* |
Ga0065715_104595882 | 3300005293 | Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAAGAFVLVWLISLVFGLARA* |
Ga0065715_104636692 | 3300005293 | Miscanthus Rhizosphere | MINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGS |
Ga0065715_106944442 | 3300005293 | Miscanthus Rhizosphere | MTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA* |
Ga0065705_100097792 | 3300005294 | Switchgrass Rhizosphere | MTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLARA* |
Ga0065705_110156232 | 3300005294 | Switchgrass Rhizosphere | MINGKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA* |
Ga0065707_109619251 | 3300005295 | Switchgrass Rhizosphere | TEKKRNLPMIDQKKTSELIETSLIYLLSAAVAVGAFVLVWLISMLLGPSQT* |
Ga0070670_1000003588 | 3300005331 | Switchgrass Rhizosphere | MINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSPT* |
Ga0070670_1000166933 | 3300005331 | Switchgrass Rhizosphere | MINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLVSSQT* |
Ga0070670_1003082702 | 3300005331 | Switchgrass Rhizosphere | MMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA* |
Ga0070670_1008968251 | 3300005331 | Switchgrass Rhizosphere | MINQKKTSELIETSLIYLLSTAVALGAFVLVWLVSLLLGSSPT* |
Ga0070670_1018456641 | 3300005331 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLSF |
Ga0066388_1024592962 | 3300005332 | Tropical Forest Soil | MINGKKDSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA* |
Ga0066388_1028345942 | 3300005332 | Tropical Forest Soil | MISEKKSSDLFETWVIYLLSAAVAVGAFLLVWLISLLANPALT* |
Ga0068869_1004035482 | 3300005334 | Miscanthus Rhizosphere | MINQKKTSEFIETSLVYLLSAVVAVGAFVLVWLVSLLLGPSPM* |
Ga0068869_1008245761 | 3300005334 | Miscanthus Rhizosphere | MFNQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHS* |
Ga0070680_1015863591 | 3300005336 | Corn Rhizosphere | MINEKKSSDLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAT* |
Ga0070682_1000032272 | 3300005337 | Corn Rhizosphere | MIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGFSQG* |
Ga0070682_1002619002 | 3300005337 | Corn Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVFGLGHA* |
Ga0068868_1011340262 | 3300005338 | Miscanthus Rhizosphere | TEVAQRKPRNLPMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT* |
Ga0068868_1013844081 | 3300005338 | Miscanthus Rhizosphere | MIDNKKSSELVETWLVYLLSAAVAIGAFLLVWLISTLTGIGWA* |
Ga0070691_102726362 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLFGSSPT* |
Ga0070692_100200462 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVFGLARA* |
Ga0070692_102488792 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MINKKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT* |
Ga0070675_1004391742 | 3300005354 | Miscanthus Rhizosphere | MINSKKTSELIETSVVYLLSAAVAVGAFILVWLISLFLGFGH* |
Ga0070673_1001219732 | 3300005364 | Switchgrass Rhizosphere | MINGKKNSEFIETSLIYLLSAAVALGAFALVWLISLLLGSGRA* |
Ga0070673_1007086101 | 3300005364 | Switchgrass Rhizosphere | MINQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVALLLGSSPT* |
Ga0070673_1009637802 | 3300005364 | Switchgrass Rhizosphere | MMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGQA* |
Ga0070673_1016367741 | 3300005364 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLSFGRA* |
Ga0070688_1010763321 | 3300005365 | Switchgrass Rhizosphere | MINEKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA* |
Ga0070703_105311631 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSPT* |
Ga0070701_100554281 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSHA* |
Ga0070701_107141021 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RNLPMINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLFGSSPT* |
Ga0070705_1000921412 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDEKKNSEVIETSLIYLLSAAVAVGAFILVWLISLLLGSGRA* |
Ga0070705_1003634301 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TRRNLPMTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA* |
Ga0070705_1003852952 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDNKKSAELVETWLIYLLSAAVAIGAFLLVWFISTLTGIGWA* |
Ga0070705_1016426761 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MINGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT* |
Ga0070700_1000935462 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAAGAFVLVWLISLVFGLGHA* |
Ga0070700_1003449982 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | RNLPMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSHA* |
Ga0070700_1019665932 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFMLVWLISLFLSFGRA* |
Ga0070700_1019716062 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLVLGVGQA* |
Ga0070694_1003287512 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT* |
Ga0070694_1006445372 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA* |
Ga0070694_1015606801 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFFLGFGRA* |
Ga0070681_100524204 | 3300005458 | Corn Rhizosphere | MINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA* |
Ga0070681_103381222 | 3300005458 | Corn Rhizosphere | MIDNKKSSELVETWLIYLLSAAVAIGAFLLAWLISTLTGIGWA* |
Ga0070681_107109701 | 3300005458 | Corn Rhizosphere | MINEKKSSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA* |
Ga0070681_107954952 | 3300005458 | Corn Rhizosphere | MIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT* |
Ga0068867_1000348162 | 3300005459 | Miscanthus Rhizosphere | MINQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT* |
Ga0070685_109073402 | 3300005466 | Switchgrass Rhizosphere | MINQKKTSEFVETSLIYLLSAAVAVAAFVLVWLVSLLLGPSQT* |
Ga0070706_10000004412 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHEKKTSELLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA* |
Ga0070707_1000206312 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MINEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA* |
Ga0070707_1008882012 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MINEKKTTELLETSLVYLLSAAVAVGAFVLIWLISLFAGLTRT* |
Ga0070698_1000746852 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MINEKKTSELIETSLIYLLSAAVAVGAFILVWLISLFLGFGQA* |
Ga0070679_1011569721 | 3300005530 | Corn Rhizosphere | QKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT* |
Ga0070697_1010896012 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SKKASELIETSVIYLLSAAVAVGAFVLVWLISFFLGFGRA* |
Ga0068853_1005212941 | 3300005539 | Corn Rhizosphere | MTNQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA* |
Ga0070695_1004786142 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDEKKTSELIETSLIYLLSAAVAVGAFILVWLVAVFLGLGSQA* |
Ga0070695_1010072671 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDNKKCSDLVETWLIYLLSAAVAIGAFLLVWIISLVADIGPA* |
Ga0070695_1012350122 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLVLGFGQA* |
Ga0070695_1014752572 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISSLAGVSAT* |
Ga0070695_1015186032 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | QKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT* |
Ga0070695_1017205191 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEEKKTSELVETWLIYLLSAAVAVGAFLLIWFVSLVAGTGRA* |
Ga0070696_1004646632 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MINQKKNSELIETSLIYLLSAAVAVGAFALVWLISMLLGSSQT* |
Ga0070696_1019227412 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MINGKKTSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSSHA* |
Ga0070696_1019632081 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHT* |
Ga0070693_1000753732 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDNKKSAELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGWA* |
Ga0070693_1007044692 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MINSKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGSGQA* |
Ga0070704_1001085002 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGFGQG* |
Ga0070704_1017486661 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLAHA* |
Ga0068855_1001135062 | 3300005563 | Corn Rhizosphere | MIDQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLFGLSQG* |
Ga0070664_1015334252 | 3300005564 | Corn Rhizosphere | MINEKKNSEVIETSLIYLLSAAVAVGAFALVWLVSLLLGSGWS* |
Ga0066693_103743312 | 3300005566 | Soil | NLPMINDKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGFGQA* |
Ga0068857_1001966091 | 3300005577 | Corn Rhizosphere | PMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFVLNFGRA* |
Ga0068857_1004723212 | 3300005577 | Corn Rhizosphere | MINSKKTSELIETSLIYLLSAAVAVGAFILVWLISLFLGLGQA* |
Ga0068857_1006295602 | 3300005577 | Corn Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGLGHA* |
Ga0068857_1014952241 | 3300005577 | Corn Rhizosphere | MIEEKKTSELIETWLVYLLSAAVAVGAFLLVWLISAL |
Ga0068857_1015674712 | 3300005577 | Corn Rhizosphere | MINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLVLGVGQA* |
Ga0068854_1001373391 | 3300005578 | Corn Rhizosphere | GNLPMINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT* |
Ga0070702_1012867331 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MINEKKSSELVETWLIYLLSAAVAVGAFMLVWLISVLTGFSST* |
Ga0070702_1018806251 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | KKCSDLVETWLIYLLSAAVAIGAFLLVWIISLVADIGPA* |
Ga0068859_1002612701 | 3300005617 | Switchgrass Rhizosphere | RGNLPMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT* |
Ga0068859_1022198102 | 3300005617 | Switchgrass Rhizosphere | MINQKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGTGRA* |
Ga0068864_1001471883 | 3300005618 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLVSLVLGFGRA* |
Ga0068864_1013550552 | 3300005618 | Switchgrass Rhizosphere | MINSKKTSELIETSFIYLLSAAVAVGAFVLVWLVSLFLGLGHA* |
Ga0068864_1016598602 | 3300005618 | Switchgrass Rhizosphere | MTDQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKADF |
Ga0068864_1017119272 | 3300005618 | Switchgrass Rhizosphere | TSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA* |
Ga0068864_1026398832 | 3300005618 | Switchgrass Rhizosphere | MINEKKSSDLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAN* |
Ga0068861_1005272172 | 3300005719 | Switchgrass Rhizosphere | LPMIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA* |
Ga0068863_1004684942 | 3300005841 | Switchgrass Rhizosphere | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT* |
Ga0068863_1016839131 | 3300005841 | Switchgrass Rhizosphere | MIDNKKSSELVETWLIYLLSAAVAVGAFLLVWLISLVTGISAA* |
Ga0068858_1004298021 | 3300005842 | Switchgrass Rhizosphere | MINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT* |
Ga0068860_1013257302 | 3300005843 | Switchgrass Rhizosphere | MMNGKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA* |
Ga0068862_1015128192 | 3300005844 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFVLSFGRA* |
Ga0075287_10253041 | 3300005873 | Rice Paddy Soil | MIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLLGPSQT* |
Ga0075297_10101012 | 3300005878 | Rice Paddy Soil | MIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLLG |
Ga0075291_10092982 | 3300005884 | Rice Paddy Soil | MIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLLGPRQT* |
Ga0081539_101225222 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MINEKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGFGQT* |
Ga0075417_101644842 | 3300006049 | Populus Rhizosphere | MIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLFGFGQG* |
Ga0082029_11838332 | 3300006169 | Termite Nest | MINGKKNSEFVETSLIYLLSAAVAVGAFALVWLVSLLLGSGRS* |
Ga0082029_14184062 | 3300006169 | Termite Nest | MINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISFFLGFGQA* |
Ga0082029_146618427 | 3300006169 | Termite Nest | MIDQKKTSELLETSLVYLLSAAVAVGAFVLVWLISLLFGLGQA* |
Ga0082029_16207311 | 3300006169 | Termite Nest | NQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSAQT* |
Ga0070716_1008171211 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLLSTLTGIGWT* |
Ga0097621_1000092202 | 3300006237 | Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVFGLAHA* |
Ga0097621_1011372502 | 3300006237 | Miscanthus Rhizosphere | QKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT* |
Ga0068871_1013185901 | 3300006358 | Miscanthus Rhizosphere | DLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAT* |
Ga0079222_100078321 | 3300006755 | Agricultural Soil | TRGNLPMINQKKTSEVIETSLIYLLSEAVAVGAFVLVWVISLLLGSSQT* |
Ga0079222_104455532 | 3300006755 | Agricultural Soil | MIENKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGWA* |
Ga0079222_104837482 | 3300006755 | Agricultural Soil | MINQKKSSELIETSLIYLLSAAVAVGAFGLVWLISL |
Ga0079222_111362711 | 3300006755 | Agricultural Soil | NCNLKTKILKMKDLPMIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLLSTLTGIGWT* |
Ga0079222_116408441 | 3300006755 | Agricultural Soil | MINGKRTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLG |
Ga0079220_105183312 | 3300006806 | Agricultural Soil | MIDKKKYSELVESWLFYLLSAAVAIGAFLLIWLVSSMAGVSAT* |
Ga0079220_105944462 | 3300006806 | Agricultural Soil | MINEKKNSEFVETSVIYLLSAAVAVGAFVLVWLISVLLGSGRA* |
Ga0079220_114750912 | 3300006806 | Agricultural Soil | MIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGSA* |
Ga0075421_1000888464 | 3300006845 | Populus Rhizosphere | MMDEKKTSEVIETSLIYLLSAAVAVGAFVLVWLLTPLTHF* |
Ga0075421_1020692292 | 3300006845 | Populus Rhizosphere | MMNEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF* |
Ga0075430_1006754831 | 3300006846 | Populus Rhizosphere | MMDEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF* |
Ga0075430_1006766172 | 3300006846 | Populus Rhizosphere | MLNEKKTSEVIETSLIYLLSAAVAVGAFVLVGLIAVLFGLSQA* |
Ga0075431_1002762862 | 3300006847 | Populus Rhizosphere | MMDEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVLSSPRF* |
Ga0075431_1017822662 | 3300006847 | Populus Rhizosphere | MIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISL |
Ga0075431_1021014012 | 3300006847 | Populus Rhizosphere | KTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF* |
Ga0075433_100174573 | 3300006852 | Populus Rhizosphere | MINSKRTSELLETSLIYLLSAAVAVGAFVLVWLLSLLVGLGRA* |
Ga0075433_100939881 | 3300006852 | Populus Rhizosphere | MLNEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGIARA* |
Ga0075433_101367492 | 3300006852 | Populus Rhizosphere | MINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVSLLLGSGRS* |
Ga0075433_116367412 | 3300006852 | Populus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLVSLFLGFGHA* |
Ga0075425_1001021053 | 3300006854 | Populus Rhizosphere | MINEKRTSELLETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA* |
Ga0075425_1016484862 | 3300006854 | Populus Rhizosphere | RNLWMALKVKDLPMLNGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT* |
Ga0079217_100112043 | 3300006876 | Agricultural Soil | MMIHEKKNSELVETWLIYLLSAAVAVGAFLLVWFISLLAGVARA* |
Ga0079217_111605812 | 3300006876 | Agricultural Soil | MMNEKKTSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA* |
Ga0079215_100733832 | 3300006894 | Agricultural Soil | MMIHEKKNSELVETWLIYLLSAAVAVGAFLLVWLISLLAGVAPA* |
Ga0075426_100541602 | 3300006903 | Populus Rhizosphere | MIDNKKSAELVETWLIYLLSAAVAIGAFLLVWLISALAGVSAT* |
Ga0075424_1002976771 | 3300006904 | Populus Rhizosphere | MLNEKKTSELIETSLIYLLSAAVAVGAFILVWLISLLLGIARA* |
Ga0075424_1012959821 | 3300006904 | Populus Rhizosphere | LNEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGIARA* |
Ga0079216_102225062 | 3300006918 | Agricultural Soil | MMNEKKTSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGLGQA* |
Ga0079219_100302982 | 3300006954 | Agricultural Soil | MINQKKTSELIETSLIYLLSAAVALGAFVLVWLISLLLGPSQT* |
Ga0079219_100649482 | 3300006954 | Agricultural Soil | MINQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT* |
Ga0079219_104077681 | 3300006954 | Agricultural Soil | MTNHNKTSEFIETSLIYLLSAAVAVGAFGLVWLISLLLGSSQT* |
Ga0079218_106661602 | 3300007004 | Agricultural Soil | MMNGKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLFGLGRA* |
Ga0079218_117302722 | 3300007004 | Agricultural Soil | MINEKKTSEVIETSLIYLLSAAVAVGAFVLVGLIAVVFGFSQA* |
Ga0105247_109617351 | 3300009101 | Switchgrass Rhizosphere | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSRLT* |
Ga0105247_114455181 | 3300009101 | Switchgrass Rhizosphere | MIDEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGFGQA* |
Ga0114129_125475542 | 3300009147 | Populus Rhizosphere | MMNEKKTSELIETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA* |
Ga0105243_121537612 | 3300009148 | Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGFGRA* |
Ga0075423_100151408 | 3300009162 | Populus Rhizosphere | MALKVKDLPMLNGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT* |
Ga0105241_107085082 | 3300009174 | Corn Rhizosphere | MIEEKKTSELVETWLVYLLSVAVAVGAFLLVCLISLLAGVNRA* |
Ga0105241_113762082 | 3300009174 | Corn Rhizosphere | MKILKVKDLPMIDNKKYSDLVETWLIYLLSAAVAVGAFLLVWLISLVTGISAA* |
Ga0105242_111813672 | 3300009176 | Miscanthus Rhizosphere | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSS |
Ga0105237_101045123 | 3300009545 | Corn Rhizosphere | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSS |
Ga0105237_116237592 | 3300009545 | Corn Rhizosphere | MINQKKSSELIETSLIYLLSAAVAVGAFGLVWLISLLLGSSQT* |
Ga0105238_127758002 | 3300009551 | Corn Rhizosphere | MIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIASA* |
Ga0105249_101258381 | 3300009553 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFFGL |
Ga0126307_107062882 | 3300009789 | Serpentine Soil | MINPKKSSELIETSLIYLLSAAVAVGAFVLVGLISVLLGLSPA* |
Ga0126307_111303311 | 3300009789 | Serpentine Soil | RDLPMIDEKKTSELVETWLVYLLSAGVAVGAFLLVWLIVLLAGLGRA* |
Ga0126374_103685691 | 3300009792 | Tropical Forest Soil | MINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLL |
Ga0126305_105534912 | 3300010036 | Serpentine Soil | MIHEKKTSEFIETSLIYLLSAGVAVGAFVLVWLISLLLGFG |
Ga0126305_108831001 | 3300010036 | Serpentine Soil | MINEKKTSELFETSLIYLLSAAVAVGAFVLVWLISLLLGFGQ |
Ga0126305_109056742 | 3300010036 | Serpentine Soil | MISEKKTSEVIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSPT* |
Ga0126308_108978802 | 3300010040 | Serpentine Soil | MINQKKTSELLETSVIYLLSAAVAAGAFALVWLISLLFGFGYA* |
Ga0126310_108390572 | 3300010044 | Serpentine Soil | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT* |
Ga0126384_101365432 | 3300010046 | Tropical Forest Soil | MINEKKNSEFVETSLIYLLSAAVAVGAFALVWLVSLLLGSGRS* |
Ga0126306_117525752 | 3300010166 | Serpentine Soil | MIEEKKTSELIETWLVYLLSVAVAAGAFLLVWGISALAGLHWS* |
Ga0126370_107724721 | 3300010358 | Tropical Forest Soil | MINEKKHSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA* |
Ga0126376_110350082 | 3300010359 | Tropical Forest Soil | MINEKKTSDLFETWVIYLLSAAVAVGAFLLVWLISLLANPALT* |
Ga0126372_115210822 | 3300010360 | Tropical Forest Soil | MINGKKNSEFVETSLIYLLSAAVAVAAFVLVWLISLLLGPGRA* |
Ga0105239_109600301 | 3300010375 | Corn Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFL |
Ga0105239_125786261 | 3300010375 | Corn Rhizosphere | MIDEKKTSELVETWLVYLLSAAVAVGAFLLVWLISLLAGMNRA |
Ga0134126_108967911 | 3300010396 | Terrestrial Soil | MKDLPMIDNKNTSELVETWLIYLLSAAVAIAAFLLVWFVSSL |
Ga0134127_102659111 | 3300010399 | Terrestrial Soil | MINRKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA* |
Ga0134127_116216872 | 3300010399 | Terrestrial Soil | MINQKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLGP |
Ga0134121_108644591 | 3300010401 | Terrestrial Soil | TKILKMKDLPMIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISSLAGVSAT* |
Ga0120182_10097011 | 3300011993 | Terrestrial | MMNGKKTSEFLETSLIYLLSAAVAVGAFVLVWLISRLLGFGQL* |
Ga0157299_100876661 | 3300012899 | Soil | MMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA* |
Ga0164298_105981272 | 3300012955 | Soil | DNKKSAELVETWLVYLLSAAVAIAAFLLVWLISSLAGISAT* |
Ga0164303_106743871 | 3300012957 | Soil | RPNCNLKTKILKMKDLPMIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISSLAGVSAT |
Ga0164301_109378412 | 3300012960 | Soil | KMKDLPMIDNKKSSELVETWLIYLLSAAVAIGAFLLVCLISRLAGIGST* |
Ga0164304_116343142 | 3300012986 | Soil | MINQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGP |
Ga0157373_110613461 | 3300013100 | Corn Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVLGSGRA |
Ga0157373_112420002 | 3300013100 | Corn Rhizosphere | MINQKKNSELIETSLVYLLSAAVAVGAFVLVWLISLLLGTSHS* |
Ga0163162_104895762 | 3300013306 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGVGHA* |
Ga0157372_101427473 | 3300013307 | Corn Rhizosphere | MIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISFLFGLGQG* |
Ga0157375_101848422 | 3300013308 | Miscanthus Rhizosphere | MTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLA |
Ga0157377_115219221 | 3300014745 | Miscanthus Rhizosphere | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT* |
Ga0120193_100448252 | 3300014965 | Terrestrial | MLNEKKTSEVIETSLIYLLSAAVAAGAFVLVGLVALLFGFSQA* |
Ga0182006_13236402 | 3300015261 | Rhizosphere | MKDLPMIDNRKSSELVETWLIYLLSAAVAIGAFLLVWFISTLTGIGWA* |
Ga0163161_109421321 | 3300017792 | Switchgrass Rhizosphere | MINQKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT |
Ga0190265_100202281 | 3300018422 | Soil | MINDKKTSELLETSLIYLLSAAVAVGAFVLVWLLSLLFGFGQT |
Ga0190265_101850021 | 3300018422 | Soil | MINEKKTSEVIETSLIYLLSAAVAVGAFVLVGLIAVLFGFSQT |
Ga0190265_115090852 | 3300018422 | Soil | MINEKKSSEVIETSLIYLLSAAVAVGAFVLVGLIAVLFG |
Ga0190265_135931842 | 3300018422 | Soil | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGVSQT |
Ga0190272_110045342 | 3300018429 | Soil | MINEKKTSELIETSVVYLLSAAVAVGAFVLVWLISLLLGFSQG |
Ga0190275_103179572 | 3300018432 | Soil | MIDEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA |
Ga0190268_101879712 | 3300018466 | Soil | MINSKKTSELLETSLIYLLSAAVAVGAFVLVWLLSLLFGFGQA |
Ga0190268_103591832 | 3300018466 | Soil | MIEEKKTSELVETWLVYLLSAAVAVAAFMLVWLIVLLAGLGGRA |
Ga0190268_106229542 | 3300018466 | Soil | MMNGKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA |
Ga0190268_109788421 | 3300018466 | Soil | MLNEKKTSEVIETSLIYLLSAAVAAGAFVLVGLIALLFGFNQA |
Ga0190268_116050031 | 3300018466 | Soil | EKKTSELIETSLIYLLSAVVAAGAFVLVGLLALLFGFNQT |
Ga0190270_133436611 | 3300018469 | Soil | MINEKKTSELIETSVVYLLSAAVAVGAFVLVWLISLLLGLGQG |
Ga0190274_109033692 | 3300018476 | Soil | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHT |
Ga0190274_117392671 | 3300018476 | Soil | MIDHKKTSELIETSFIYLLSAAVAVGAFVLVWLVSFLLGFGQT |
Ga0187894_1000130919 | 3300019360 | Microbial Mat On Rocks | MIDEKKTSELVETWLIYLLSAAVAVGAFMLVWLISLLAGVNRA |
Ga0173482_107358731 | 3300019361 | Soil | MINGKKNSEFVETSVIYLLSAAVAVGAFALVWLVS |
Ga0190264_102160932 | 3300019377 | Soil | MTDEKKTSELLETSFIYLLSAAVAAGAFVLVWLLSQLFGFGQA |
Ga0196977_100022510 | 3300020146 | Soil | MIEEKKTSELVETWLVYLLSAAVAVGAFLLVWLISMLAGLNRA |
Ga0193736_10121592 | 3300021412 | Soil | MIEQKKTSELVETWLVYLLSAGVAVGAFLLVWLIVLLAGLGRA |
Ga0182009_100024943 | 3300021445 | Soil | MINEKKTSEILETSLIYLLSAAVAVGAFVLVWLISLLLGVGGRA |
Ga0182009_100254842 | 3300021445 | Soil | MINGKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGTGRA |
Ga0182009_100858011 | 3300021445 | Soil | MINEKKNSEFVETSLVYLLSAAVAVGAFVLVWLVSLLLGPGRA |
Ga0182009_101226192 | 3300021445 | Soil | MINEKKSSDLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAT |
Ga0182009_103750302 | 3300021445 | Soil | MIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGWA |
Ga0182009_104756632 | 3300021445 | Soil | INEKKSSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA |
Ga0182009_107755921 | 3300021445 | Soil | MINGKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGTGWA |
Ga0182009_108235221 | 3300021445 | Soil | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT |
Ga0247695_10079412 | 3300024179 | Soil | MISEKKSSELFETWVIYLLSAAVAAGAFLLVWLVSLLASFSST |
Ga0207697_105047142 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA |
Ga0207656_100171943 | 3300025321 | Corn Rhizosphere | MIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGLSQG |
Ga0207653_101422021 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | KKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT |
Ga0207642_100583382 | 3300025899 | Miscanthus Rhizosphere | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT |
Ga0207710_100017325 | 3300025900 | Switchgrass Rhizosphere | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSHA |
Ga0207710_100458042 | 3300025900 | Switchgrass Rhizosphere | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSRLT |
Ga0207710_102556082 | 3300025900 | Switchgrass Rhizosphere | MINGKKNSEFIETSLIYLLSAAVALGAFALVWLISLLLGSGRA |
Ga0207688_101653982 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MINQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT |
Ga0207647_100066615 | 3300025904 | Corn Rhizosphere | MINSKKTSELIETSVIYLLSAAVAAGAFVLVWLISLVFGLARA |
Ga0207643_100215792 | 3300025908 | Miscanthus Rhizosphere | MIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFFGFGQA |
Ga0207643_101657572 | 3300025908 | Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGFGHA |
Ga0207643_109879342 | 3300025908 | Miscanthus Rhizosphere | LPMMNGKKTSEFLETSVIYLLSAAVAVGAFVLVWLLSLLLGLGQA |
Ga0207684_1000011739 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHEKKTSELLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA |
Ga0207654_101140051 | 3300025911 | Corn Rhizosphere | MINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSPA |
Ga0207654_101185782 | 3300025911 | Corn Rhizosphere | MALKVKDLPMINGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT |
Ga0207654_101275992 | 3300025911 | Corn Rhizosphere | MIDNKKSSELVETWLIYLLSAAVAIGAFLLVWLISTLTGIGSA |
Ga0207654_102981051 | 3300025911 | Corn Rhizosphere | MINSKKTSELIETSLIYLLSAAVAVGAFVLVWLISLVLGFGQA |
Ga0207654_103483122 | 3300025911 | Corn Rhizosphere | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVALLLGSSPT |
Ga0207654_107084511 | 3300025911 | Corn Rhizosphere | MINGKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA |
Ga0207654_110584471 | 3300025911 | Corn Rhizosphere | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHS |
Ga0207654_112223861 | 3300025911 | Corn Rhizosphere | MINEKKTSELIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA |
Ga0207707_107479082 | 3300025912 | Corn Rhizosphere | MIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT |
Ga0207707_109009551 | 3300025912 | Corn Rhizosphere | MIDNKKSSELVETWLIYLLSAAVAIGAFLLAWLISTLTGIGWA |
Ga0207662_100282832 | 3300025918 | Switchgrass Rhizosphere | MTDPKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA |
Ga0207662_104931422 | 3300025918 | Switchgrass Rhizosphere | MIDQKKASEVIETSLVYLLSAAVAVGAFVLVWLISLLFGFSQG |
Ga0207649_105193461 | 3300025920 | Corn Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLSFGRA |
Ga0207652_116375851 | 3300025921 | Corn Rhizosphere | RGNLPMINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT |
Ga0207681_100741012 | 3300025923 | Switchgrass Rhizosphere | MINQKKTSEFIETSLVYLLSAVVAVGAFVLVWLVSLLLGPSPM |
Ga0207694_100175522 | 3300025924 | Corn Rhizosphere | MIKQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVALLLGSSPT |
Ga0207694_111611532 | 3300025924 | Corn Rhizosphere | MINQKKNSELIETSLIYLLSAAVAVGAFVLVWLISMLLGSSQT |
Ga0207650_10000028178 | 3300025925 | Switchgrass Rhizosphere | MINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSPT |
Ga0207650_107694102 | 3300025925 | Switchgrass Rhizosphere | MINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLVSSQT |
Ga0207650_114615002 | 3300025925 | Switchgrass Rhizosphere | TRYLPMMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA |
Ga0207701_107858991 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA |
Ga0207690_107610681 | 3300025932 | Corn Rhizosphere | LKRNLPMINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT |
Ga0207706_104497801 | 3300025933 | Corn Rhizosphere | MINHKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT |
Ga0207706_104967392 | 3300025933 | Corn Rhizosphere | MINEKKNSEFVETSVIYLLSAAVAVGAFALVWLISLLLGSGRA |
Ga0207706_115610662 | 3300025933 | Corn Rhizosphere | MIDEKKTSELIETSLIYLLSAAVAVGAFILVWLVAVFLGLGSQA |
Ga0207709_100307982 | 3300025935 | Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFFLGFGRA |
Ga0207709_105993702 | 3300025935 | Miscanthus Rhizosphere | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLISLLLGSSQT |
Ga0207709_112520902 | 3300025935 | Miscanthus Rhizosphere | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHA |
Ga0207670_103721602 | 3300025936 | Switchgrass Rhizosphere | MIEEKKTSELIETWLVYLLSAAVAVGAFLLVWLISALAVPRWS |
Ga0207704_110432861 | 3300025938 | Miscanthus Rhizosphere | INQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSPT |
Ga0207665_100317872 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MINEKKSSELVETWLIYLLSAAVAVGAFMLVWLISVLTGFSST |
Ga0207665_114363962 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MISEKKTSDLVETWLIYLLSAAVAVGAFMLVWLISLLTGFSST |
Ga0207691_104997652 | 3300025940 | Miscanthus Rhizosphere | MINEKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA |
Ga0207691_105108752 | 3300025940 | Miscanthus Rhizosphere | MINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISMLLGLGQA |
Ga0207711_115530371 | 3300025941 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLVLGFGRA |
Ga0207689_101226792 | 3300025942 | Miscanthus Rhizosphere | MINHKKSSEFLETSLIYLLSTAVAVGAFVLVWLISLLLGPSQT |
Ga0207689_101412062 | 3300025942 | Miscanthus Rhizosphere | MTDQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA |
Ga0207689_110045981 | 3300025942 | Miscanthus Rhizosphere | MIDEKKTSELVETWLVYLLSAAVAAGAFLLVWFISLLTGVNRA |
Ga0207689_112188252 | 3300025942 | Miscanthus Rhizosphere | MINSKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLVLGFGQA |
Ga0207689_114154621 | 3300025942 | Miscanthus Rhizosphere | MIEEKKTSELVETWLIYLLSAAVAVGAFLLIWFVSLVAGTGRA |
Ga0207661_112318782 | 3300025944 | Corn Rhizosphere | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGPSQT |
Ga0207679_116918942 | 3300025945 | Corn Rhizosphere | MINEKKNSEVIETSLIYLLSAAVAVGAFALVWLISLLLGSGRA |
Ga0207667_101341542 | 3300025949 | Corn Rhizosphere | MIDQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLFGLSQG |
Ga0207651_113072902 | 3300025960 | Switchgrass Rhizosphere | MMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISMLLGLGQ |
Ga0207712_111317241 | 3300025961 | Switchgrass Rhizosphere | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLISLLLGSSHT |
Ga0207640_106054232 | 3300025981 | Corn Rhizosphere | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLISLLLGPSQT |
Ga0207640_108543022 | 3300025981 | Corn Rhizosphere | MIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA |
Ga0207703_102529102 | 3300026035 | Switchgrass Rhizosphere | MINQKKSSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT |
Ga0207703_112647512 | 3300026035 | Switchgrass Rhizosphere | SELIETSVIYLLSAAVAAGAFVLVWLISLVFGLARA |
Ga0207703_122794262 | 3300026035 | Switchgrass Rhizosphere | PKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA |
Ga0207639_109519502 | 3300026041 | Corn Rhizosphere | MTNQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA |
Ga0207678_108108102 | 3300026067 | Corn Rhizosphere | MIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGSGRT |
Ga0207708_100886162 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MINSKKTSELIETSVIYLLSAAVAAGAFVLVWLISLVFGLGHA |
Ga0207641_102560351 | 3300026088 | Switchgrass Rhizosphere | INGKKTSEFVETSLIYLLSAAVAVGAFVLVWLLSTLLGLGQT |
Ga0207641_109406932 | 3300026088 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISLFLGLGHA |
Ga0207641_115816881 | 3300026088 | Switchgrass Rhizosphere | NLPMTDQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFLGLAKA |
Ga0207641_120306222 | 3300026088 | Switchgrass Rhizosphere | SEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRA |
Ga0207676_102299392 | 3300026095 | Switchgrass Rhizosphere | MINSKKTSELIETSFIYLLSAAVAVGAFVLVWLVSLFLGLGHA |
Ga0207676_103230382 | 3300026095 | Switchgrass Rhizosphere | MINSKKTSELIETSVIYLLSAAVAVGAFVLVWLVSLVLGFGRA |
Ga0207676_116353342 | 3300026095 | Switchgrass Rhizosphere | MINEKKSSDLFETWVIYLLSAAVAAGAFLLVWFISLLASPGAN |
Ga0207674_107130852 | 3300026116 | Corn Rhizosphere | MINQKKTSEFVETSLIYLLSAAVAVAAFVLVWLVSLLLGPSQT |
Ga0207674_107984192 | 3300026116 | Corn Rhizosphere | MINQKKTSELIETSLIYLLSTAVAVGAFVLVWLVSLLLGPSPM |
Ga0207674_109514642 | 3300026116 | Corn Rhizosphere | PMINSKKTSELIETSVIYLLSAAVAVGAFVLVWLISFVLNFGRA |
Ga0256867_100120483 | 3300026535 | Soil | MIDEKKTSELIETSLIYLLSAAVAVGAFVLVWIISMFLGFGQA |
Ga0209215_100003526 | 3300027266 | Forest Soil | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSTFLGLGQT |
Ga0209215_10091662 | 3300027266 | Forest Soil | MIEEKKTAELIETWLVYLLSAAVAVGAFLLVWLISLLS |
Ga0209731_10194462 | 3300027326 | Forest Soil | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLISLFLGFGQA |
Ga0209216_10029512 | 3300027530 | Forest Soil | MIEEKKTSELIETWLVYLLSAAVAVGAFLLVWLVSMLAGVNRA |
Ga0209387_10255082 | 3300027639 | Agricultural Soil | MMIHEKKNSELVETWLIYLLSAAVAVGAFLLVWLISLLAGVAPA |
Ga0209795_100162252 | 3300027718 | Agave | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSQT |
Ga0209177_100176592 | 3300027775 | Agricultural Soil | MINQKKTSELIETSLIYLLSAAVALGAFVLVWLISLLLGPSQT |
Ga0209177_100748401 | 3300027775 | Agricultural Soil | MINQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQT |
Ga0209177_101369801 | 3300027775 | Agricultural Soil | MINEKKNSEFVETSVIYLLSAAVAVGAFVLVWLISVLLGSGRA |
Ga0209481_100136554 | 3300027880 | Populus Rhizosphere | MMNEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF |
Ga0209486_101633952 | 3300027886 | Agricultural Soil | MMIHEKKNSELVETWLIYLLSAAVAVGAFLLVWFISLLAGVARA |
Ga0207428_102769892 | 3300027907 | Populus Rhizosphere | MIDQKKTSELIETSLVYLLSAAVAVGAFLLVWLISLLFGFGQG |
Ga0209382_102273132 | 3300027909 | Populus Rhizosphere | MMDEKKTSEVIETSLIYLLSAAVAVGAFVLIWLISVFSSPRF |
Ga0209382_104929912 | 3300027909 | Populus Rhizosphere | MINGKKNSEFVETSLIYLLSAAVAVGAFALVWLISLLLGSGRG |
Ga0209382_108816692 | 3300027909 | Populus Rhizosphere | RNLPMMDEKKTSEVIETSLIYLLSAAVAVGAFVLVWLLTPLTDF |
Ga0268266_120877112 | 3300028379 | Switchgrass Rhizosphere | MINQKKTSEFIETSLIYLLSAAVAVGAFVLVWLVSLLLGSSPT |
Ga0268264_120941012 | 3300028381 | Switchgrass Rhizosphere | MMNEKKTSEFLETSLIYLLSAAVAVGAFVLVWLISLLLGLGRA |
Ga0268264_123325561 | 3300028381 | Switchgrass Rhizosphere | MINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLIS |
Ga0268264_124946142 | 3300028381 | Switchgrass Rhizosphere | MINQKKTSEFIETSLIYLLSTAVAVGAFVLVWLVSLLLGSSAT |
Ga0268259_101123281 | 3300030499 | Agave | RNLPMINQKKTSEFIETSLVYLLSAAVAVGAFVLVWLVSLLLGSSRA |
Ga0268241_100161072 | 3300030511 | Soil | MIDNKKSAELVETWLIYLLSAAVAIAAFLLVWLISTLTGRGWA |
Ga0268241_100663752 | 3300030511 | Soil | MIEHKKTSELIETSLIYLLSAAVAVGAFVLVWLISLLLGSSHA |
Ga0268241_101740491 | 3300030511 | Soil | RNLPMINEKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPAQT |
Ga0307505_1000008986 | 3300031455 | Soil | MIERKKTAELVETWLVYLLSAAVAVGAFLLVWFISVLAGVNRA |
Ga0307408_1000821672 | 3300031548 | Rhizosphere | MIEEKKTSELVETWLVYLLSAGVAVAAFLLVWLIVLLAGLGGRA |
Ga0310813_102010452 | 3300031716 | Soil | MIDNKKYSDLVETWLIYLLSAAVAVGAFLLVWLISLVTGISAA |
Ga0310813_103744161 | 3300031716 | Soil | MINEKKNSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA |
Ga0310813_105440332 | 3300031716 | Soil | MINSKKTSELIETSLIYLLSAAVAVGAFVLVWLVSFFLGFGNA |
Ga0310813_105459102 | 3300031716 | Soil | MINGKKNTEFVETSLIYLLSAAVAVGAFVLVWLISLLLGTGRA |
Ga0310813_105941942 | 3300031716 | Soil | MINGKKNSEFVETSLIYLLSAAVAVGAFVLVYLISLLLGSGRA |
Ga0310813_108801401 | 3300031716 | Soil | MINQKKTAEVIETSLIYLLSAAVAVGAFVLVWLISLLLGSSQS |
Ga0310813_118211752 | 3300031716 | Soil | MINEKKSSEFVETSLIYLLSAAVAVGAFVLVWLISLLLGSGRA |
Ga0310813_122525702 | 3300031716 | Soil | MINGKKNSEFVETSLIYLLSAAVAVGAFALVWLVSLLLGPGRA |
Ga0310813_122931171 | 3300031716 | Soil | MINQKKTSEFVETSLIYLLSAAVAVGAFVLVWLVSLLLG |
Ga0307468_1002261892 | 3300031740 | Hardwood Forest Soil | MINQKKTSELIETSLIYLLSAAVAVGAFVLVWLVSLFFGFGQA |
Ga0307468_1003429582 | 3300031740 | Hardwood Forest Soil | MIHEKKTSDLIETSLIYLLSAAVAVGAFLLVWLISNILGLGQA |
Ga0307468_1017065571 | 3300031740 | Hardwood Forest Soil | EFVETSLIYLLSAAVAVGAFVLVWLISLLLGPGRA |
Ga0307410_117261611 | 3300031852 | Rhizosphere | MIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLGFG |
Ga0310904_111146792 | 3300031854 | Soil | KKTSELIETSVIYLLSAAVAVGAFVLVWLISLFFGLSHA |
Ga0307406_112724051 | 3300031901 | Rhizosphere | MINQKKTSEFIETSLVYLLSAAVALGAFVLVWLVSL |
Ga0307407_115896552 | 3300031903 | Rhizosphere | MINEKKTSELIETSLVYLLSAGVAVGAFVLVWLISLLLGFGQA |
Ga0307412_105660021 | 3300031911 | Rhizosphere | MIDQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLFLG |
Ga0308174_107753632 | 3300031939 | Soil | MINQKKTSEVIETSLIYLLSAAVAVGAFVLVWLISLLLGPAQT |
Ga0307409_1010414711 | 3300031995 | Rhizosphere | PMINEKKTSELIETSLVYLLSAGVAVGAFVLVWLISLLLGFGQA |
Ga0308176_129965551 | 3300031996 | Soil | MIEEKKRSELVETWLIYLLSAAVAAGAFLLVWFVSVLMGIGRA |
Ga0307416_1013886621 | 3300032002 | Rhizosphere | MIDQKKTSELIETSLVYLLSAAVAVGAFVLVWLISLLFGLGQG |
Ga0315910_102426202 | 3300032144 | Soil | MIEQKKTSELIETWLVYLLSAAVAVGAFLLVWLISLLAGVTRA |
Ga0310811_113293341 | 3300033475 | Soil | MINSKKTSELIETSLIYLLSAAVAVGAFVLVWLVSFF |
⦗Top⦘ |