Basic Information | |
---|---|
Family ID | F005863 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 388 |
Average Sequence Length | 42 residues |
Representative Sequence | GTVARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK |
Number of Associated Samples | 312 |
Number of Associated Scaffolds | 388 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.52 % |
% of genes near scaffold ends (potentially truncated) | 98.71 % |
% of genes from short scaffolds (< 2000 bps) | 95.10 % |
Associated GOLD sequencing projects | 287 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.320 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.051 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.021 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.144 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.76% β-sheet: 0.00% Coil/Unstructured: 88.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 388 Family Scaffolds |
---|---|---|
PF04909 | Amidohydro_2 | 2.06 |
PF05193 | Peptidase_M16_C | 1.55 |
PF11746 | DUF3303 | 1.55 |
PF14534 | DUF4440 | 1.55 |
PF13442 | Cytochrome_CBB3 | 1.55 |
PF02518 | HATPase_c | 1.29 |
PF07519 | Tannase | 1.29 |
PF02668 | TauD | 1.03 |
PF02566 | OsmC | 1.03 |
PF12840 | HTH_20 | 1.03 |
PF13924 | Lipocalin_5 | 1.03 |
PF13564 | DoxX_2 | 1.03 |
PF00365 | PFK | 1.03 |
PF01979 | Amidohydro_1 | 0.77 |
PF12680 | SnoaL_2 | 0.77 |
PF00144 | Beta-lactamase | 0.77 |
PF00857 | Isochorismatase | 0.77 |
PF00657 | Lipase_GDSL | 0.77 |
PF01425 | Amidase | 0.77 |
PF01568 | Molydop_binding | 0.77 |
PF00072 | Response_reg | 0.77 |
PF04255 | DUF433 | 0.77 |
PF13432 | TPR_16 | 0.77 |
PF01738 | DLH | 0.77 |
PF00753 | Lactamase_B | 0.77 |
PF13676 | TIR_2 | 0.77 |
PF00106 | adh_short | 0.77 |
PF08818 | DUF1801 | 0.77 |
PF13398 | Peptidase_M50B | 0.52 |
PF13474 | SnoaL_3 | 0.52 |
PF00115 | COX1 | 0.52 |
PF07969 | Amidohydro_3 | 0.52 |
PF07995 | GSDH | 0.52 |
PF00210 | Ferritin | 0.52 |
PF00583 | Acetyltransf_1 | 0.52 |
PF05362 | Lon_C | 0.52 |
PF13620 | CarboxypepD_reg | 0.52 |
PF12146 | Hydrolase_4 | 0.52 |
PF03992 | ABM | 0.52 |
PF04304 | DUF454 | 0.52 |
PF02633 | Creatininase | 0.52 |
PF01261 | AP_endonuc_2 | 0.52 |
PF13419 | HAD_2 | 0.52 |
PF03401 | TctC | 0.26 |
PF06210 | DUF1003 | 0.26 |
PF01081 | Aldolase | 0.26 |
PF00149 | Metallophos | 0.26 |
PF01436 | NHL | 0.26 |
PF00196 | GerE | 0.26 |
PF01050 | MannoseP_isomer | 0.26 |
PF01596 | Methyltransf_3 | 0.26 |
PF00578 | AhpC-TSA | 0.26 |
PF13565 | HTH_32 | 0.26 |
PF01165 | Ribosomal_S21 | 0.26 |
PF01406 | tRNA-synt_1e | 0.26 |
PF01850 | PIN | 0.26 |
PF12836 | HHH_3 | 0.26 |
PF00480 | ROK | 0.26 |
PF12681 | Glyoxalase_2 | 0.26 |
PF08241 | Methyltransf_11 | 0.26 |
PF01847 | VHL | 0.26 |
PF03591 | AzlC | 0.26 |
PF01527 | HTH_Tnp_1 | 0.26 |
PF13411 | MerR_1 | 0.26 |
PF00756 | Esterase | 0.26 |
PF00190 | Cupin_1 | 0.26 |
PF00497 | SBP_bac_3 | 0.26 |
PF00188 | CAP | 0.26 |
PF16757 | Fucosidase_C | 0.26 |
PF17170 | DUF5128 | 0.26 |
PF01713 | Smr | 0.26 |
PF06983 | 3-dmu-9_3-mt | 0.26 |
PF03712 | Cu2_monoox_C | 0.26 |
PF03544 | TonB_C | 0.26 |
PF10531 | SLBB | 0.26 |
PF01061 | ABC2_membrane | 0.26 |
PF12543 | DUF3738 | 0.26 |
PF01258 | zf-dskA_traR | 0.26 |
PF12704 | MacB_PCD | 0.26 |
PF13531 | SBP_bac_11 | 0.26 |
PF12006 | DUF3500 | 0.26 |
PF01507 | PAPS_reduct | 0.26 |
PF00083 | Sugar_tr | 0.26 |
PF01841 | Transglut_core | 0.26 |
PF06439 | 3keto-disac_hyd | 0.26 |
PF13088 | BNR_2 | 0.26 |
PF02635 | DrsE | 0.26 |
PF06736 | TMEM175 | 0.26 |
PF13489 | Methyltransf_23 | 0.26 |
PF07228 | SpoIIE | 0.26 |
PF13646 | HEAT_2 | 0.26 |
PF06831 | H2TH | 0.26 |
PF00043 | GST_C | 0.26 |
PF01322 | Cytochrom_C_2 | 0.26 |
PF07045 | DUF1330 | 0.26 |
PF00982 | Glyco_transf_20 | 0.26 |
PF13155 | Toprim_2 | 0.26 |
PF13360 | PQQ_2 | 0.26 |
PF01408 | GFO_IDH_MocA | 0.26 |
PF00654 | Voltage_CLC | 0.26 |
PF01011 | PQQ | 0.26 |
PF08592 | Anthrone_oxy | 0.26 |
PF06739 | SBBP | 0.26 |
PF12276 | DUF3617 | 0.26 |
PF07883 | Cupin_2 | 0.26 |
PF03928 | HbpS-like | 0.26 |
PF13577 | SnoaL_4 | 0.26 |
PF01476 | LysM | 0.26 |
PF12833 | HTH_18 | 0.26 |
PF00668 | Condensation | 0.26 |
PF00119 | ATP-synt_A | 0.26 |
PF07586 | HXXSHH | 0.26 |
PF13857 | Ank_5 | 0.26 |
PF00534 | Glycos_transf_1 | 0.26 |
PF13376 | OmdA | 0.26 |
PF05598 | DUF772 | 0.26 |
PF06445 | GyrI-like | 0.26 |
PF02086 | MethyltransfD12 | 0.26 |
PF00589 | Phage_integrase | 0.26 |
PF13551 | HTH_29 | 0.26 |
PF13468 | Glyoxalase_3 | 0.26 |
PF07746 | LigA | 0.26 |
PF03352 | Adenine_glyco | 0.26 |
PF10518 | TAT_signal | 0.26 |
PF09587 | PGA_cap | 0.26 |
COG ID | Name | Functional Category | % Frequency in 388 Family Scaffolds |
---|---|---|---|
COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 1.03 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.03 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.03 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.03 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.77 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.77 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.77 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.77 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.77 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.77 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.77 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.77 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.77 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.77 |
COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.52 |
COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 0.52 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 0.52 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.52 |
COG2832 | Uncharacterized membrane protein YbaN, DUF454 family | Function unknown [S] | 0.52 |
COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 0.52 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.26 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.26 |
COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.26 |
COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 0.26 |
COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.26 |
COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.26 |
COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.26 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.26 |
COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG1020 | EntF, seryl-AMP synthase component of non-ribosomal peptide synthetase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.26 |
COG1296 | Predicted branched-chain amino acid permease (azaleucine resistance) | Amino acid transport and metabolism [E] | 0.26 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.26 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.26 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.26 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.26 |
COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.26 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.26 |
COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.26 |
COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.26 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.26 |
COG3909 | Cytochrome c556 | Energy production and conversion [C] | 0.26 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.26 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.26 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.26 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.32 % |
Unclassified | root | N/A | 22.68 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459015|G14TP7Y02I020Y | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
2170459017|G14TP7Y02F77OW | Not Available | 524 | Open in IMG/M |
3300000443|F12B_11666604 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300000559|F14TC_100601186 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300000574|JGI1357J11328_10062811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1352 | Open in IMG/M |
3300000955|JGI1027J12803_100306005 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
3300000956|JGI10216J12902_125648249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300001838|RCM33_1101278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
3300001848|RCM47_1004128 | All Organisms → cellular organisms → Bacteria | 2510 | Open in IMG/M |
3300002561|JGI25384J37096_10139726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300004022|Ga0055432_10128543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 688 | Open in IMG/M |
3300004025|Ga0055433_10042770 | Not Available | 894 | Open in IMG/M |
3300004082|Ga0062384_100232176 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300004091|Ga0062387_101333352 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300004092|Ga0062389_103557735 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300004092|Ga0062389_104354781 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300004156|Ga0062589_102268902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300004480|Ga0062592_101516047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 644 | Open in IMG/M |
3300004635|Ga0062388_102773738 | Not Available | 516 | Open in IMG/M |
3300004778|Ga0062383_10710140 | Not Available | 514 | Open in IMG/M |
3300004782|Ga0062382_10070566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
3300005167|Ga0066672_10753921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 618 | Open in IMG/M |
3300005172|Ga0066683_10306774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
3300005186|Ga0066676_10704297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
3300005293|Ga0065715_10821055 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300005332|Ga0066388_107439692 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005332|Ga0066388_108627973 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005335|Ga0070666_10146062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1648 | Open in IMG/M |
3300005340|Ga0070689_100250087 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
3300005340|Ga0070689_100380850 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300005341|Ga0070691_10918074 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300005353|Ga0070669_100366392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
3300005353|Ga0070669_101834085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300005354|Ga0070675_100500244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1095 | Open in IMG/M |
3300005356|Ga0070674_100584770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 941 | Open in IMG/M |
3300005365|Ga0070688_100204300 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300005367|Ga0070667_102052307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300005436|Ga0070713_101150101 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300005438|Ga0070701_11168628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 545 | Open in IMG/M |
3300005438|Ga0070701_11308754 | Not Available | 518 | Open in IMG/M |
3300005455|Ga0070663_100411248 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300005456|Ga0070678_101074229 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300005457|Ga0070662_101612740 | Not Available | 560 | Open in IMG/M |
3300005467|Ga0070706_100340502 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
3300005534|Ga0070735_10873268 | Not Available | 528 | Open in IMG/M |
3300005537|Ga0070730_10418448 | Not Available | 866 | Open in IMG/M |
3300005538|Ga0070731_11064460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300005539|Ga0068853_101303104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300005539|Ga0068853_101822538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300005541|Ga0070733_10569391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
3300005542|Ga0070732_10871034 | Not Available | 550 | Open in IMG/M |
3300005543|Ga0070672_101238825 | Not Available | 665 | Open in IMG/M |
3300005543|Ga0070672_101731387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300005545|Ga0070695_101849597 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005546|Ga0070696_101710078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 542 | Open in IMG/M |
3300005549|Ga0070704_100559609 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300005549|Ga0070704_100572661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
3300005549|Ga0070704_101616591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300005563|Ga0068855_100663427 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300005578|Ga0068854_100386096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1155 | Open in IMG/M |
3300005598|Ga0066706_11208566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300005602|Ga0070762_10458761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
3300005614|Ga0068856_101444492 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300005615|Ga0070702_100087354 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
3300005616|Ga0068852_102853351 | Not Available | 501 | Open in IMG/M |
3300005719|Ga0068861_101151585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 748 | Open in IMG/M |
3300005764|Ga0066903_100329930 | All Organisms → cellular organisms → Bacteria | 2445 | Open in IMG/M |
3300005764|Ga0066903_101945660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1127 | Open in IMG/M |
3300005764|Ga0066903_102387564 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
3300005764|Ga0066903_103397302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
3300005764|Ga0066903_104350590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300005841|Ga0068863_100214827 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
3300005995|Ga0066790_10200427 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300006028|Ga0070717_10618230 | Not Available | 983 | Open in IMG/M |
3300006028|Ga0070717_10724269 | Not Available | 904 | Open in IMG/M |
3300006034|Ga0066656_10354552 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300006047|Ga0075024_100541713 | Not Available | 617 | Open in IMG/M |
3300006059|Ga0075017_101089276 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300006162|Ga0075030_101317158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
3300006163|Ga0070715_10597563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300006169|Ga0082029_1178075 | Not Available | 801 | Open in IMG/M |
3300006175|Ga0070712_100317617 | Not Available | 1266 | Open in IMG/M |
3300006178|Ga0075367_10636084 | Not Available | 678 | Open in IMG/M |
3300006196|Ga0075422_10463306 | Not Available | 570 | Open in IMG/M |
3300006358|Ga0068871_100166708 | Not Available | 1886 | Open in IMG/M |
3300006578|Ga0074059_11859640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 517 | Open in IMG/M |
3300006794|Ga0066658_10443811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300006797|Ga0066659_10415315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RBG_16_68_9 | 1062 | Open in IMG/M |
3300006844|Ga0075428_102393344 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300006845|Ga0075421_100991642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 952 | Open in IMG/M |
3300006846|Ga0075430_100678224 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300006854|Ga0075425_103150977 | Not Available | 502 | Open in IMG/M |
3300006880|Ga0075429_100221719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1656 | Open in IMG/M |
3300006881|Ga0068865_100360450 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300006881|Ga0068865_102210893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300006904|Ga0075424_100334102 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
3300006904|Ga0075424_101991166 | Not Available | 613 | Open in IMG/M |
3300006918|Ga0079216_10179352 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300006969|Ga0075419_11008352 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300007076|Ga0075435_100238145 | All Organisms → cellular organisms → Bacteria | 1547 | Open in IMG/M |
3300009012|Ga0066710_103501101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300009094|Ga0111539_10015518 | All Organisms → cellular organisms → Bacteria | 9471 | Open in IMG/M |
3300009094|Ga0111539_11275756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
3300009094|Ga0111539_12349726 | Not Available | 618 | Open in IMG/M |
3300009098|Ga0105245_11080091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae | 848 | Open in IMG/M |
3300009148|Ga0105243_12379051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300009156|Ga0111538_12470117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300009156|Ga0111538_13572826 | Not Available | 539 | Open in IMG/M |
3300009174|Ga0105241_12383875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300009176|Ga0105242_10173991 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
3300009176|Ga0105242_10320874 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
3300009176|Ga0105242_10565221 | Not Available | 1093 | Open in IMG/M |
3300009176|Ga0105242_11968043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300009177|Ga0105248_10133015 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2806 | Open in IMG/M |
3300009523|Ga0116221_1262531 | Not Available | 746 | Open in IMG/M |
3300009545|Ga0105237_10613848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1094 | Open in IMG/M |
3300009545|Ga0105237_11770679 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300009551|Ga0105238_11436387 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300009553|Ga0105249_11359281 | Not Available | 782 | Open in IMG/M |
3300009553|Ga0105249_11380817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300009609|Ga0105347_1062987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1348 | Open in IMG/M |
3300009637|Ga0116118_1211313 | Not Available | 605 | Open in IMG/M |
3300010048|Ga0126373_11352081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 778 | Open in IMG/M |
3300010049|Ga0123356_13694191 | Not Available | 529 | Open in IMG/M |
3300010325|Ga0134064_10506073 | Not Available | 502 | Open in IMG/M |
3300010329|Ga0134111_10421362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300010359|Ga0126376_10680554 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
3300010361|Ga0126378_12670434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300010366|Ga0126379_12745216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300010373|Ga0134128_12003691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300010373|Ga0134128_12225551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300010373|Ga0134128_13216591 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300010376|Ga0126381_101823753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 878 | Open in IMG/M |
3300010376|Ga0126381_102385509 | Not Available | 759 | Open in IMG/M |
3300010379|Ga0136449_101589400 | Not Available | 994 | Open in IMG/M |
3300010379|Ga0136449_104203613 | Not Available | 534 | Open in IMG/M |
3300010397|Ga0134124_10031562 | All Organisms → cellular organisms → Bacteria | 4389 | Open in IMG/M |
3300010399|Ga0134127_11772945 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300010401|Ga0134121_12145207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300011443|Ga0137457_1155882 | Not Available | 761 | Open in IMG/M |
3300011443|Ga0137457_1213186 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300012040|Ga0137461_1045973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
3300012134|Ga0137330_1017004 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300012134|Ga0137330_1042015 | Not Available | 600 | Open in IMG/M |
3300012166|Ga0137350_1080192 | Not Available | 656 | Open in IMG/M |
3300012189|Ga0137388_10181138 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300012189|Ga0137388_11441833 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300012199|Ga0137383_10794705 | Not Available | 691 | Open in IMG/M |
3300012208|Ga0137376_11028297 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300012212|Ga0150985_117558148 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300012231|Ga0137465_1142702 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300012361|Ga0137360_10982211 | Not Available | 728 | Open in IMG/M |
3300012362|Ga0137361_11152784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300012469|Ga0150984_106211961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300012469|Ga0150984_118385875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300012892|Ga0157294_10269519 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 532 | Open in IMG/M |
3300012906|Ga0157295_10340004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300012907|Ga0157283_10013756 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300012916|Ga0157310_10240723 | Not Available | 680 | Open in IMG/M |
3300012917|Ga0137395_10613042 | Not Available | 787 | Open in IMG/M |
3300012918|Ga0137396_10358278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
3300012923|Ga0137359_10188331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1843 | Open in IMG/M |
3300012925|Ga0137419_10841184 | Not Available | 753 | Open in IMG/M |
3300012925|Ga0137419_11157328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 646 | Open in IMG/M |
3300012927|Ga0137416_10779250 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300012927|Ga0137416_11861724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 550 | Open in IMG/M |
3300012929|Ga0137404_10623951 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300012943|Ga0164241_11196222 | Not Available | 561 | Open in IMG/M |
3300012948|Ga0126375_11411749 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300012985|Ga0164308_12038120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300013104|Ga0157370_10778401 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300013296|Ga0157374_11468187 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300013296|Ga0157374_12420037 | Not Available | 552 | Open in IMG/M |
3300013306|Ga0163162_10922092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
3300013306|Ga0163162_11427864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 788 | Open in IMG/M |
3300013308|Ga0157375_12068900 | Not Available | 677 | Open in IMG/M |
3300014153|Ga0181527_1291578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 646 | Open in IMG/M |
3300014159|Ga0181530_10525106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 587 | Open in IMG/M |
3300014159|Ga0181530_10578953 | Not Available | 551 | Open in IMG/M |
3300014168|Ga0181534_10604087 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300014169|Ga0181531_10716296 | Not Available | 622 | Open in IMG/M |
3300014262|Ga0075301_1089384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 653 | Open in IMG/M |
3300014269|Ga0075302_1137992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 582 | Open in IMG/M |
3300014325|Ga0163163_12589369 | Not Available | 565 | Open in IMG/M |
3300014326|Ga0157380_10546430 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300014493|Ga0182016_10350124 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300014495|Ga0182015_11000445 | Not Available | 519 | Open in IMG/M |
3300014654|Ga0181525_10655804 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300014655|Ga0181516_10226775 | Not Available | 948 | Open in IMG/M |
3300014968|Ga0157379_10552911 | Not Available | 1071 | Open in IMG/M |
3300014969|Ga0157376_12449007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300015372|Ga0132256_100008632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8772 | Open in IMG/M |
3300015372|Ga0132256_102406745 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300015374|Ga0132255_100755154 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
3300015374|Ga0132255_106160727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300016294|Ga0182041_10785280 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300016404|Ga0182037_11098009 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300016445|Ga0182038_10142513 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300017659|Ga0134083_10130049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
3300017823|Ga0187818_10274754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
3300017966|Ga0187776_10924620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 635 | Open in IMG/M |
3300018031|Ga0184634_10405704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas boonkerdii | 621 | Open in IMG/M |
3300018422|Ga0190265_11248074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 861 | Open in IMG/M |
3300018433|Ga0066667_11026474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
3300018469|Ga0190270_11424126 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 740 | Open in IMG/M |
3300018476|Ga0190274_10404167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1326 | Open in IMG/M |
3300018481|Ga0190271_10159375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2192 | Open in IMG/M |
3300019248|Ga0180117_1408354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1440 | Open in IMG/M |
3300019248|Ga0180117_1424331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 540 | Open in IMG/M |
3300020016|Ga0193696_1164244 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300020581|Ga0210399_11268348 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300020581|Ga0210399_11558421 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300020582|Ga0210395_11197605 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300020583|Ga0210401_10368704 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
3300020583|Ga0210401_10767553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 824 | Open in IMG/M |
3300021082|Ga0210380_10543711 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300021170|Ga0210400_10458079 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300021178|Ga0210408_11378053 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300021181|Ga0210388_10815406 | Not Available | 808 | Open in IMG/M |
3300021181|Ga0210388_11440649 | Not Available | 577 | Open in IMG/M |
3300021403|Ga0210397_10856853 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300021432|Ga0210384_10272392 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300021475|Ga0210392_10368147 | Not Available | 1043 | Open in IMG/M |
3300021478|Ga0210402_10615516 | Not Available | 1006 | Open in IMG/M |
3300021478|Ga0210402_11235989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
3300021479|Ga0210410_11642521 | Not Available | 536 | Open in IMG/M |
3300021560|Ga0126371_13109252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300021860|Ga0213851_1315254 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300022712|Ga0242653_1073080 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300022726|Ga0242654_10134553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 811 | Open in IMG/M |
3300022908|Ga0247779_1199020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 526 | Open in IMG/M |
3300023261|Ga0247796_1004963 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300023266|Ga0247789_1108044 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
(restricted) 3300024059|Ga0255040_10017782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2424 | Open in IMG/M |
3300025174|Ga0209324_10566110 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300025321|Ga0207656_10446060 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300025322|Ga0209641_10396608 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300025324|Ga0209640_10087871 | All Organisms → cellular organisms → Bacteria | 2682 | Open in IMG/M |
3300025893|Ga0207682_10411051 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300025901|Ga0207688_10730752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 626 | Open in IMG/M |
3300025903|Ga0207680_10248375 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300025907|Ga0207645_10596502 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300025909|Ga0207705_11018747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
3300025911|Ga0207654_10238065 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300025920|Ga0207649_10881184 | Not Available | 701 | Open in IMG/M |
3300025922|Ga0207646_10934895 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300025923|Ga0207681_10388237 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300025923|Ga0207681_10467940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
3300025925|Ga0207650_11344580 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300025926|Ga0207659_10701486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
3300025926|Ga0207659_11784100 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300025928|Ga0207700_10540935 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
3300025931|Ga0207644_11075405 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300025933|Ga0207706_10684037 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300025934|Ga0207686_11535928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 549 | Open in IMG/M |
3300025934|Ga0207686_11804705 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300025935|Ga0207709_11111376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
3300025936|Ga0207670_11232372 | Not Available | 634 | Open in IMG/M |
3300025938|Ga0207704_10040220 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
3300025938|Ga0207704_11969154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300025941|Ga0207711_10086598 | All Organisms → cellular organisms → Bacteria | 2747 | Open in IMG/M |
3300025941|Ga0207711_10256882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1605 | Open in IMG/M |
3300025941|Ga0207711_10354337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1359 | Open in IMG/M |
3300025941|Ga0207711_10972138 | Not Available | 788 | Open in IMG/M |
3300025941|Ga0207711_10985328 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300025941|Ga0207711_11558069 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300025941|Ga0207711_11720018 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300025942|Ga0207689_10782684 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300025945|Ga0207679_10810598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
3300025949|Ga0207667_10451652 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300026023|Ga0207677_11311708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
3300026035|Ga0207703_11612192 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300026041|Ga0207639_11867475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
3300026088|Ga0207641_10173756 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
3300026324|Ga0209470_1112483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1213 | Open in IMG/M |
3300026355|Ga0257149_1003722 | Not Available | 1761 | Open in IMG/M |
3300026550|Ga0209474_10442066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
3300027617|Ga0210002_1046162 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300027682|Ga0209971_1041347 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300027716|Ga0209682_10191304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
3300027765|Ga0209073_10126105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 926 | Open in IMG/M |
3300027818|Ga0209706_10539164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 530 | Open in IMG/M |
3300027831|Ga0209797_10376958 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300027857|Ga0209166_10289467 | Not Available | 863 | Open in IMG/M |
3300027876|Ga0209974_10255172 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 661 | Open in IMG/M |
3300027884|Ga0209275_10553149 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300027911|Ga0209698_11154571 | Not Available | 572 | Open in IMG/M |
3300027986|Ga0209168_10597086 | Not Available | 528 | Open in IMG/M |
3300028381|Ga0268264_11158272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
3300028381|Ga0268264_11463639 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300028536|Ga0137415_10162701 | Not Available | 2065 | Open in IMG/M |
3300028747|Ga0302219_10137631 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300028747|Ga0302219_10240728 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300028748|Ga0302156_10420191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 579 | Open in IMG/M |
3300028802|Ga0307503_10091485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1275 | Open in IMG/M |
3300028802|Ga0307503_10932501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300028819|Ga0307296_10764502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 527 | Open in IMG/M |
3300029636|Ga0222749_10237921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis bryophila | 923 | Open in IMG/M |
3300029883|Ga0311327_10223297 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300029953|Ga0311343_10992565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S190 | 661 | Open in IMG/M |
3300029999|Ga0311339_10182690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2403 | Open in IMG/M |
3300030294|Ga0311349_11874103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter | 553 | Open in IMG/M |
3300031184|Ga0307499_10082923 | Not Available | 849 | Open in IMG/M |
3300031228|Ga0299914_11504102 | Not Available | 525 | Open in IMG/M |
3300031234|Ga0302325_10505773 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1824 | Open in IMG/M |
3300031236|Ga0302324_102749455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300031240|Ga0265320_10349511 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300031455|Ga0307505_10153109 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1053 | Open in IMG/M |
3300031455|Ga0307505_10549785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
3300031545|Ga0318541_10504406 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300031545|Ga0318541_10685678 | Not Available | 572 | Open in IMG/M |
3300031547|Ga0310887_10513586 | Not Available | 723 | Open in IMG/M |
3300031547|Ga0310887_10652321 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300031547|Ga0310887_10845536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300031562|Ga0310886_10876484 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300031562|Ga0310886_11127452 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031564|Ga0318573_10460317 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300031679|Ga0318561_10768894 | Not Available | 529 | Open in IMG/M |
3300031679|Ga0318561_10811221 | Not Available | 514 | Open in IMG/M |
3300031680|Ga0318574_10935889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300031682|Ga0318560_10526261 | Not Available | 641 | Open in IMG/M |
3300031708|Ga0310686_102232798 | All Organisms → cellular organisms → Bacteria | 5136 | Open in IMG/M |
3300031708|Ga0310686_102625454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 922 | Open in IMG/M |
3300031713|Ga0318496_10385957 | Not Available | 774 | Open in IMG/M |
3300031715|Ga0307476_11444844 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300031716|Ga0310813_10264637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rugosimonospora → Rugosimonospora africana | 1437 | Open in IMG/M |
3300031716|Ga0310813_10293743 | Not Available | 1368 | Open in IMG/M |
3300031720|Ga0307469_12034400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
3300031744|Ga0306918_10629368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 841 | Open in IMG/M |
3300031747|Ga0318502_10913369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300031753|Ga0307477_10145854 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
3300031770|Ga0318521_10369864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 852 | Open in IMG/M |
3300031795|Ga0318557_10325635 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300031798|Ga0318523_10471610 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300031820|Ga0307473_10723042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 702 | Open in IMG/M |
3300031820|Ga0307473_11390688 | Not Available | 528 | Open in IMG/M |
3300031835|Ga0318517_10434854 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300031846|Ga0318512_10667896 | Not Available | 532 | Open in IMG/M |
3300031852|Ga0307410_10141741 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
3300031854|Ga0310904_11353065 | Not Available | 517 | Open in IMG/M |
3300031858|Ga0310892_11125083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
3300031892|Ga0310893_10042262 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
3300031902|Ga0302322_101070461 | Not Available | 974 | Open in IMG/M |
3300031908|Ga0310900_10634699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 848 | Open in IMG/M |
3300031908|Ga0310900_11466243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 575 | Open in IMG/M |
3300031910|Ga0306923_12055189 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031938|Ga0308175_100513907 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
3300031938|Ga0308175_102388916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300031938|Ga0308175_103258635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
3300031940|Ga0310901_10583668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 510 | Open in IMG/M |
3300031941|Ga0310912_11376081 | Not Available | 533 | Open in IMG/M |
3300031942|Ga0310916_10632987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 908 | Open in IMG/M |
3300031944|Ga0310884_10012621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3206 | Open in IMG/M |
3300031944|Ga0310884_10814197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300031944|Ga0310884_10888725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 549 | Open in IMG/M |
3300031946|Ga0310910_11049719 | Not Available | 636 | Open in IMG/M |
3300032001|Ga0306922_11261564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
3300032002|Ga0307416_103196419 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300032002|Ga0307416_103866629 | Not Available | 501 | Open in IMG/M |
3300032004|Ga0307414_11202708 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300032012|Ga0310902_10114016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1470 | Open in IMG/M |
3300032012|Ga0310902_10699641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 682 | Open in IMG/M |
3300032017|Ga0310899_10130967 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1050 | Open in IMG/M |
3300032063|Ga0318504_10538766 | Not Available | 560 | Open in IMG/M |
3300032075|Ga0310890_10189538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1401 | Open in IMG/M |
3300032076|Ga0306924_12246632 | Not Available | 555 | Open in IMG/M |
3300032144|Ga0315910_10101513 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
3300032144|Ga0315910_10192456 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
3300032144|Ga0315910_11463177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 533 | Open in IMG/M |
3300032157|Ga0315912_10631675 | Not Available | 853 | Open in IMG/M |
3300032180|Ga0307471_103674875 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300032211|Ga0310896_10625800 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300032261|Ga0306920_101798910 | Not Available | 865 | Open in IMG/M |
3300032515|Ga0348332_11105227 | Not Available | 524 | Open in IMG/M |
3300032770|Ga0335085_11978193 | Not Available | 592 | Open in IMG/M |
3300032895|Ga0335074_10262965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2015 | Open in IMG/M |
3300033289|Ga0310914_10703622 | Not Available | 906 | Open in IMG/M |
3300033407|Ga0214472_11433386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300033412|Ga0310810_10986138 | Not Available | 723 | Open in IMG/M |
3300033417|Ga0214471_11189438 | Not Available | 580 | Open in IMG/M |
3300033433|Ga0326726_12064607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 555 | Open in IMG/M |
3300033481|Ga0316600_10629814 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300033550|Ga0247829_10560567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
3300033551|Ga0247830_11171081 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300033551|Ga0247830_11266369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300034151|Ga0364935_0170935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300034177|Ga0364932_0383776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.70% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.38% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.87% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.58% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.32% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.06% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.06% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.80% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.55% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.55% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.29% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.29% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.29% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.03% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.03% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.03% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.03% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.03% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.77% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.77% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.77% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.77% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.77% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.52% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.52% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.52% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.52% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.52% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.26% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.26% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.26% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.26% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.26% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.26% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.26% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.26% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.26% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.26% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.26% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.26% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.26% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.26% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.26% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.26% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.26% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.26% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.26% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.26% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.26% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
4PV_01118500 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | VARYSVEKGQPHRLETLADANATRLFDNFEETKKGCSSAR |
4ZMR_01717390 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | LQSKGDIARYSVEKGQPHRLETLAGDHASRLFDGFEQARKSCSS |
F12B_116666041 | 3300000443 | Soil | LRSKGSVARYTVEKGQPHRLETLAGVNATRLFDGFEETKKGCSGR* |
F14TC_1006011861 | 3300000559 | Soil | RSKGTVARYSVEKGQPHRLETLAGPNATRLFDGFEETKRGCSR* |
JGI1357J11328_100628113 | 3300000574 | Groundwater | LRSKGTLARYTVEKGQPHRLETLAGASAGRLFDGFEETNKGCSQ* |
JGI1027J12803_1003060051 | 3300000955 | Soil | YTVEKGQPHRLETLAGANASRLFDGFEATKKGCNK* |
JGI10216J12902_1256482491 | 3300000956 | Soil | ARYTVEKGQPHRLDTLAGVNAGRLFDGFEETRKGCST* |
RCM33_11012783 | 3300001838 | Marine Plankton | NEVNYLRERGTVARYTVEKGQPHRLDTLAGENAHRLLEGFEVTKKGCSR* |
RCM47_10041285 | 3300001848 | Marine Plankton | ARYTEEKGQPHRMETLAGAGAARLFDNFAETKKGCSK* |
JGI25384J37096_101397262 | 3300002561 | Grasslands Soil | EFLRSKGTVARYTVEKGQHHRLETLAGANAGRLFDGFEETRKGCSK* |
Ga0055432_101285431 | 3300004022 | Natural And Restored Wetlands | GTVARYTVEKGQPHRIDTLAGENAHRLFEGFEETKKGCSK* |
Ga0055433_100427702 | 3300004025 | Natural And Restored Wetlands | GTVAQYSVEKGQPHRIETLAGANASRLFEGFEATKQGCSR* |
Ga0062384_1002321762 | 3300004082 | Bog Forest Soil | REAELLRSIGTVARYTVEKGQPHRLETLAGANAARLFDGFEETKNGCSK* |
Ga0062387_1013333521 | 3300004091 | Bog Forest Soil | TVARYTVEKGQPHRLDTLAGANAGRLFDGFEETRKGCSSN* |
Ga0062389_1035577351 | 3300004092 | Bog Forest Soil | EFLRSRGTVARYSVEKDQPHRLETLAGDGAARLFDGFEESEKGCSKS* |
Ga0062389_1043547813 | 3300004092 | Bog Forest Soil | EAEFLRSTGTVARYTVEMGQPHRLDTLAGANAGRLFDGFEEAKRGCTQ* |
Ga0062589_1022689022 | 3300004156 | Soil | EFLSSKGAVARYTVEKGQPHRLETLAGANAGRLFDGFEETKRGCGP* |
Ga0062592_1015160472 | 3300004480 | Soil | EYLSSHGSVARYSLEKDQPHRIETLAGAGAARLFDGFEAARRGCRR* |
Ga0062388_1027737383 | 3300004635 | Bog Forest Soil | STGTVARYTVEMGQPHRLDTLAGANAGRLFDGFEEAKRGCTQ* |
Ga0062383_107101401 | 3300004778 | Wetland Sediment | QGAVARYTLERGQGHRLETLADANAGRLFDNFEEASRGCTR* |
Ga0062382_100705661 | 3300004782 | Wetland Sediment | GDVARYTVDKGQPHRLDTLAGENASRLFDGFEQARMGCSQAK* |
Ga0066672_107539211 | 3300005167 | Soil | RSKGTVARYSVEKGQPHRLETLAGANAGRLFDGFEATDKGCSN* |
Ga0066683_103067741 | 3300005172 | Soil | GTVARYTVEKGQPHRLDTLAGTNAARLFDGFEETKKGCSSR* |
Ga0066676_107042972 | 3300005186 | Soil | GTVARYTVEKGQPHRLDTLAGTNAARLFDGFEETKKGCSR* |
Ga0065715_108210552 | 3300005293 | Miscanthus Rhizosphere | VARYTVEKGQPHRLDTLAGANASRLFDGFEEAKKSCRIQSTALR* |
Ga0066388_1074396922 | 3300005332 | Tropical Forest Soil | EAEFLRSKGTLARYSVEKGQPHRLETLAGANAGRLFDGFEETEKGCRR* |
Ga0066388_1086279731 | 3300005332 | Tropical Forest Soil | YGAVARYSVEEGQPHRLETLAGANAGRLFDGFDEAGKGCGK* |
Ga0070666_101460621 | 3300005335 | Switchgrass Rhizosphere | KGTVAHYTVEKGQPHRMETLAGGGAGRLFDGFEETKKGCSK* |
Ga0070689_1002500871 | 3300005340 | Switchgrass Rhizosphere | EYLRSRGTVARYTVEKGQPHRLDTLAGANASRLFDGFEEAKKGCRVESTARR* |
Ga0070689_1003808503 | 3300005340 | Switchgrass Rhizosphere | EFLRSKGTVARYTVEKGQPHRIETLAGVNASRLFDGFEETKKGCSR* |
Ga0070691_109180742 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | KGTVARYSVEKGQPHRLETLADANATRLFDNFEETKKGCSSAR* |
Ga0070669_1003663921 | 3300005353 | Switchgrass Rhizosphere | GAVARYTVEKGQPHRLDTLAGANAGRLFDGFEETKKGCSK* |
Ga0070669_1018340852 | 3300005353 | Switchgrass Rhizosphere | GTVARYTVEKGQPHRLETLAGAGAARLFDGFEETKKGCSK* |
Ga0070675_1005002443 | 3300005354 | Miscanthus Rhizosphere | VARYTVEKGQPHRLETLAGAAASRLFDGFEEARKSCTSR* |
Ga0070674_1005847703 | 3300005356 | Miscanthus Rhizosphere | ELLSAKGTVAHYTVEKGQPHRMETLAGAGAARLFDGFEETKKGCSK* |
Ga0070688_1002043003 | 3300005365 | Switchgrass Rhizosphere | RSKGTVARYTVEKGQPHRIETLAGVNASRLFDGFEETKKGCSR* |
Ga0070667_1020523071 | 3300005367 | Switchgrass Rhizosphere | TVARYTVEEGQPHRLETLAGASAARLFDGFEETKKGCSK* |
Ga0070713_1011501012 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK* |
Ga0070701_111686282 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | TVARYTVEKGQPHRIETLAGVNASRLFDGFEETKKGCSK* |
Ga0070701_113087542 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RGTVAKYSEEKGQPHRIETLAGASASRLFDGFEEAKKGCSR* |
Ga0070663_1004112483 | 3300005455 | Corn Rhizosphere | FLRSKGAVARYTVEQGQPHRIETLAGVNASRLFDGFEETKKGCSK* |
Ga0070678_1010742292 | 3300005456 | Miscanthus Rhizosphere | EVLRSMGTVARYTVEANQPHRLETLAGDGARRLFDGFDETKKGCSR* |
Ga0070662_1016127402 | 3300005457 | Corn Rhizosphere | GAVARYTVEKGQPHRLETLAGANASRLFDNFEEARKSCTTR* |
Ga0070706_1003405021 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KGTVARYTVEKGQPHRLDTLAGDHAARLFDGFEETKKGCSSQ* |
Ga0070735_108732681 | 3300005534 | Surface Soil | FLRSRGTSARYTVEKGQPHRLDTLAEGNAARLFNDFEETKQGCSK* |
Ga0070730_104184481 | 3300005537 | Surface Soil | KGTKARFIVEKGQPHRIETLTGAQAGRLFDGFEETAKGCSK* |
Ga0070731_110644602 | 3300005538 | Surface Soil | ARYTVEKGQPHRMETLAGDHAGRLFDDFEETKKGCSK* |
Ga0068853_1013031042 | 3300005539 | Corn Rhizosphere | EWLSSKGTVARYTVEKGQPHRMETLAGANAGRLFDGFEEAKKGCSK* |
Ga0068853_1018225382 | 3300005539 | Corn Rhizosphere | VEKGQPHRLDTLAGANASRLFDGFEEAKRGCKTESTARR* |
Ga0070733_105693911 | 3300005541 | Surface Soil | ARYTVEKGQPHRMETLAGPNAGRLFEGFEETKKGCSK* |
Ga0070732_108710342 | 3300005542 | Surface Soil | ARYTVEKGQPHRLETLAGANAVRLFDGFEETKKGCGL* |
Ga0070672_1012388251 | 3300005543 | Miscanthus Rhizosphere | KYSVEKGQPHRIETLAGANASRLFDGFEAVKNGCSR* |
Ga0070672_1017313872 | 3300005543 | Miscanthus Rhizosphere | EAEFLRSKGAVARYTVEKDQPHRIETLAGANASRLFDGFEETKKGCSR* |
Ga0070695_1018495972 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TVARYTVEKGQPHRMETLAGASASRLFEGFEETKKGCAK* |
Ga0070696_1017100782 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RSHGTVAQYSVEKGQPHRLETLAGANATRLFDGFEATKKGCRQRANK* |
Ga0070704_1005596091 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TVARYTVEKGQPHRLDTLAGANAARLFDGFEEARKGCRR* |
Ga0070704_1005726613 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | KGTLARYAVEKGQPHRLDTLAGANAGRLFDGFEETRKGCSQ* |
Ga0070704_1016165911 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VARYAVEKGQPHRLDTLAGANASRLFDGFEEAKRGCKTESTARR* |
Ga0068855_1006634272 | 3300005563 | Corn Rhizosphere | LRSKGTVARYTVEKGQPHRLDTLAGANAGRLFDGFEESKKGCSK* |
Ga0068854_1003860961 | 3300005578 | Corn Rhizosphere | EAEWLRSRGTVAHYTVEKGQPHRMETLAGANAGRIFDGFEETKKGCSK* |
Ga0066706_112085662 | 3300005598 | Soil | SKGTVARYTVEKGQPHRMDTLAGANAGRLFDGFEETKKGCSK* |
Ga0070762_104587612 | 3300005602 | Soil | VARYTVEKGQPHRMETLADANAGRLFDGFEETKKGCSK* |
Ga0068856_1014444922 | 3300005614 | Corn Rhizosphere | YTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK* |
Ga0070702_1000873543 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSKGSVARYTVEKGQPHRLDTLAGASASRLFDGFEEARKGCRQ* |
Ga0068852_1028533511 | 3300005616 | Corn Rhizosphere | KGTVARYTVEKGQPHRMETLAGVNAGRLFDGFEETKKGCSK* |
Ga0068861_1011515851 | 3300005719 | Switchgrass Rhizosphere | REAEYLSSHGSVARYSLEKDQPHRIETLAGAGAARLFEGFEAARQGCRR* |
Ga0066903_1003299304 | 3300005764 | Tropical Forest Soil | RYTVEKGQPHRLDTLAGENAHRLFEGFEETKKGCSK* |
Ga0066903_1019456603 | 3300005764 | Tropical Forest Soil | GTVAKYSVEAGQPHRLETLAGPNAARLFDGFEATKQGCRR* |
Ga0066903_1023875642 | 3300005764 | Tropical Forest Soil | ARYTVEKGQPHRLESLAGANAGRLFDGFEETKKGCRR* |
Ga0066903_1033973021 | 3300005764 | Tropical Forest Soil | YTVEKGQPHRIETLAGANAGRLFDGFEETKKGCSNQY* |
Ga0066903_1043505902 | 3300005764 | Tropical Forest Soil | EFLRSTGTVARYTVENGQPHRLETLAGANAGRLFDGFEETKKGCSK* |
Ga0068863_1002148273 | 3300005841 | Switchgrass Rhizosphere | GTVARYTVEKGQPHRLETLAGDNAKRLFEGFEETKKGCSRK* |
Ga0066790_102004272 | 3300005995 | Soil | KGTVARYTVEKKQPHRLDTLAGANASRLFDGFEETKKGCAK* |
Ga0070717_106182302 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ARYTVEKGQPHRMETLAGANAGRLFDGFEETHKGCSK* |
Ga0070717_107242692 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YTVEKGQPHRLETLAGENAGRLFDGFEETKKGCSK* |
Ga0066656_103545521 | 3300006034 | Soil | RYTVEKGQPHRLDTLAGANAGRLFDGFEETRKGCSQ* |
Ga0075024_1005417132 | 3300006047 | Watersheds | TVARYSVEKDQPHRLETLAGANAGRLFDNFEETGKGCSK* |
Ga0075017_1010892761 | 3300006059 | Watersheds | TVEKGQPHRMETLADDHAGRLFDGFEETKKGCSQ* |
Ga0075030_1013171582 | 3300006162 | Watersheds | TAARYTVEKGRPHRLDTLAGANAGRPFNGFEETKKRQVTI* |
Ga0070715_105975631 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LRAKGSVARYSVEKGQPHRLDTLAGTNASRLFDGFEEAKKGCKTESTARR* |
Ga0082029_11780751 | 3300006169 | Termite Nest | RSKGAIARYTVEKGSRTLETLAGANAARLFDGFEETKKGCSK* |
Ga0070712_1003176171 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RYTVEQGQPHRLETLAGENAGRLFDGFEETKKGCSK* |
Ga0075367_106360841 | 3300006178 | Populus Endosphere | EVEFLRSKGAVARYSLEKGQPHRLETLAGANAGRLFDGFEEAEKGCSK* |
Ga0075422_104633062 | 3300006196 | Populus Rhizosphere | RYTVEKGQPHRLETLAGEHAARLFEGFEQARKGCSS* |
Ga0068871_1001667081 | 3300006358 | Miscanthus Rhizosphere | YTVEEGQPHRLETLAGASAARLFDGFEETKKGCSK* |
Ga0074059_118596401 | 3300006578 | Soil | TVARYTVEKGQPHRLETLAGVNAGRLFDGFEETKKGCSK* |
Ga0066658_104438112 | 3300006794 | Soil | VARYTVEKGQPHRLDTLAGTNAARLFDGFEETKKGCSSR* |
Ga0066659_104153151 | 3300006797 | Soil | TVARYTVEKRQPHRLDTLAGANAGRLFDGFEETKKGCSK* |
Ga0075428_1023933441 | 3300006844 | Populus Rhizosphere | SKGTVARYTVERGQPHRLDTLAGANAGRLFDGFEETRKGCST* |
Ga0075421_1009916423 | 3300006845 | Populus Rhizosphere | TVARYTVEKGQPHRMETLAGASASRLFDGFEETKKGCAK* |
Ga0075430_1006782241 | 3300006846 | Populus Rhizosphere | LRSKGTVARYSVEKGQPHRLETLAGANATRLFDGFEETKKGCSR* |
Ga0075425_1031509771 | 3300006854 | Populus Rhizosphere | EAEFLSSHGTVAKYSVEKGQPHRIETLAGANASRLFDGFEAVKNGCSR* |
Ga0075429_1002217192 | 3300006880 | Populus Rhizosphere | TVATYTVEKGQPHRLETLAGANASRLFDGFEATKKGCNK* |
Ga0068865_1003604503 | 3300006881 | Miscanthus Rhizosphere | VARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK* |
Ga0068865_1022108932 | 3300006881 | Miscanthus Rhizosphere | YTVEKGQPHRMETLAGAGAARLFDGFEETKKGCSK* |
Ga0075424_1003341021 | 3300006904 | Populus Rhizosphere | TLEKGQPHRLESLAGANAGRLFDGFEETKKGCRK* |
Ga0075424_1019911662 | 3300006904 | Populus Rhizosphere | AVARYTVEKGQPHRLETLAGANAARLFDGFEEAKNGCSK* |
Ga0079216_101793522 | 3300006918 | Agricultural Soil | VARYTVEKGQPHRLDSLAGANAGRLFDGFEEARKGCTA* |
Ga0075419_110083521 | 3300006969 | Populus Rhizosphere | AEFLRSKGTKAHYTVEKGQPHRLETLAGANATRLFDGFEETKKGCSS* |
Ga0075435_1002381453 | 3300007076 | Populus Rhizosphere | VARYTVEKGQPHRLDTLAGANAGRLFDGFEETKKGCSK* |
Ga0066710_1035011012 | 3300009012 | Grasslands Soil | ARYTVEKGQPHRLETLAGANAARLFDGFEETKKGCSK |
Ga0111539_100155189 | 3300009094 | Populus Rhizosphere | VARYTVEKGQPHRLETLAGVNATRLFDGFEETKKGCSGR* |
Ga0111539_112757562 | 3300009094 | Populus Rhizosphere | LRSIGAVARYTVEKDQPHRLETLAGANAGRLFDGFEEAKRGCGP* |
Ga0111539_123497261 | 3300009094 | Populus Rhizosphere | TVARYTVEKGQPHRMETLAGAKASRLFEGFEETKQGCGK* |
Ga0105245_110800913 | 3300009098 | Miscanthus Rhizosphere | SKGTVARYSEEKGQPHRLETLAGAGAARLFENFEETKKGCSK* |
Ga0105243_123790511 | 3300009148 | Miscanthus Rhizosphere | LSAKGTVAHYTVEKGQPHRMETLAGGGAGRLFDGFEETKKGCSK* |
Ga0111538_124701171 | 3300009156 | Populus Rhizosphere | SKGTVAHYSVEKGQPHRLETLAGTNATRLFENFEETKKGCSK* |
Ga0111538_135728261 | 3300009156 | Populus Rhizosphere | EAEFLRSKGDVARYTVEKGQPHRLETLAGDHASRLFDGFEQARKSCSS* |
Ga0105241_123838751 | 3300009174 | Corn Rhizosphere | AEVLRANGTVARYTVEKGQPHRLETLAGANAVRLFDGFDETKKGCRK* |
Ga0105242_101739916 | 3300009176 | Miscanthus Rhizosphere | TVARYTVEKGQPHRLDTLAGASAARLFDGFEETRNGCRR* |
Ga0105242_103208744 | 3300009176 | Miscanthus Rhizosphere | ARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK* |
Ga0105242_105652212 | 3300009176 | Miscanthus Rhizosphere | TVEKGQPHRLDTLANANAHRLFEGFEESKKGCSK* |
Ga0105242_119680431 | 3300009176 | Miscanthus Rhizosphere | VARYTVEKGQPHRLDTLAGANASRLFDGFEEAKKGCRVESTARR* |
Ga0105248_101330151 | 3300009177 | Switchgrass Rhizosphere | RYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK* |
Ga0116221_12625312 | 3300009523 | Peatlands Soil | SKGTVARYTVEKGQPHRMETLAGANAGRLFEGFEETKKGCSK* |
Ga0105237_106138481 | 3300009545 | Corn Rhizosphere | LLISKGTLARYTVEKGQPHRLDTLAGAGAARLFDGFDQAAKGCTIQGAR* |
Ga0105237_117706791 | 3300009545 | Corn Rhizosphere | IGTVARCTVQKGHPHGMETLPGAGAGRLFDCFEETKKGCSR* |
Ga0105238_114363872 | 3300009551 | Corn Rhizosphere | SGTVAHYTVEKGQPHRLDTLAGANAGRLFDGFEETKKGCRTK* |
Ga0105249_113592812 | 3300009553 | Switchgrass Rhizosphere | EKGQPHRLETLAGANAGRLFDGFEEAKKGCSAKL* |
Ga0105249_113808172 | 3300009553 | Switchgrass Rhizosphere | YTVEKGQPHRLETLAGDHAGRLFDGFEEARKGCSS* |
Ga0105347_10629873 | 3300009609 | Soil | LARYTVEKGQPHRLDTLAGANAGRLFDGFEETKKGCSQ* |
Ga0116118_12113132 | 3300009637 | Peatland | GVTAQYTVEKGQPHRLDTLAGPNAGRLFDLFEQARHGCGK* |
Ga0126373_113520811 | 3300010048 | Tropical Forest Soil | SVEKGQPRRLETLAGANAARLFDGFEEAGKGCGK* |
Ga0123356_136941911 | 3300010049 | Termite Gut | RGTIARYTVEKDQPHRIETLAGAKAGRLFDGFEEAEKGCSK* |
Ga0134064_105060731 | 3300010325 | Grasslands Soil | EAEFLSRRGTVAKYSVEAGQPHRLETLAGANAARLFDGFEATKQGCSR* |
Ga0134111_104213622 | 3300010329 | Grasslands Soil | GTVARYTVEKGQQHRLETLAGANASRLFDGFEETKKGCSK* |
Ga0126376_106805541 | 3300010359 | Tropical Forest Soil | RYSVEKGQPHRLETLAGANAGRLFDGFEETGKGCSK* |
Ga0126378_126704342 | 3300010361 | Tropical Forest Soil | FLRSKGAVAHYAVEKGQPHRLETLAGANASRLFDNFEETKTGCSR* |
Ga0126379_127452161 | 3300010366 | Tropical Forest Soil | VARYAVEKSQPHRLETLAGANASRLFDNFEETKRGCSR* |
Ga0134128_120036912 | 3300010373 | Terrestrial Soil | AKGTVAHYTVEKVQPHWMETRAGSGAARWFDGLEETKKGCSK* |
Ga0134128_122255511 | 3300010373 | Terrestrial Soil | TVEKGQPHRMETLAGANAGRLFDGFEEAKKGCSK* |
Ga0134128_132165911 | 3300010373 | Terrestrial Soil | YTVEKGQPHRLETLAGPNATRLFDGFEETKKGCSK* |
Ga0126381_1018237532 | 3300010376 | Tropical Forest Soil | SVMGTLARYNVEKGQPHRLETLAGANATRLFDGFEEAQQGCSK* |
Ga0126381_1023855091 | 3300010376 | Tropical Forest Soil | LRSRGTVARYSVEKDQPHRLETLAGVNAGRLFDGFEETEKGCRN* |
Ga0136449_1015894002 | 3300010379 | Peatlands Soil | RSTGTVAHYTVEKGQPHRLETLAGVNAGRLFDGFAETKKGCSK* |
Ga0136449_1042036131 | 3300010379 | Peatlands Soil | YTVEKGQPHRLETLAGSNAGRLFDGFEESKKGCSK* |
Ga0134124_100315621 | 3300010397 | Terrestrial Soil | AELLSAKGTVARYTVEKGQPHRMETLAGAGAGRLFDGFEETKKGCSK* |
Ga0134127_117729451 | 3300010399 | Terrestrial Soil | VARYTLEKGQPHRLETLAGGGAGRLFDGFEETKKGCSK* |
Ga0134121_121452071 | 3300010401 | Terrestrial Soil | KGTVARYTVEKGQPHRLDTLAGANAGRLFDGFEETKKGCSK* |
Ga0137457_11558821 | 3300011443 | Soil | RGAVARYTVEKGQPHRLETLAGANASRLFEGFEEASRGCRR* |
Ga0137457_12131861 | 3300011443 | Soil | KGTVARYSVEKGQPHRLESLAGANATRLFDNFEETKKGCSSAGK* |
Ga0137461_10459732 | 3300012040 | Soil | STGAVARYTVEKGQPHRLDTLAGANARRLFEGFEETKKGCSR* |
Ga0137330_10170042 | 3300012134 | Soil | VARYTVEKGQPHRMETLAGTQASRLFDGFEETKKGCAR* |
Ga0137330_10420152 | 3300012134 | Soil | ARYTVEKGQPHRLETLAGANASRLSEGFEEASRGCRR* |
Ga0137350_10801921 | 3300012166 | Soil | REVEFLRARGTVARYSLEKGQPHRIETLVGANAGRLFDGFEETKKGCAR* |
Ga0137388_101811384 | 3300012189 | Vadose Zone Soil | AAILRAYGAVARYSVEEGQPHRLETLAGASAGRLFDGFEEAAKGCSK* |
Ga0137388_114418331 | 3300012189 | Vadose Zone Soil | ILSAYGADARYSVEEGQPHRLETLAGANAARLFDGFEEAGKGCGK* |
Ga0137383_107947052 | 3300012199 | Vadose Zone Soil | GAVARYSVEEGQPHRLETLAGASAGRLFDGFEEAGKGCSK* |
Ga0137376_110282972 | 3300012208 | Vadose Zone Soil | RYSLEKDQPHRLETLAGVNAARLFDGFEETKKGCSK* |
Ga0150985_1175581482 | 3300012212 | Avena Fatua Rhizosphere | MKAESDSLRGMGTAAYYIVEKGQAHGIQTLAGNNAGRLFDGFEATK |
Ga0137465_11427022 | 3300012231 | Soil | LRSMGAAARYIVEKGQAHGIQTLAGNNAGRLFDGFEESKKGCSN* |
Ga0137360_109822112 | 3300012361 | Vadose Zone Soil | SKGTVARFSEEKGQPHRIETLIGAGAGRLFDGFDETEKGCSK* |
Ga0137361_111527842 | 3300012362 | Vadose Zone Soil | LRSKGTVARYTVEKGQPHRMETLAGASAGRLFDGFEETKKGCSK* |
Ga0150984_1062119611 | 3300012469 | Avena Fatua Rhizosphere | AEMLRPKGTVARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK* |
Ga0150984_1183858751 | 3300012469 | Avena Fatua Rhizosphere | EISWLQSKGTVARYSLEKNQPHRLDTLAGANAHRLFDNFEEAKKGCSKS* |
Ga0157294_102695192 | 3300012892 | Soil | KGAVARYTVEKGQPHRLDTLAGANAGRLFDGFEETRKGCSQ* |
Ga0157295_103400042 | 3300012906 | Soil | YTVEKGQPHRLDTLAGAHASRLFDGFEETKKGCSR* |
Ga0157283_100137562 | 3300012907 | Soil | RGRGTVARYTVEKGQPHRIETLAGTGASRLFDGFEEATKGCSR* |
Ga0157310_102407232 | 3300012916 | Soil | FLRSKGAVARYTVEKGQPHRLETLAGANASRLFDNFEEARKSCTTR* |
Ga0137395_106130422 | 3300012917 | Vadose Zone Soil | KTEAAVLRAYGAVARYSVEEGQPHRLETLAGANAGRLFDGFEEAGKGCGK* |
Ga0137396_103582781 | 3300012918 | Vadose Zone Soil | ELLRDKGTVARYTVEKGQPHRLETLAGANAVRLFDGFDETKNGCSK* |
Ga0137359_101883311 | 3300012923 | Vadose Zone Soil | TVARYTVEKGQPHRLDTLAGPNAARLFDGFEETRKGCTTR* |
Ga0137419_108411842 | 3300012925 | Vadose Zone Soil | RSKGTVARYSVEQGQPHRLDTLAGANAGRLFDGFEETEKGCSK* |
Ga0137419_111573281 | 3300012925 | Vadose Zone Soil | VARYTVEKGQPHRMETLAGANAGRLFDGFEETRKGCSS* |
Ga0137416_107792502 | 3300012927 | Vadose Zone Soil | RAYGAVARYSVEEGQPHRLETLAGANAARLFDGFEEAAKGCGK* |
Ga0137416_118617241 | 3300012927 | Vadose Zone Soil | SVEEGQPHRLETLAGANAARLFDGFEEAGKGCGK* |
Ga0137404_106239511 | 3300012929 | Vadose Zone Soil | LARYSVEKGQPHRLETLAGANAGRLFDGFEETEKGCISK* |
Ga0164241_111962221 | 3300012943 | Soil | TVATYSVEKGQPHRLDTLAGSNAARLFDGFEATKAGCAH* |
Ga0126375_114117492 | 3300012948 | Tropical Forest Soil | RSKGTVARYSVEKGQPHRLETLAGPNAGRLFDGFEEAAKGCSK* |
Ga0164308_120381201 | 3300012985 | Soil | LRGRGTVARYTVEKGQPHRLETLAGANASRLFDNFEEARKSCTTRQP* |
Ga0157370_107784011 | 3300013104 | Corn Rhizosphere | RYTVEPGQPHRLETLAGANATRLFDGFEEARKSCATK* |
Ga0157374_114681871 | 3300013296 | Miscanthus Rhizosphere | LRSKGTVARYTVEKGQPHRMETLAGANASRLFDGFEETKKGCSK* |
Ga0157374_124200371 | 3300013296 | Miscanthus Rhizosphere | GTVARYTVAKGQPHRMETLAGAGAGRLFDGFEETKKGCSK* |
Ga0163162_109220923 | 3300013306 | Switchgrass Rhizosphere | YTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK* |
Ga0163162_114278641 | 3300013306 | Switchgrass Rhizosphere | HGTVAKYSVEKGQPHRIETLAGASASRLFDGFEAVKTGCRR* |
Ga0157375_120689002 | 3300013308 | Miscanthus Rhizosphere | VARYTVEKGQPHRLETLAGEHASRLFEGFEEARKGCSS* |
Ga0181527_12915782 | 3300014153 | Bog | WLRSKGTVARYTVEKGQPHRMETLADANAARLFDGFEETKKGCTK* |
Ga0181530_105251061 | 3300014159 | Bog | KGTVARYTVEKGQPHRMETLAGASAGRLFDNFEETKKGCSK* |
Ga0181530_105789531 | 3300014159 | Bog | LRSLGTVARYSVEQGQPHRLDTLAGANAGRLFDGFEEAGKGCGA* |
Ga0181534_106040872 | 3300014168 | Bog | GTLARYSVEAGQPHRLETLAGANAGRLFDGFDEAAKGCRK* |
Ga0181531_107162961 | 3300014169 | Bog | KEAEQLRSRGTVARYTVEKGQPHRLETLAGANAWRLFDGFEETKKGCSK* |
Ga0075301_10893841 | 3300014262 | Natural And Restored Wetlands | KGTLARYTVEEGQPHRLETLAGSNAGRLFDGFEETKKGCNR* |
Ga0075302_11379922 | 3300014269 | Natural And Restored Wetlands | AEYLSSHGSVARYSLEKDQPHRIETLAGDGAARLFEGFEAARQGCRR* |
Ga0163163_125893692 | 3300014325 | Switchgrass Rhizosphere | ARYTVEKGQPHRLETLAGANAGRLFDGFEETRKGCSK* |
Ga0157380_105464303 | 3300014326 | Switchgrass Rhizosphere | ARYTVEKGQPHRLDTLAGANASRLFDGFEEAKRGCKTESTARR* |
Ga0182016_103501241 | 3300014493 | Bog | SVEAGQPHRLETLAGANAGRLFDGFDEAAKGCRK* |
Ga0182015_110004453 | 3300014495 | Palsa | IGTVAHYTVEMGQPHRLETLAGDHAGRLFDGFEETKKGCSQ* |
Ga0181525_106558042 | 3300014654 | Bog | YTVEAGQPHRMETLAGANAGRLFDGFEETKKGCRTSAP* |
Ga0181516_102267752 | 3300014655 | Bog | FLRSKGTLARYSVEKDQPHRLETLANANAHRLFEGFEQAEKGCRSLVRAN* |
Ga0157379_105529112 | 3300014968 | Switchgrass Rhizosphere | YTVEKGQPHRMETLAGANAGRLFDGFEETRKGCSK* |
Ga0157376_124490071 | 3300014969 | Miscanthus Rhizosphere | YTVEKGQPHRLDTLAGANASRLFDGFEEAKRGCKTESTARR* |
Ga0132256_1000086321 | 3300015372 | Arabidopsis Rhizosphere | RSKGSVARYTVEKGQPHRLETLAGVNATRLFDGFEETKKGCSGR* |
Ga0132256_1024067451 | 3300015372 | Arabidopsis Rhizosphere | KGTVARYTVEKGQPHRMETLAGANASRLFDGFEETKKGCSK* |
Ga0132255_1007551541 | 3300015374 | Arabidopsis Rhizosphere | YLRSRGTVARYTVEKGQPHRLDTLAGANASRLFDGFEEAKKGCRVESTARR* |
Ga0132255_1061607271 | 3300015374 | Arabidopsis Rhizosphere | VARYTVEKGQPHRLETLAGANAGRLFDGFEETKNGCRR* |
Ga0182041_107852801 | 3300016294 | Soil | VEKDQPHRLDTLAGANAGRLFDGFEETKKGCQLQSR |
Ga0182037_110980091 | 3300016404 | Soil | SKGTVARYTVEKGQPHRMETLAGANASRLFDGFEETKKGCSK |
Ga0182038_101425133 | 3300016445 | Soil | YTVEPGQPHRLDTLAGDNAGRLFDGFEESREGCSR |
Ga0134083_101300493 | 3300017659 | Grasslands Soil | ARYTVEKGQPHRLDTLAGTNAARLFDGFEETKKGCSSR |
Ga0187818_102747542 | 3300017823 | Freshwater Sediment | GTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSN |
Ga0187776_109246201 | 3300017966 | Tropical Peatland | RGTLARYTVEKGQPHRLETLAGTGAARLFDGFEQTGKGCSK |
Ga0184634_104057041 | 3300018031 | Groundwater Sediment | LRSKGTVARYTVEKGQPHRLETLAGEKAARLFDGFEETRSGCNK |
Ga0190265_112480742 | 3300018422 | Soil | MKASIARYTVEKGQPHRLETLAGVNAGRLFDGFEETKKGCRQ |
Ga0066667_110264742 | 3300018433 | Grasslands Soil | AEFLRAKGTVARYTVEKGQPHRLDTLAGTNAARLFDGFEETKKGCSSR |
Ga0190270_114241262 | 3300018469 | Soil | FLRSQGAVARYTVEKGQPHRMATLEGANVARLFDGFEEAKRGCQ |
Ga0190274_104041673 | 3300018476 | Soil | GAVARYTVEKGQPHRMATLEGANAARLFDGFEEAKRGCRP |
Ga0190271_101593751 | 3300018481 | Soil | SKGAVARYTVEKGQPHRIETLAGASASRLFDNFDQTGKGCSK |
Ga0180117_14083542 | 3300019248 | Groundwater Sediment | SIGTAARYTVEKDQPHRLETLAGANAGRLFDGFEETKRGCSP |
Ga0180117_14243311 | 3300019248 | Groundwater Sediment | GTVARYTVEKGQPHRMETLAGASAGRLFDGFEETKKGCAR |
Ga0193696_11642442 | 3300020016 | Soil | TVARYTVEKGQPHRLDTLAGASASRLFDGFEEARKGCRQ |
Ga0210399_112683481 | 3300020581 | Soil | KGTVARYTVEKGQPHRMETLADANAGRLFDGFEETKKGCSK |
Ga0210399_115584212 | 3300020581 | Soil | FLRSIGTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSR |
Ga0210395_111976051 | 3300020582 | Soil | ARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0210401_103687044 | 3300020583 | Soil | QYTVEKGQPHRMETLAGASAGRLFDNFEETRRGCSK |
Ga0210401_107675531 | 3300020583 | Soil | FNGALARYTVEEGQPHRLETLAGANAGRLFDGFEETKKGCTS |
Ga0210380_105437111 | 3300021082 | Groundwater Sediment | LEKGQPHRLESLAGANATRLFDNFEETKKGCSSAGK |
Ga0210400_104580793 | 3300021170 | Soil | EAELLRSKGTVARYTVEKGQPHRLETLAGASAGRLFDGFEETKKGCSK |
Ga0210408_113780532 | 3300021178 | Soil | TVARYTVEKGQPHRLETLAGANAVRLFDGFEETKKGCSK |
Ga0210388_108154061 | 3300021181 | Soil | EGEAEYLRSLGTVARYTVEKNQPHRLETLAGANAGRLFDGFEEAQMGCGAK |
Ga0210388_114406491 | 3300021181 | Soil | STGTVARYTVEMGQPHRLDTLAGANAGRLFDGFEEAKKGCSQQK |
Ga0210397_108568531 | 3300021403 | Soil | LRSQGTLARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSQ |
Ga0210384_102723921 | 3300021432 | Soil | TGTVARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK |
Ga0210390_111817281 | 3300021474 | Soil | FTVEKGQHHRLETFENEGAARLFDQFEEARKGCGK |
Ga0210392_103681472 | 3300021475 | Soil | ARYTVEQGQPHRLETLAGENAGRLFDGFEETKKGCSK |
Ga0210402_106155163 | 3300021478 | Soil | LRARGGVARYTVEPGQPHRLDTLAGDNAARLFDGFEESRKGCSR |
Ga0210402_112359891 | 3300021478 | Soil | EFLRSRGTLARYSVEKGQPHRLDTLAGANAGRLFDGFEETGAGCSK |
Ga0210410_116425212 | 3300021479 | Soil | EAEYLRSLGTVARYTVEKNQPHRLETLAGANAGRLFDGFEEAQMGCGAK |
Ga0126371_131092521 | 3300021560 | Tropical Forest Soil | EAEFLRAKGPVPRYAAEKGQPHRLETLAGANASRLFDNFEETKKGCSR |
Ga0213851_13152541 | 3300021860 | Watersheds | EFLRSKGTVARYSVEMDQPHRLETLAGANAGRLFDGFEETAKGCSK |
Ga0242653_10730802 | 3300022712 | Soil | KGTVARYTVEKGQPHRLDTLAGANAGRLFDGFEETKKGCSK |
Ga0242654_101345532 | 3300022726 | Soil | ALARYTVEEGQPHRLETLAGANAGRLFDGFEETKKGCAS |
Ga0247779_11990201 | 3300022908 | Plant Litter | ARYTVEANQPHRLETLAGDGARRLFDGFEETKKGCSR |
Ga0247796_10049633 | 3300023261 | Soil | LSSHGSVARYSLEKDQPHRIETLAGAGAARLFDGFEAARRGCRR |
Ga0247789_11080441 | 3300023266 | Soil | RSKGTVARYSVEKGQPHRLESLAGANATRLFDNFEETKKGCSSAGK |
(restricted) Ga0255040_100177821 | 3300024059 | Seawater | AEFLRSKGTRARYTVEKDQLHRLDSLAGANAGRLFDGFEEAEERCSQ |
Ga0209324_105661101 | 3300025174 | Soil | ARYTVEKGQPHRLETLAGTRAGRLFDGFEEATRGCTR |
Ga0207656_104460601 | 3300025321 | Corn Rhizosphere | LRSKGTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0209641_103966082 | 3300025322 | Soil | LARYTVEKGQPHRLETLAGARASRLFDGFEEATRGCTH |
Ga0209640_100878713 | 3300025324 | Soil | MVEKGQPHRPEALAGANAGRLFDGFEETKKGCSRGRTEP |
Ga0207682_104110511 | 3300025893 | Miscanthus Rhizosphere | ARYTVEKGQPHRMETLAGANASRLFDGFEETKKGCSK |
Ga0207688_107307521 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | KGTVARYTVEKGQPHRIETLAGVNASRLFDGFEETKKGCSK |
Ga0207680_102483751 | 3300025903 | Switchgrass Rhizosphere | LSAKGTVAHYTVEKGQPHRMETLAGGGAGRLFDGFEETKKGCSK |
Ga0207645_105965021 | 3300025907 | Miscanthus Rhizosphere | ARYSVEKGQPHRLESLAGANATRLFDNFEETKKGCSSAGK |
Ga0207705_110187472 | 3300025909 | Corn Rhizosphere | RYTVEKGQPHRMETLAGANAGRLFDGFEEAKKGCSK |
Ga0207654_102380651 | 3300025911 | Corn Rhizosphere | KGTVARYTVEKGQPHRMETLAGANAGRLFDGFEEAKKGCSK |
Ga0207649_108811842 | 3300025920 | Corn Rhizosphere | ARYTVEKGQPHRLETLAGEHASRLFDGFEQARKGCSS |
Ga0207646_109348952 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TLARYTVEKGQPHRLDTLAGANAGRLFDGFEETRKGCRQ |
Ga0207681_103882371 | 3300025923 | Switchgrass Rhizosphere | RSKGTVARYSVEKGQPHRLETLAGMNATRLFDNFEETKKGCGSAK |
Ga0207681_104679401 | 3300025923 | Switchgrass Rhizosphere | ARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK |
Ga0207650_113445802 | 3300025925 | Switchgrass Rhizosphere | AKGTVARYTVEKGQPHRLDTLAGASASRLFDNFEEAKKGCNPSR |
Ga0207659_107014863 | 3300025926 | Miscanthus Rhizosphere | VARYTVEKGQPHRLETLAGTSASRLFDGFEEARKSCTSR |
Ga0207659_117841002 | 3300025926 | Miscanthus Rhizosphere | LRSKGTLARYTVEKGQPHRLDTLAGANASRLFEGFEQARKGCRQ |
Ga0207700_105409352 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LARYSVEKGQPHRLDTLAGANAGRLFDGFEETGSGCSK |
Ga0207644_110754053 | 3300025931 | Switchgrass Rhizosphere | RSRGTVARYTVEKGQPHRMETLAGASAGRLFDGFEETKKGCSK |
Ga0207706_106840372 | 3300025933 | Corn Rhizosphere | LRSKGTVARYSVEKGQPHRLESLAGANATRLFDNFEETKKGCSSAGK |
Ga0207686_115359282 | 3300025934 | Miscanthus Rhizosphere | TVARYTVEKGQPHRIETLAGVNASRLFDGFEETKKGCSK |
Ga0207686_118047051 | 3300025934 | Miscanthus Rhizosphere | REAEYLRSKGTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0207709_111113761 | 3300025935 | Miscanthus Rhizosphere | SAKGTVAHYTVEKGQPHRMETLAGGGAGRLFDGFEETKKGCSK |
Ga0207670_112323722 | 3300025936 | Switchgrass Rhizosphere | YTVEKGQPHRMETLAGANARRLFEGFEETKKGCSK |
Ga0207704_100402201 | 3300025938 | Miscanthus Rhizosphere | TVARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK |
Ga0207704_119691541 | 3300025938 | Miscanthus Rhizosphere | YTVEKGQPHRMETLAGAGAARLFDGFEETKKGCSK |
Ga0207711_100865986 | 3300025941 | Switchgrass Rhizosphere | RYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK |
Ga0207711_102568821 | 3300025941 | Switchgrass Rhizosphere | YTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK |
Ga0207711_103543371 | 3300025941 | Switchgrass Rhizosphere | KEAEFLRANGAVANYTVEKGQPHRLETLAGANAARLFDGFEETKKGCSK |
Ga0207711_109721382 | 3300025941 | Switchgrass Rhizosphere | KREAEFLSSHGTVAKYSVEKGQPHRIETLAGASASRLFDGFEAVNNGCRR |
Ga0207711_109853281 | 3300025941 | Switchgrass Rhizosphere | KREAEFLSSHGTVAKYSVEKGQPHRIETLAGASASRLFDGFEAVKNGCRR |
Ga0207711_115580691 | 3300025941 | Switchgrass Rhizosphere | ARYKVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0207711_117200182 | 3300025941 | Switchgrass Rhizosphere | GTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSR |
Ga0207689_107826842 | 3300025942 | Miscanthus Rhizosphere | VARYSVEKGQPHRLETLAGANATRLFDNFEETKKGCSSAR |
Ga0207679_108105981 | 3300025945 | Corn Rhizosphere | KGAVARYTVEKGQPHRLETLAGANASRLFDNFDEARKSCTTR |
Ga0207667_104516521 | 3300025949 | Corn Rhizosphere | LRSKGTVARYTVEKGQPHRLDTLAGANAGRLFDGFEESKKGCSK |
Ga0207677_113117082 | 3300026023 | Miscanthus Rhizosphere | RYTVEKGQPHRLDTLAGANASRLFEGFEEARKGCRL |
Ga0207703_116121922 | 3300026035 | Switchgrass Rhizosphere | VARYTVEKGQPHRLETLAGVNATRLFDGFEETKKGCSGR |
Ga0207639_118674752 | 3300026041 | Corn Rhizosphere | LLRSTGTVARYTVEMGQPHRLDTLAGANAGRLFDGFDETRKGCSK |
Ga0207641_101737563 | 3300026088 | Switchgrass Rhizosphere | EFLQSIGTVARYTVEKGQPHRLETLAGDNAKRLFEGFEETKKGCSRK |
Ga0209470_11124833 | 3300026324 | Soil | EAEFLRAKGTVAHYTVEKGQPHRLDTLAGTNAARLFDGFEETKKGCSSR |
Ga0257149_10037222 | 3300026355 | Soil | EAAVLRAYGAVARYSVEEGQPHRLETLAGDNARRLFEGFEEAGKGCGK |
Ga0209474_104420662 | 3300026550 | Soil | YTVEKGQPHRLDTLAGTNASRLFDDFEESKKGCTR |
Ga0210002_10461621 | 3300027617 | Arabidopsis Thaliana Rhizosphere | GSVAEFSEEKGQPHRIETLAGAGASRLFDGFEETKRGCSR |
Ga0209971_10413471 | 3300027682 | Arabidopsis Thaliana Rhizosphere | GSIARYTVEKGQPHRLETLAGVNATRLFDGFEETKKGCSGR |
Ga0209682_101913041 | 3300027716 | Wetland Sediment | VARYTVEKGQPHRIETVAGASAGRLFDGFEEAAKGCTAPADAERR |
Ga0209073_101261051 | 3300027765 | Agricultural Soil | WLRSRGTVAHYTVEKGQPHRMETLAGANAGRIFDGFEETKKGCSK |
Ga0209706_105391641 | 3300027818 | Freshwater Sediment | GSVAQYTVEKGQPHRLETLAGTGASRLFDGFETARQGCRR |
Ga0209797_103769581 | 3300027831 | Wetland Sediment | RYSVEKGQPHRIDTLIGAKAGRLFDGFEETKKGCVK |
Ga0209166_102894671 | 3300027857 | Surface Soil | RETEFLLGKGTKARFIVEKGQPHRIETLTGAQAGRLFDGFEETAKGCSK |
Ga0209974_102551722 | 3300027876 | Arabidopsis Thaliana Rhizosphere | YTVEKGQPHRLDTLAGANAHRLFDGFEESNKGCVSRQTTSQRR |
Ga0209275_105531491 | 3300027884 | Soil | RYTVEKGQPHRLETLAGANAARLFDGFEETRKGCSN |
Ga0209698_111545712 | 3300027911 | Watersheds | KGTAARYTVEKGRPHRLDTLAGANAGRPFNGFEETKKRQVTI |
Ga0209168_105970861 | 3300027986 | Surface Soil | FLRSRGTSARYTVEKGQPHRLDTLAEGNAARLFNDFEETKQGCSK |
Ga0268264_111582721 | 3300028381 | Switchgrass Rhizosphere | GTVARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK |
Ga0268264_114636391 | 3300028381 | Switchgrass Rhizosphere | ARYTVEKGQPHRLDTLAGASASRLFDGFEEARKGCRQ |
Ga0137415_101627011 | 3300028536 | Vadose Zone Soil | RAYGAVARYSVEEGQPHRLETLAGANAARLFDGFEEAGKGCGK |
Ga0302219_101376312 | 3300028747 | Palsa | RAGGTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0302219_102407281 | 3300028747 | Palsa | LLRSGGTVARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK |
Ga0302156_104201912 | 3300028748 | Bog | TVAHYTVEKGQPHRMATLADEYAGRLFDGFEETKKGCSK |
Ga0307503_100914851 | 3300028802 | Soil | REAEFLRSIGAVARYTVEKEQPHRLETLAGANAGRLFDGFEEAKRSCGP |
Ga0307503_109325012 | 3300028802 | Soil | AEFLRGRGTVARYTVEKGQPHRIETLAGTGASRLFDGFEEATKGCSR |
Ga0307296_107645022 | 3300028819 | Soil | GTVALYSVERGQPHRLETLAGANAGRLFDGFDATKKGCRRPSK |
Ga0222749_102379211 | 3300029636 | Soil | LARYTVEEGQPHRLETLAGANAGRLFGGFEETKKGCTS |
Ga0311327_102232973 | 3300029883 | Bog | HYTVEKGQPHRMATLADEYAGRLFDGFEETKKGCSK |
Ga0311343_109925652 | 3300029953 | Bog | GTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0311339_101826901 | 3300029999 | Palsa | KEAEWLRSKGTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0311349_118741032 | 3300030294 | Fen | KGTVARYTVEKGQPHRLDTLAGANAKRLFEGFDETKKGCSK |
Ga0307499_100829232 | 3300031184 | Soil | RGTVARYTVEKGQPHRMETLAGASAARLFDGFEETKKGCSK |
Ga0299914_115041022 | 3300031228 | Soil | VARYTVEIGQAHRIETLAGENAGRLFDGFEAATQGCTQ |
Ga0302325_105057733 | 3300031234 | Palsa | TVEKGQPHRLETLAGPNAARLFDLFEQAKKGCSKTSSN |
Ga0302324_1027494551 | 3300031236 | Palsa | LRSMGTVARYTVEKGQPHRLETLAGANAGRLFDGFEETKKGCSK |
Ga0265320_103495112 | 3300031240 | Rhizosphere | RSKGTVARYTVEKGQPHRMETLAGAGAGRLFDGFEETRKGCSQ |
Ga0307505_101531092 | 3300031455 | Soil | MYTVEKGQPHRMATLEGANVSRLFEGFEEAKKGCGT |
Ga0307505_105497851 | 3300031455 | Soil | FLRARGTVARYTVEKGQPHRIETLAGVSAGRLFDGFEETKKGCTGR |
Ga0318541_105044061 | 3300031545 | Soil | KGTVARYTVEKGQPHRMETLADANAGRLFDGFEETKKGCSP |
Ga0318541_106856781 | 3300031545 | Soil | GTVARYTVEQGQPHRLETLAGENAGRLFDGFEETKKGCSK |
Ga0310887_105135862 | 3300031547 | Soil | EFLRSKGDVARYTVEKGQPHRLETLAGEHASRLFEGFEEARKGCSS |
Ga0310887_106523211 | 3300031547 | Soil | AEFLRSKGTVARYSVEKGQPHRLETLAGPNATRLFDGFEETKRGCSR |
Ga0310887_108455362 | 3300031547 | Soil | SIGAAARYTVETGQPHRLETLAGANAGRLFDGFEETKKGCGP |
Ga0310886_108764842 | 3300031562 | Soil | VEKGQPHRLESLAGANATRLFDNFEETKKGCSSAGK |
Ga0310886_111274522 | 3300031562 | Soil | TVARYSVEKGQPHRLDTLAGANASRLFDGFEEAKRGCRTESTARR |
Ga0318573_104603171 | 3300031564 | Soil | YTVEKDQPHRLDTLAGANAGRLFDGFEEAKKGCQLQSR |
Ga0318561_107688941 | 3300031679 | Soil | AKYSVEKGQPHRIETLAGTNASRLFDGFDAVKSGCSR |
Ga0318561_108112212 | 3300031679 | Soil | YTVEKGQPHRMETLADANAGRLFDGFEETKKGCSP |
Ga0318574_109358891 | 3300031680 | Soil | ARYSVEKGQPHRLETLAGANAARLFDGFEEAQQGCSK |
Ga0318560_105262612 | 3300031682 | Soil | AEFLRSKGTVARYTVEQGQPHRLETLAGENAGRLFDGFEETKKGCSK |
Ga0310686_1022327981 | 3300031708 | Soil | AEWLRSKGTVARYTVEKGQPHRMETLAGAHAGRLFDDFEETRKGCSR |
Ga0310686_1026254542 | 3300031708 | Soil | QKEAELLSSHGTVARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0318496_103859572 | 3300031713 | Soil | TVARYTVEQGQPHRLETLAGENAGRLFDGFEETKKGCSK |
Ga0307476_114448442 | 3300031715 | Hardwood Forest Soil | RYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSR |
Ga0310813_102646371 | 3300031716 | Soil | RSMGADARYIVEKGQGHGIQTLAGNNAGRLFDGFEETKKGCSN |
Ga0310813_102937431 | 3300031716 | Soil | LRSKGDIARYTVEKGQPHRMETLAGENAKRLFEGFEEARKGCTL |
Ga0307469_120344001 | 3300031720 | Hardwood Forest Soil | YTVEKGQPHRLETLAGAGAARLFDNFEETRKGCSR |
Ga0306918_106293681 | 3300031744 | Soil | AKYSVEKGQPHRIETLAGANASRLFDGFEAVKNGCSR |
Ga0318502_109133691 | 3300031747 | Soil | YSVEKGQPHRLETLAGPSASRLFDNFEETKKGCSR |
Ga0307477_101458543 | 3300031753 | Hardwood Forest Soil | VARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0318521_103698642 | 3300031770 | Soil | VARYTVEQGQPHRLETLAGENAGRLFDGFEETKKGCSK |
Ga0318557_103256352 | 3300031795 | Soil | YSVEKGQPHRIETLAGANASRLFDGFEAVKNGCSR |
Ga0318523_104716101 | 3300031798 | Soil | ARYTVEKAQPHRLDTLAGANAGRLFDGFEEAKKGCQLQSR |
Ga0307473_107230421 | 3300031820 | Hardwood Forest Soil | VARYTVEQGQPHRLETLAGANAGRLFDGFEEAEKGCSK |
Ga0307473_113906881 | 3300031820 | Hardwood Forest Soil | WLRSKGTLARYTVEKGQPHRMETLAGANAGRLFDGFEETKKGCSK |
Ga0318517_104348542 | 3300031835 | Soil | RYTVEKDQPHRLDTLAGANAGRLFDGFEETKKGCQLQSR |
Ga0318512_106678962 | 3300031846 | Soil | YTVEQGQPHRLETLAGENAGRLFDGFEETKKGCSK |
Ga0307410_101417412 | 3300031852 | Rhizosphere | HDEMRREAQALTAAGSVARYTLEQGQGHRLETLAGANAARLFDDFDEARRGCTRQP |
Ga0310904_113530652 | 3300031854 | Soil | VARYTVEKGQPHRLETLAGEHASRLFEGFEEARKGCSS |
Ga0310892_111250832 | 3300031858 | Soil | KGAVARYTVEKDQPHRIETLAGANASRLFDGFEETKKGCSR |
Ga0310893_100422621 | 3300031892 | Soil | KGSVARYTVEKGQPHRLETLAGVNATRLFDGFEETKKGCSGR |
Ga0302322_1010704611 | 3300031902 | Fen | VEFLKARRTVAKYTVEKGQPHRIETLAGDKAGRLFEGFEATKQGCTR |
Ga0310900_106346991 | 3300031908 | Soil | TVARYTVEKGQPHRIETLAGVNASRLFDGFEETKKGCSR |
Ga0310900_114662432 | 3300031908 | Soil | DEMQREAEYLSSHGSVARYSLEKGQPHRIETLAGDGAARLFEGFEAARQGCRR |
Ga0306923_120551892 | 3300031910 | Soil | RSKGTVARYTVEKGQPHRMETLAGANASRLFEGFEETKKGCSK |
Ga0308175_1005139073 | 3300031938 | Soil | GTVAHYTVEKGQPHRMETLAGDGASRLFANFEETKKGCSSR |
Ga0308175_1023889162 | 3300031938 | Soil | SSKGTVAHYTVEKGQPHRMETLAGANAGRLFDGFEETRKGCSK |
Ga0308175_1032586352 | 3300031938 | Soil | LRAKGTVARYTVEKGQPHRLDTLAGPNAKRLFEGFEETKKGCAK |
Ga0310901_105836682 | 3300031940 | Soil | KGDVARYTVEKGQPHRLETLAGEHASRLFDGFEQARKGCSS |
Ga0310912_113760812 | 3300031941 | Soil | KGTVARYTVEQGQPHRLETLAGENAGRLFDGFEETKKGCSK |
Ga0310916_106329871 | 3300031942 | Soil | RSKGTVARYTVEKGQPHRLETLAGANATRLFDGFEETQKGCSK |
Ga0310884_100126215 | 3300031944 | Soil | EAEFLRSKGTVARYTVEKGQPHRLETLAGANATRLFDGFEETRKGCSR |
Ga0310884_108141971 | 3300031944 | Soil | GAAARYTVETGQPHRLETLAGANAGRLFDGFEETKKGCGP |
Ga0310884_108887251 | 3300031944 | Soil | FLRSKGDVARYTVEKGQPHRLETLAGEHASRLFDGFEQARKGCSS |
Ga0310910_110497192 | 3300031946 | Soil | YTVEEGQPHRLDTLAGDHAGRLFDGFEETAKGCSK |
Ga0306922_112615642 | 3300032001 | Soil | VMGTLARYSVEKGQPHRLETLAGANAARLFDGFEEAQQGCSK |
Ga0307416_1031964192 | 3300032002 | Rhizosphere | LTAAGSVARYTLEQGQGHRLETLAGANAARLFDDFEEARRGCVRQP |
Ga0307416_1038666292 | 3300032002 | Rhizosphere | STGDIARYTVEKGQPHRLETLAGEHASRLFEGFEEARKGCSS |
Ga0307414_112027082 | 3300032004 | Rhizosphere | TAAGSVARYTLEQGQGHRLETLAGANAARLFDDFDEARRGCTRRP |
Ga0310902_101140162 | 3300032012 | Soil | REAEFLRSIGAVARYTVEKDQPHRLETLAGAHAGRLFDGFEETKKGCGP |
Ga0310902_106996412 | 3300032012 | Soil | LGSHGSIARYSLEKGQPHRIETLAGTGASRLFDGFEAARKGCRS |
Ga0310899_101309672 | 3300032017 | Soil | EFLRSKGTVARYSVEKGQPHRLETLAGLNATRLFDGFEETKRGCSR |
Ga0318504_105387661 | 3300032063 | Soil | AEFLRSRGTVARYTVEEGQPHRLDTLAGDHAGRLFDGFEETAKGCSK |
Ga0310890_101895381 | 3300032075 | Soil | YTVEKGQPHRLETLAGEHASRLFDGFEQARKGCSS |
Ga0306924_122466322 | 3300032076 | Soil | GTLARYTVENDQLHRLDTLAGANAGRLFDGFEETKKGCRLQSP |
Ga0315910_101015133 | 3300032144 | Soil | EREAKVLSAAGTVARYSVERGQGHRLETLAGQSAGRLFDGFEEASRGGCTQ |
Ga0315910_101924561 | 3300032144 | Soil | YTVEKGQPHRLETLAGANAGRLFEGFEQARRGCRTNDR |
Ga0315910_114631772 | 3300032144 | Soil | EAEYLVARGSVAEYHLEKGQPHRIETLAGAGASRLFDGFETARKGCRRS |
Ga0315912_106316751 | 3300032157 | Soil | GGTVARYTVEKGQPHRMATLEGANVSRLFDGFEETKKGCSSR |
Ga0307471_1036748752 | 3300032180 | Hardwood Forest Soil | VKFLQARGTVAKYSEEKGQPHRLETLAGTSASRLFDGFEAAKKGCSR |
Ga0310896_106258002 | 3300032211 | Soil | GTVARYSVEKGQPHRLESLAGANATRLFDNFEETKKGCSSAGK |
Ga0306920_1017989102 | 3300032261 | Soil | AEFLRSKGTLARYTVEKGQPHRLDTLAGANAARLFEGFEETKKGCSK |
Ga0348332_111052271 | 3300032515 | Plant Litter | YTVEKGQPHRMETLADAHAGRLFDDFDETKKGCCK |
Ga0335085_119781932 | 3300032770 | Soil | LRSRGTVAKYSVEAGQPHRIETLAGDGAARLFDGFEATKQGCHR |
Ga0335074_102629654 | 3300032895 | Soil | REAEWLSAKGDVAHYTVEKGQPHRLATLAGANAGRLFDGFDEARKGCTK |
Ga0310914_107036221 | 3300033289 | Soil | KDQPHRLDTLAGANAGRLFNGFEEAKKGCQLQSRRD |
Ga0214472_114333863 | 3300033407 | Soil | RAQGAVARYTVEKGQPHRLDTLTGAGAGRLFDGFEEARTGCTR |
Ga0310810_109861382 | 3300033412 | Soil | ARYAVEKGQPHRMETLAGAQASRLFDGFEEARTSCAGK |
Ga0214471_111894382 | 3300033417 | Soil | EFLRALGTVARYTVEKSQPHRLETLAGANSARLFEGFEEAKRGCAL |
Ga0326726_120646071 | 3300033433 | Peat Soil | LSSHGTVAQYSVERGQPHRLETLAGENAGRLFDGFEATKKGCRQPSK |
Ga0316600_106298141 | 3300033481 | Soil | ARYTVEKGQPHRLETLAGANASRLFDGFEETKKGCSR |
Ga0247829_105605672 | 3300033550 | Soil | ETEFLRSKGAVARYTVEKDQPHRIETLAGANASRLFDGFEETKKGCSR |
Ga0247830_111710811 | 3300033551 | Soil | TVARYTLEQGQGHRLESLAGANAARLFEGFEEARRGCTR |
Ga0247830_112663691 | 3300033551 | Soil | ARYTVEKDQPHRIETLAGANASRLFDGFEETKKGCSR |
Ga0364935_0170935_1_147 | 3300034151 | Sediment | EAEFLRGKGTVARYTVEKGQPHRIETLAGASASRLFDNFDETGKGCSK |
Ga0364932_0383776_396_530 | 3300034177 | Sediment | LRSKGAVARYTVEKGQPHRLDTLAGANAGRLFDGFEETKKGCSL |
⦗Top⦘ |