Metagenome / Metatranscriptome Family F004844

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F004844
Family Type	Metagenome / Metatranscriptome
Number of Sequences	421
Average Sequence Length	39 residues
Representative Sequence	MSRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL
Number of Associated Samples	287
Number of Associated Scaffolds	421

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	56.29 %
% of genes near scaffold ends (potentially truncated)	17.34 %
% of genes from short scaffolds (< 2000 bps)	82.66 %
Associated GOLD sequencing projects	261
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (88.361 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (7.126 % of family members)
Environment Ontology (ENVO)	Unclassified (27.553 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (45.606 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.53
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 421 Family Scaffolds
PF12773	DZR	20.90
PF00334	NDK	8.55
PF08245	Mur_ligase_M	6.65
PF13396	PLDc_N	5.70
PF10458	Val_tRNA-synt_C	3.56
PF08241	Methyltransf_11	2.85
PF02545	Maf	0.71
PF13649	Methyltransf_25	0.71
PF00583	Acetyltransf_1	0.48
PF01636	APH	0.48
PF13302	Acetyltransf_3	0.48
PF06723	MreB_Mbl	0.48
PF14691	Fer4_20	0.24
PF08264	Anticodon_1	0.24
PF13610	DDE_Tnp_IS240	0.24
PF01019	G_glu_transpept	0.24
PF01522	Polysacc_deac_1	0.24
PF06971	Put_DNA-bind_N	0.24
PF02595	Gly_kinase	0.24
PF10150	RNase_E_G	0.24
PF12911	OppC_N	0.24
PF09924	LPG_synthase_C	0.24
PF01274	Malate_synthase	0.24
PF06175	MiaE	0.24

COG ID	Name	Functional Category	% Frequency in 421 Family Scaffolds
COG0105	Nucleoside diphosphate kinase	Nucleotide transport and metabolism [F]	8.55
COG0424	7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.71
COG1077	Cell shape-determining ATPase MreB, actin-like superfamily	Cell cycle control, cell division, chromosome partitioning [D]	0.48
COG4445	tRNA isopentenyl-2-thiomethyl-A-37 hydroxylase MiaE (synthesis of 2-methylthio-cis-ribozeatin)	Translation, ribosomal structure and biogenesis [J]	0.48
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	0.24
COG0726	Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family	Cell wall/membrane/envelope biogenesis [M]	0.24
COG1929	Glycerate kinase	Carbohydrate transport and metabolism [G]	0.24
COG2225	Malate synthase	Energy production and conversion [C]	0.24

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	88.36 %
Unclassified	root	N/A	11.64 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	88.36 %
Unclassified	root	N/A	11.64 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	88.36 %
Unclassified	root	N/A	11.64 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	75.53 %
Unclassified	root	N/A	11.64 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	75.30 %
Unclassified	root	N/A	11.64 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.24 %

Name	Rank	Taxonomy	Distribution
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	14.25 %
Unclassified	root	N/A	11.64 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4.99 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.24 %

Name	Rank	Taxonomy	Distribution
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	12.83 %
Unclassified	root	N/A	11.64 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	4.99 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	11.64 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	4.99 %
Conexibacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae	2.14 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.24 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	11.64 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	4.99 %
Conexibacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter	2.14 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.24 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.24 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	11.64 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	4.99 %
Conexibacter woesei	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	2.14 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.24 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.24 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908007\|FWIRElOz_GKZ9IRQ02JVVWT	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	506	Open in IMG/M
2124908032\|Perma_A_C_ConsensusfromContig74276	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	923	Open in IMG/M
2124908039\|B3_v_NODE_18523_len_1894_cov_6_930834	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1944	Open in IMG/M
2124908043\|A2_c1_ConsensusfromContig26672	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	784	Open in IMG/M
2140918006\|ConsensusfromContig12974	All Organisms → cellular organisms → Bacteria	1114	Open in IMG/M
2140918007\|ConsensusfromContig197612	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	775	Open in IMG/M
2140918025\|NODE_409489_length_2008_cov_7.839143	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2058	Open in IMG/M
2166559005\|cont_contig00967	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3248	Open in IMG/M
2170459003\|FZ032L002GLVQI	Not Available	540	Open in IMG/M
2170459003\|FZ032L002JMEVM	Not Available	509	Open in IMG/M
2170459003\|FZN2CUW02IPH8B	Not Available	518	Open in IMG/M
2170459010\|GIO7OMY01APKFU	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	500	Open in IMG/M
2170459016\|G1P06HT02GX3KC	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	556	Open in IMG/M
2189573000\|GPBTN7E02IDVZL	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	525	Open in IMG/M
2228664022\|INPgaii200_c1064554	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	556	Open in IMG/M
3300000880\|AL20A1W_1046853	All Organisms → cellular organisms → Bacteria	2092	Open in IMG/M
3300000955\|JGI1027J12803_100072059	All Organisms → cellular organisms → Bacteria	1370	Open in IMG/M
3300001205\|C688J13580_1050867	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	560	Open in IMG/M
3300001305\|C688J14111_10178711	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	656	Open in IMG/M
3300001532\|A20PFW1_1061769	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	5337	Open in IMG/M
3300001535\|A3PFW1_10217589	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1002	Open in IMG/M
3300001536\|A1565W1_11182269	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1467	Open in IMG/M
3300001538\|A10PFW1_11011381	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1382	Open in IMG/M
3300001538\|A10PFW1_11172418	Not Available	2171	Open in IMG/M
3300001686\|C688J18823_10150302	All Organisms → cellular organisms → Bacteria	1597	Open in IMG/M
3300001686\|C688J18823_10465797	All Organisms → cellular organisms → Bacteria	812	Open in IMG/M
3300001686\|C688J18823_10530914	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	753	Open in IMG/M
3300002568\|C688J35102_118440301	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	560	Open in IMG/M
3300002568\|C688J35102_118490009	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	564	Open in IMG/M
3300002568\|C688J35102_119921687	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	815	Open in IMG/M
3300002568\|C688J35102_120786600	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1577	Open in IMG/M
3300002568\|C688J35102_120886950	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2030	Open in IMG/M
3300002568\|C688J35102_120962082	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3271	Open in IMG/M
3300004081\|Ga0063454_101099587	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	649	Open in IMG/M
3300004081\|Ga0063454_101371097	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300004479\|Ga0062595_102455303	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	518	Open in IMG/M
3300004643\|Ga0062591_100875240	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	839	Open in IMG/M
3300005093\|Ga0062594_100314479	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1202	Open in IMG/M
3300005176\|Ga0066679_10366842	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	942	Open in IMG/M
3300005176\|Ga0066679_10927273	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	547	Open in IMG/M
3300005179\|Ga0066684_10936772	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	563	Open in IMG/M
3300005187\|Ga0066675_11066086	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	605	Open in IMG/M
3300005293\|Ga0065715_10619292	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	696	Open in IMG/M
3300005327\|Ga0070658_10742412	All Organisms → cellular organisms → Bacteria	852	Open in IMG/M
3300005327\|Ga0070658_10927490	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	757	Open in IMG/M
3300005329\|Ga0070683_100056062	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3659	Open in IMG/M
3300005329\|Ga0070683_102155373	Not Available	535	Open in IMG/M
3300005339\|Ga0070660_101282491	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	621	Open in IMG/M
3300005344\|Ga0070661_100143234	All Organisms → cellular organisms → Bacteria	1802	Open in IMG/M
3300005355\|Ga0070671_101243899	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	656	Open in IMG/M
3300005434\|Ga0070709_11374681	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	571	Open in IMG/M
3300005435\|Ga0070714_100778769	Not Available	926	Open in IMG/M
3300005435\|Ga0070714_101044786	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	795	Open in IMG/M
3300005435\|Ga0070714_101683229	Not Available	620	Open in IMG/M
3300005436\|Ga0070713_100882041	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	860	Open in IMG/M
3300005436\|Ga0070713_101412012	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	675	Open in IMG/M
3300005437\|Ga0070710_11410484	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	521	Open in IMG/M
3300005444\|Ga0070694_100120768	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1880	Open in IMG/M
3300005454\|Ga0066687_10459751	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	747	Open in IMG/M
3300005455\|Ga0070663_100360067	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1180	Open in IMG/M
3300005458\|Ga0070681_10442569	All Organisms → cellular organisms → Bacteria	1211	Open in IMG/M
3300005529\|Ga0070741_10000221	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	216785	Open in IMG/M
3300005529\|Ga0070741_10000639	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	120657	Open in IMG/M
3300005529\|Ga0070741_10007329	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	22896	Open in IMG/M
3300005529\|Ga0070741_10024361	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	9079	Open in IMG/M
3300005529\|Ga0070741_10112728	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2838	Open in IMG/M
3300005529\|Ga0070741_10354106	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1361	Open in IMG/M
3300005529\|Ga0070741_10684068	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	907	Open in IMG/M
3300005529\|Ga0070741_10995313	Not Available	719	Open in IMG/M
3300005532\|Ga0070739_10000776	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	54847	Open in IMG/M
3300005532\|Ga0070739_10008222	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	10773	Open in IMG/M
3300005532\|Ga0070739_10012494	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	7856	Open in IMG/M
3300005532\|Ga0070739_10028492	All Organisms → cellular organisms → Bacteria	4202	Open in IMG/M
3300005532\|Ga0070739_10073768	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2045	Open in IMG/M
3300005533\|Ga0070734_10144265	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1383	Open in IMG/M
3300005533\|Ga0070734_10365245	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	824	Open in IMG/M
3300005534\|Ga0070735_10046860	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2886	Open in IMG/M
3300005535\|Ga0070684_100294867	All Organisms → cellular organisms → Bacteria	1487	Open in IMG/M
3300005538\|Ga0070731_10000777	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	38195	Open in IMG/M
3300005538\|Ga0070731_10002271	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	18519	Open in IMG/M
3300005538\|Ga0070731_10174531	All Organisms → cellular organisms → Bacteria	1427	Open in IMG/M
3300005538\|Ga0070731_10242772	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1196	Open in IMG/M
3300005538\|Ga0070731_11150582	Not Available	512	Open in IMG/M
3300005540\|Ga0066697_10691123	Not Available	559	Open in IMG/M
3300005548\|Ga0070665_100037861	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4848	Open in IMG/M
3300005548\|Ga0070665_100873290	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	912	Open in IMG/M
3300005554\|Ga0066661_10169971	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1341	Open in IMG/M
3300005555\|Ga0066692_10854477	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	558	Open in IMG/M
3300005557\|Ga0066704_10563232	Not Available	740	Open in IMG/M
3300005557\|Ga0066704_10992451	Not Available	518	Open in IMG/M
3300005563\|Ga0068855_100055408	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	4657	Open in IMG/M
3300005563\|Ga0068855_100141791	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2738	Open in IMG/M
3300005563\|Ga0068855_100196193	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2274	Open in IMG/M
3300005563\|Ga0068855_100521928	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1288	Open in IMG/M
3300005563\|Ga0068855_101918389	Not Available	600	Open in IMG/M
3300005563\|Ga0068855_101981008	Not Available	589	Open in IMG/M
3300005566\|Ga0066693_10281114	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	663	Open in IMG/M
3300005575\|Ga0066702_10020514	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3215	Open in IMG/M
3300005578\|Ga0068854_101810878	All Organisms → cellular organisms → Bacteria	560	Open in IMG/M
3300005587\|Ga0066654_10277521	All Organisms → cellular organisms → Bacteria	891	Open in IMG/M
3300005587\|Ga0066654_10350676	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	802	Open in IMG/M
3300005587\|Ga0066654_10386139	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	763	Open in IMG/M
3300005614\|Ga0068856_100415711	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1365	Open in IMG/M
3300005616\|Ga0068852_100866842	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	919	Open in IMG/M
3300005764\|Ga0066903_106977386	Not Available	586	Open in IMG/M
3300005885\|Ga0075284_1062703	Not Available	538	Open in IMG/M
3300005892\|Ga0075275_1089032	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	532	Open in IMG/M
3300006028\|Ga0070717_10293932	All Organisms → cellular organisms → Bacteria	1443	Open in IMG/M
3300006028\|Ga0070717_11463391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	620	Open in IMG/M
3300006034\|Ga0066656_10822047	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	595	Open in IMG/M
3300006049\|Ga0075417_10627651	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	548	Open in IMG/M
3300006175\|Ga0070712_100443045	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	1080	Open in IMG/M
3300006175\|Ga0070712_100749132	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	836	Open in IMG/M
3300006175\|Ga0070712_100904463	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	761	Open in IMG/M
3300006175\|Ga0070712_101146044	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	676	Open in IMG/M
3300006175\|Ga0070712_101419648	Not Available	606	Open in IMG/M
3300006237\|Ga0097621_100993089	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	785	Open in IMG/M
3300006358\|Ga0068871_101077276	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	751	Open in IMG/M
3300006638\|Ga0075522_10223522	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	941	Open in IMG/M
3300006755\|Ga0079222_10593331	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	843	Open in IMG/M
3300006755\|Ga0079222_12098504	Not Available	559	Open in IMG/M
3300006791\|Ga0066653_10551544	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	583	Open in IMG/M
3300006794\|Ga0066658_10457484	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	695	Open in IMG/M
3300006804\|Ga0079221_10635397	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	728	Open in IMG/M
3300006804\|Ga0079221_10901863	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300006806\|Ga0079220_11440564	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	587	Open in IMG/M
3300006852\|Ga0075433_10015712	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	6219	Open in IMG/M
3300006871\|Ga0075434_101193908	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	773	Open in IMG/M
3300006871\|Ga0075434_101287068	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	742	Open in IMG/M
3300006881\|Ga0068865_100798469	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	814	Open in IMG/M
3300006904\|Ga0075424_100758075	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1036	Open in IMG/M
3300006954\|Ga0079219_12472908	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	505	Open in IMG/M
3300007819\|Ga0104322_113265	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1150	Open in IMG/M
3300007821\|Ga0104323_100532	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1007	Open in IMG/M
3300009012\|Ga0066710_100526946	All Organisms → cellular organisms → Bacteria	1785	Open in IMG/M
3300009012\|Ga0066710_102527075	All Organisms → cellular organisms → Bacteria	742	Open in IMG/M
3300009038\|Ga0099829_10533100	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	975	Open in IMG/M
3300009038\|Ga0099829_10913080	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	729	Open in IMG/M
3300009093\|Ga0105240_12185695	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	574	Open in IMG/M
3300009093\|Ga0105240_12371818	Not Available	549	Open in IMG/M
3300009098\|Ga0105245_11143641	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	825	Open in IMG/M
3300009137\|Ga0066709_103168492	Not Available	600	Open in IMG/M
3300009148\|Ga0105243_10864751	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	896	Open in IMG/M
3300009162\|Ga0075423_10539597	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1228	Open in IMG/M
3300009174\|Ga0105241_11729873	Not Available	608	Open in IMG/M
3300009177\|Ga0105248_10901275	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	998	Open in IMG/M
3300009551\|Ga0105238_11495822	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	704	Open in IMG/M
3300009650\|Ga0105857_1181292	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	603	Open in IMG/M
3300009660\|Ga0105854_1000606	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	15783	Open in IMG/M
3300009789\|Ga0126307_10031687	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4069	Open in IMG/M
3300009789\|Ga0126307_10087920	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2455	Open in IMG/M
3300009789\|Ga0126307_10500055	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	981	Open in IMG/M
3300009840\|Ga0126313_11376979	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	584	Open in IMG/M
3300009840\|Ga0126313_11621414	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	539	Open in IMG/M
3300010038\|Ga0126315_10213101	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1168	Open in IMG/M
3300010038\|Ga0126315_11113024	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	534	Open in IMG/M
3300010039\|Ga0126309_10013404	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3437	Open in IMG/M
3300010039\|Ga0126309_11126730	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	535	Open in IMG/M
3300010042\|Ga0126314_10484926	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	896	Open in IMG/M
3300010043\|Ga0126380_10413910	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1006	Open in IMG/M
3300010043\|Ga0126380_10721023	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	804	Open in IMG/M
3300010044\|Ga0126310_10576140	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	835	Open in IMG/M
3300010044\|Ga0126310_11357750	Not Available	577	Open in IMG/M
3300010046\|Ga0126384_11947422	Not Available	561	Open in IMG/M
3300010152\|Ga0126318_10371895	Not Available	502	Open in IMG/M
3300010152\|Ga0126318_10766292	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1177	Open in IMG/M
3300010335\|Ga0134063_10200435	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	939	Open in IMG/M
3300010361\|Ga0126378_12700066	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	567	Open in IMG/M
3300010371\|Ga0134125_10499064	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1348	Open in IMG/M
3300010373\|Ga0134128_12158859	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	613	Open in IMG/M
3300010376\|Ga0126381_100877070	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1291	Open in IMG/M
3300010396\|Ga0134126_10203622	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2366	Open in IMG/M
3300010396\|Ga0134126_11918368	Not Available	648	Open in IMG/M
3300010396\|Ga0134126_12955070	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	514	Open in IMG/M
3300010400\|Ga0134122_12669176	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	551	Open in IMG/M
3300010401\|Ga0134121_10084708	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2640	Open in IMG/M
3300010403\|Ga0134123_10660272	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1015	Open in IMG/M
3300010937\|Ga0137776_1429045	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1227	Open in IMG/M
3300012001\|Ga0120167_1010220	All Organisms → cellular organisms → Bacteria	2686	Open in IMG/M
3300012011\|Ga0120152_1183854	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	532	Open in IMG/M
3300012014\|Ga0120159_1110226	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	781	Open in IMG/M
3300012198\|Ga0137364_10350849	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1101	Open in IMG/M
3300012204\|Ga0137374_10204889	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1695	Open in IMG/M
3300012208\|Ga0137376_10641529	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	918	Open in IMG/M
3300012208\|Ga0137376_11262387	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	628	Open in IMG/M
3300012209\|Ga0137379_10744070	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	886	Open in IMG/M
3300012211\|Ga0137377_10532524	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1112	Open in IMG/M
3300012212\|Ga0150985_105493253	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	521	Open in IMG/M
3300012212\|Ga0150985_107527310	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1326	Open in IMG/M
3300012212\|Ga0150985_112818837	All Organisms → cellular organisms → Bacteria	1249	Open in IMG/M
3300012212\|Ga0150985_116672986	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1209	Open in IMG/M
3300012212\|Ga0150985_117100058	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1459	Open in IMG/M
3300012350\|Ga0137372_10061691	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3263	Open in IMG/M
3300012354\|Ga0137366_10408228	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	988	Open in IMG/M
3300012355\|Ga0137369_10116597	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2167	Open in IMG/M
3300012469\|Ga0150984_110623254	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	684	Open in IMG/M
3300012469\|Ga0150984_119302567	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	712	Open in IMG/M
3300012478\|Ga0157328_1028602	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	515	Open in IMG/M
3300012582\|Ga0137358_10479654	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	839	Open in IMG/M
3300012683\|Ga0137398_10481825	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	851	Open in IMG/M
3300012685\|Ga0137397_10095180	All Organisms → cellular organisms → Bacteria	2178	Open in IMG/M
3300012918\|Ga0137396_10080219	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2296	Open in IMG/M
3300012918\|Ga0137396_11147699	Not Available	552	Open in IMG/M
3300012931\|Ga0153915_10206583	All Organisms → cellular organisms → Bacteria	2157	Open in IMG/M
3300012931\|Ga0153915_11867628	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	703	Open in IMG/M
3300012948\|Ga0126375_11021471	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	675	Open in IMG/M
3300012951\|Ga0164300_10124776	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1169	Open in IMG/M
3300012955\|Ga0164298_10316627	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	973	Open in IMG/M
3300012957\|Ga0164303_10833740	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	638	Open in IMG/M
3300012960\|Ga0164301_10058272	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2030	Open in IMG/M
3300012960\|Ga0164301_10140208	All Organisms → cellular organisms → Bacteria	1462	Open in IMG/M
3300012960\|Ga0164301_10169216	All Organisms → cellular organisms → Bacteria	1359	Open in IMG/M
3300012977\|Ga0134087_10140535	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1043	Open in IMG/M
3300012982\|Ga0168317_1049600	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1055	Open in IMG/M
3300012982\|Ga0168317_1079423	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	751	Open in IMG/M
3300012986\|Ga0164304_10764490	Not Available	741	Open in IMG/M
3300012987\|Ga0164307_10042276	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2560	Open in IMG/M
3300013100\|Ga0157373_11327592	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	545	Open in IMG/M
3300013104\|Ga0157370_11166269	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	695	Open in IMG/M
3300013105\|Ga0157369_10004150	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	17162	Open in IMG/M
3300013105\|Ga0157369_10027845	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	6261	Open in IMG/M
3300013105\|Ga0157369_11382709	Not Available	717	Open in IMG/M
3300013296\|Ga0157374_12779693	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	517	Open in IMG/M
3300013306\|Ga0163162_13001402	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	542	Open in IMG/M
3300013427\|Ga0120106_1056656	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	719	Open in IMG/M
3300013765\|Ga0120172_1118327	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	637	Open in IMG/M
3300013766\|Ga0120181_1128781	Not Available	552	Open in IMG/M
3300013768\|Ga0120155_1097663	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	823	Open in IMG/M
3300013832\|Ga0120132_1111508	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	581	Open in IMG/M
3300014150\|Ga0134081_10381391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	525	Open in IMG/M
3300014157\|Ga0134078_10365359	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	639	Open in IMG/M
3300014157\|Ga0134078_10614450	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	522	Open in IMG/M
3300014166\|Ga0134079_10364641	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	661	Open in IMG/M
3300014311\|Ga0075322_1161968	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	555	Open in IMG/M
3300014488\|Ga0182001_10622669	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	523	Open in IMG/M
3300014498\|Ga0182019_10898931	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	638	Open in IMG/M
3300015158\|Ga0167622_1056101	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	688	Open in IMG/M
3300015161\|Ga0167623_1004390	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	4901	Open in IMG/M
3300015203\|Ga0167650_1004122	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	4328	Open in IMG/M
3300015241\|Ga0137418_10213009	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1662	Open in IMG/M
3300015245\|Ga0137409_11083485	Not Available	640	Open in IMG/M
3300015262\|Ga0182007_10370377	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	542	Open in IMG/M
3300015358\|Ga0134089_10529334	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	520	Open in IMG/M
3300015371\|Ga0132258_10094955	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	7007	Open in IMG/M
3300015371\|Ga0132258_10580478	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2813	Open in IMG/M
3300015371\|Ga0132258_12840783	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1205	Open in IMG/M
3300016341\|Ga0182035_11288514	Not Available	654	Open in IMG/M
3300016445\|Ga0182038_10741260	Not Available	858	Open in IMG/M
3300017656\|Ga0134112_10364804	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	591	Open in IMG/M
3300017792\|Ga0163161_11814123	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	542	Open in IMG/M
3300017937\|Ga0187809_10222966	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	675	Open in IMG/M
3300017947\|Ga0187785_10153284	All Organisms → cellular organisms → Bacteria	970	Open in IMG/M
3300017959\|Ga0187779_10161001	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1389	Open in IMG/M
3300017961\|Ga0187778_10515912	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	794	Open in IMG/M
3300017966\|Ga0187776_10325094	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1007	Open in IMG/M
3300017973\|Ga0187780_10884190	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	648	Open in IMG/M
3300017973\|Ga0187780_11182257	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	560	Open in IMG/M
3300017974\|Ga0187777_10104118	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1867	Open in IMG/M
3300017974\|Ga0187777_10196846	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1357	Open in IMG/M
3300017974\|Ga0187777_10339124	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1032	Open in IMG/M
3300017994\|Ga0187822_10080386	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	966	Open in IMG/M
3300018058\|Ga0187766_10136067	All Organisms → cellular organisms → Bacteria	1516	Open in IMG/M
3300018060\|Ga0187765_10954743	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	584	Open in IMG/M
3300018060\|Ga0187765_11053358	Not Available	561	Open in IMG/M
3300018433\|Ga0066667_11273796	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	642	Open in IMG/M
3300018468\|Ga0066662_10002210	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	9114	Open in IMG/M
3300018482\|Ga0066669_11439778	Not Available	625	Open in IMG/M
3300018482\|Ga0066669_11606838	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	594	Open in IMG/M
3300019767\|Ga0190267_11637048	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	506	Open in IMG/M
3300019888\|Ga0193751_1167538	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	770	Open in IMG/M
3300020069\|Ga0197907_10032768	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	831	Open in IMG/M
3300020069\|Ga0197907_11033160	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	707	Open in IMG/M
3300020070\|Ga0206356_10000915	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	972	Open in IMG/M
3300020070\|Ga0206356_10282509	Not Available	511	Open in IMG/M
3300020070\|Ga0206356_11064516	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	1914	Open in IMG/M
3300020070\|Ga0206356_11822346	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1338	Open in IMG/M
3300020075\|Ga0206349_1681851	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	703	Open in IMG/M
3300020078\|Ga0206352_11110956	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	668	Open in IMG/M
3300020080\|Ga0206350_11044825	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	637	Open in IMG/M
3300020081\|Ga0206354_10305754	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2401	Open in IMG/M
3300020081\|Ga0206354_11607115	All Organisms → cellular organisms → Bacteria	1524	Open in IMG/M
3300020082\|Ga0206353_12041578	All Organisms → cellular organisms → Bacteria	1399	Open in IMG/M
3300021363\|Ga0193699_10020197	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2430	Open in IMG/M
3300021363\|Ga0193699_10246496	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300021374\|Ga0213881_10066021	All Organisms → cellular organisms → Bacteria	1543	Open in IMG/M
3300021384\|Ga0213876_10353252	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	782	Open in IMG/M
3300021478\|Ga0210402_10129597	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2286	Open in IMG/M
3300021560\|Ga0126371_11019195	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M
3300021953\|Ga0213880_10160579	Not Available	617	Open in IMG/M
3300022467\|Ga0224712_10183713	All Organisms → cellular organisms → Bacteria	943	Open in IMG/M
3300022467\|Ga0224712_10296895	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	755	Open in IMG/M
3300022467\|Ga0224712_10387250	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	665	Open in IMG/M
3300022467\|Ga0224712_10409281	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	647	Open in IMG/M
3300022467\|Ga0224712_10630819	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	524	Open in IMG/M
3300024254\|Ga0247661_1112338	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	519	Open in IMG/M
3300025574\|Ga0208717_1052779	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	960	Open in IMG/M
3300025679\|Ga0207933_1008168	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	5284	Open in IMG/M
3300025679\|Ga0207933_1193088	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	569	Open in IMG/M
3300025898\|Ga0207692_10673986	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	669	Open in IMG/M
3300025903\|Ga0207680_11094307	Not Available	570	Open in IMG/M
3300025909\|Ga0207705_10988398	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	650	Open in IMG/M
3300025909\|Ga0207705_11356613	Not Available	542	Open in IMG/M
3300025909\|Ga0207705_11418082	Not Available	528	Open in IMG/M
3300025910\|Ga0207684_10708898	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	855	Open in IMG/M
3300025911\|Ga0207654_10952777	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	623	Open in IMG/M
3300025913\|Ga0207695_10847512	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	794	Open in IMG/M
3300025913\|Ga0207695_11038349	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	699	Open in IMG/M
3300025915\|Ga0207693_10779740	Not Available	737	Open in IMG/M
3300025915\|Ga0207693_10995916	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	640	Open in IMG/M
3300025915\|Ga0207693_11001287	Not Available	638	Open in IMG/M
3300025915\|Ga0207693_11366023	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	527	Open in IMG/M
3300025916\|Ga0207663_10256171	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1290	Open in IMG/M
3300025917\|Ga0207660_10833900	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	752	Open in IMG/M
3300025917\|Ga0207660_11382495	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	571	Open in IMG/M
3300025919\|Ga0207657_11197220	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	577	Open in IMG/M
3300025924\|Ga0207694_11685999	Not Available	533	Open in IMG/M
3300025927\|Ga0207687_11105065	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	681	Open in IMG/M
3300025927\|Ga0207687_11391574	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	603	Open in IMG/M
3300025928\|Ga0207700_10196418	All Organisms → cellular organisms → Bacteria	1698	Open in IMG/M
3300025928\|Ga0207700_11085073	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	716	Open in IMG/M
3300025929\|Ga0207664_10418059	All Organisms → cellular organisms → Bacteria	1194	Open in IMG/M
3300025929\|Ga0207664_10448723	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1151	Open in IMG/M
3300025929\|Ga0207664_10519368	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1067	Open in IMG/M
3300025935\|Ga0207709_11706605	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	523	Open in IMG/M
3300025939\|Ga0207665_11602698	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	516	Open in IMG/M
3300025944\|Ga0207661_10197607	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1767	Open in IMG/M
3300025986\|Ga0207658_10065895	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2722	Open in IMG/M
3300026035\|Ga0207703_10168194	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	1926	Open in IMG/M
3300026041\|Ga0207639_12234425	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	508	Open in IMG/M
3300026078\|Ga0207702_10951173	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	852	Open in IMG/M
3300026089\|Ga0207648_11481046	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	638	Open in IMG/M
3300026275\|Ga0209901_1024270	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1482	Open in IMG/M
3300026527\|Ga0209059_1024303	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2753	Open in IMG/M
3300026552\|Ga0209577_10313361	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1167	Open in IMG/M
3300027706\|Ga0209581_1000002	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1458151	Open in IMG/M
3300027725\|Ga0209178_1253498	Not Available	636	Open in IMG/M
3300027773\|Ga0209810_1000015	All Organisms → cellular organisms → Bacteria	608252	Open in IMG/M
3300027773\|Ga0209810_1000063	All Organisms → cellular organisms → Bacteria	325079	Open in IMG/M
3300027773\|Ga0209810_1015805	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	5249	Open in IMG/M
3300027773\|Ga0209810_1078707	All Organisms → cellular organisms → Bacteria	1563	Open in IMG/M
3300027775\|Ga0209177_10113196	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	877	Open in IMG/M
3300027826\|Ga0209060_10102968	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1335	Open in IMG/M
3300027869\|Ga0209579_10028532	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3062	Open in IMG/M
3300027869\|Ga0209579_10127972	All Organisms → cellular organisms → Bacteria	1350	Open in IMG/M
3300027869\|Ga0209579_10299965	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	866	Open in IMG/M
3300027882\|Ga0209590_10966204	Not Available	533	Open in IMG/M
3300027908\|Ga0209006_11240422	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	580	Open in IMG/M
3300028536\|Ga0137415_10446870	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1098	Open in IMG/M
3300028563\|Ga0265319_1011930	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3533	Open in IMG/M
3300028563\|Ga0265319_1028652	All Organisms → cellular organisms → Bacteria	1962	Open in IMG/M
3300028577\|Ga0265318_10336868	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	550	Open in IMG/M
3300028666\|Ga0265336_10248992	Not Available	528	Open in IMG/M
3300028715\|Ga0307313_10156047	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	705	Open in IMG/M
3300028799\|Ga0307284_10097264	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1097	Open in IMG/M
3300028800\|Ga0265338_10534785	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	822	Open in IMG/M
3300029923\|Ga0311347_10904196	Not Available	536	Open in IMG/M
3300029984\|Ga0311332_11169204	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	620	Open in IMG/M
3300029987\|Ga0311334_10659660	All Organisms → cellular organisms → Bacteria	853	Open in IMG/M
3300030520\|Ga0311372_11382338	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	880	Open in IMG/M
3300031231\|Ga0170824_105896456	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	691	Open in IMG/M
3300031232\|Ga0302323_100758128	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1064	Open in IMG/M
3300031247\|Ga0265340_10069114	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1676	Open in IMG/M
3300031247\|Ga0265340_10442210	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	573	Open in IMG/M
3300031366\|Ga0307506_10043751	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1270	Open in IMG/M
3300031543\|Ga0318516_10037500	All Organisms → cellular organisms → Bacteria	2588	Open in IMG/M
3300031543\|Ga0318516_10395204	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	797	Open in IMG/M
3300031544\|Ga0318534_10134246	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1425	Open in IMG/M
3300031548\|Ga0307408_102289464	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	523	Open in IMG/M
3300031564\|Ga0318573_10048484	All Organisms → cellular organisms → Bacteria	2065	Open in IMG/M
3300031564\|Ga0318573_10179314	All Organisms → cellular organisms → Bacteria	1119	Open in IMG/M
3300031670\|Ga0307374_10004045	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	24639	Open in IMG/M
3300031670\|Ga0307374_10432378	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	741	Open in IMG/M
3300031672\|Ga0307373_10284819	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1068	Open in IMG/M
3300031680\|Ga0318574_10300257	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	933	Open in IMG/M
3300031713\|Ga0318496_10447784	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	714	Open in IMG/M
3300031747\|Ga0318502_10147865	All Organisms → cellular organisms → Bacteria	1338	Open in IMG/M
3300031748\|Ga0318492_10463230	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	670	Open in IMG/M
3300031890\|Ga0306925_10113472	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2894	Open in IMG/M
3300031896\|Ga0318551_10304472	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	897	Open in IMG/M
3300031938\|Ga0308175_100893743	All Organisms → cellular organisms → Bacteria	977	Open in IMG/M
3300031938\|Ga0308175_102327404	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	600	Open in IMG/M
3300031938\|Ga0308175_102808178	Not Available	544	Open in IMG/M
3300031939\|Ga0308174_10153561	All Organisms → cellular organisms → Bacteria	1716	Open in IMG/M
3300031939\|Ga0308174_10170082	All Organisms → cellular organisms → Bacteria	1639	Open in IMG/M
3300031939\|Ga0308174_10426694	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1072	Open in IMG/M
3300031939\|Ga0308174_10609592	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	904	Open in IMG/M
3300031941\|Ga0310912_11354122	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	538	Open in IMG/M
3300031996\|Ga0308176_10187211	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1934	Open in IMG/M
3300031996\|Ga0308176_10365572	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1428	Open in IMG/M
3300031996\|Ga0308176_10603103	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1129	Open in IMG/M
3300031996\|Ga0308176_11370000	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	752	Open in IMG/M
3300031996\|Ga0308176_12279904	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	578	Open in IMG/M
3300032008\|Ga0318562_10754748	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	558	Open in IMG/M
3300032043\|Ga0318556_10226358	All Organisms → cellular organisms → Bacteria	975	Open in IMG/M
3300032074\|Ga0308173_10039536	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3361	Open in IMG/M
3300032180\|Ga0307471_102443140	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	661	Open in IMG/M
3300032205\|Ga0307472_101660738	Not Available	630	Open in IMG/M
3300032261\|Ga0306920_104069737	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	530	Open in IMG/M
3300032770\|Ga0335085_10460607	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1460	Open in IMG/M
3300032770\|Ga0335085_10899061	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	965	Open in IMG/M
3300032770\|Ga0335085_11857716	Not Available	615	Open in IMG/M
3300032782\|Ga0335082_10347287	All Organisms → cellular organisms → Bacteria	1352	Open in IMG/M
3300032782\|Ga0335082_11421070	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	564	Open in IMG/M
3300032828\|Ga0335080_10611271	All Organisms → cellular organisms → Bacteria	1145	Open in IMG/M
3300032892\|Ga0335081_10535416	All Organisms → cellular organisms → Bacteria	1463	Open in IMG/M
3300032893\|Ga0335069_10337787	All Organisms → cellular organisms → Bacteria	1783	Open in IMG/M
3300032893\|Ga0335069_10719702	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1133	Open in IMG/M
3300032893\|Ga0335069_11277755	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	800	Open in IMG/M
3300032893\|Ga0335069_12125801	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	589	Open in IMG/M
3300032896\|Ga0335075_10115921	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3454	Open in IMG/M
3300032896\|Ga0335075_10156509	All Organisms → cellular organisms → Bacteria	2828	Open in IMG/M
3300032897\|Ga0335071_10049767	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	4136	Open in IMG/M
3300032897\|Ga0335071_10173075	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2112	Open in IMG/M
3300033758\|Ga0314868_008042	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1014	Open in IMG/M
3300033803\|Ga0314862_0002005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2883	Open in IMG/M
3300033805\|Ga0314864_0029460	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1186	Open in IMG/M
3300034090\|Ga0326723_0591695	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	513	Open in IMG/M
3300034195\|Ga0370501_0005922	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3186	Open in IMG/M
3300034268\|Ga0372943_0001055	All Organisms → cellular organisms → Bacteria	12908	Open in IMG/M
3300034268\|Ga0372943_0025446	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	3177	Open in IMG/M
3300034384\|Ga0372946_0138936	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1156	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	80.52%
Host-Associated	Host-Associated	19.00%
Engineered	Engineered	0.48%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	78.86%
Plants	Host-Associated → Plants	19.00%
Aquatic	Environmental → Aquatic	1.66%
Solid Waste	Engineered → Solid Waste	0.24%
Modeled	Engineered → Modeled	0.24%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	76.48%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.11%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.18%
Freshwater	Environmental → Aquatic → Freshwater	1.43%
Peat	Environmental → Terrestrial → Peat	1.43%
Roots	Host-Associated → Plants → Roots	0.71%
Rock-Dwelling (Subaerial Biofilms)	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms)	0.48%
Geologic	Environmental → Terrestrial → Geologic	0.48%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.24%
Grass	Engineered → Solid Waste → Grass	0.24%
Simulated Communities (Sequence Read Mixture)	Engineered → Modeled → Simulated Communities (Sequence Read Mixture)	0.24%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	54.87%
Loam	Environmental → Terrestrial → Soil → Loam	11.88%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	9.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.65%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.46%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.14%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.43%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.95%
Clay	Environmental → Terrestrial → Soil → Clay	0.71%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.48%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified	0.48%
Mine	Environmental → Terrestrial → Geologic → Mine	0.48%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.48%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.24%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.24%
Composting	Engineered → Solid Waste → Grass → Composting	0.24%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified	0.24%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.45%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.31%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.08%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.65%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.94%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	5.70%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.04%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.09%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	3.09%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.14%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.43%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.95%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.71%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.48%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.48%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.48%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.48%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified	0.48%
Unclassified	Environmental → Terrestrial → Geologic → Mine → Unclassified	0.48%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.48%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	0.24%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.24%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.24%
Unclassified	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified	0.24%

Habitat	Taxonomy	Distribution
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	7.13%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	5.23%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.23%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.75%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.28%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	4.04%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.80%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.56%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	3.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.09%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	3.09%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.85%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.61%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.14%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.90%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.90%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.90%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.66%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.66%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.66%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	1.66%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	1.43%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.43%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.43%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	1.19%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.19%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.19%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.19%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.95%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.95%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.71%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.71%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.71%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.71%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.71%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.48%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.48%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.48%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.48%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.48%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.48%
Weathered Mine Tailings	Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings	0.48%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.48%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.48%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.48%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment	0.24%
Permafrost Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil	0.24%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.24%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.24%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.24%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.24%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.24%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.24%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.24%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.24%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.24%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.24%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.24%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.24%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.24%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.24%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.24%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.24%
Simulated	Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated	0.24%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908007	Soil microbial communities from sample at FACE Site Metagenome WIR_ElevOz2	Environmental	Open in IMG/M
2124908032	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all	Environmental	Open in IMG/M
2124908039	Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4	Environmental	Open in IMG/M
2124908043	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2	Environmental	Open in IMG/M
2140918006	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1	Environmental	Open in IMG/M
2140918007	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all	Environmental	Open in IMG/M
2140918025	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3	Environmental	Open in IMG/M
2166559005	Simulated microbial communities from Lyon, France	Engineered	Open in IMG/M
2170459003	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm	Environmental	Open in IMG/M
2170459010	Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)	Environmental	Open in IMG/M
2170459016	Litter degradation ZMR2	Engineered	Open in IMG/M
2189573000	Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)	Environmental	Open in IMG/M
2228664022	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000880	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001205	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300001532	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-PF 12A)- 1 week illumina	Environmental	Open in IMG/M
3300001535	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina	Environmental	Open in IMG/M
3300001536	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina	Environmental	Open in IMG/M
3300001538	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina	Environmental	Open in IMG/M
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005532	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005885	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401	Environmental	Open in IMG/M
3300005892	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006638	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007819	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo	Environmental	Open in IMG/M
3300007821	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009650	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061	Environmental	Open in IMG/M
3300009660	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058	Environmental	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010152	Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300010937	Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139	Environmental	Open in IMG/M
3300012001	Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M	Environmental	Open in IMG/M
3300012011	Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M	Environmental	Open in IMG/M
3300012014	Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012478	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610	Host-Associated	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300012982	Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013427	Permafrost microbial communities from Nunavut, Canada - A15_35cm_18M	Environmental	Open in IMG/M
3300013765	Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M	Environmental	Open in IMG/M
3300013766	Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M	Environmental	Open in IMG/M
3300013768	Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M	Environmental	Open in IMG/M
3300013832	Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M	Environmental	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014311	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1	Environmental	Open in IMG/M
3300014488	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG	Environmental	Open in IMG/M
3300014498	Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG	Environmental	Open in IMG/M
3300015158	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1A, Ice margin)	Environmental	Open in IMG/M
3300015161	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)	Environmental	Open in IMG/M
3300015203	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Host-Associated	Open in IMG/M
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017937	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018058	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300021363	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2	Environmental	Open in IMG/M
3300021374	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08	Environmental	Open in IMG/M
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300021953	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07	Environmental	Open in IMG/M
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300024254	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02	Environmental	Open in IMG/M
3300025574	Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes)	Environmental	Open in IMG/M
3300025679	Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026275	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes)	Environmental	Open in IMG/M
3300026527	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027725	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)	Environmental	Open in IMG/M
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Host-Associated	Open in IMG/M
3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Host-Associated	Open in IMG/M
3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Host-Associated	Open in IMG/M
3300028715	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203	Environmental	Open in IMG/M
3300028799	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123	Environmental	Open in IMG/M
3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Host-Associated	Open in IMG/M
3300029923	II_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029984	I_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300030520	III_Palsa_N2 coassembly	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Host-Associated	Open in IMG/M
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031564	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21	Environmental	Open in IMG/M
3300031670	Soil microbial communities from Risofladan, Vaasa, Finland - OX-3	Environmental	Open in IMG/M
3300031672	Soil microbial communities from Risofladan, Vaasa, Finland - OX-2	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031713	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22	Environmental	Open in IMG/M
3300031747	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22	Environmental	Open in IMG/M
3300031748	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031941	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032043	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300032896	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4	Environmental	Open in IMG/M
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental	Open in IMG/M
3300033758	Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_A	Environmental	Open in IMG/M
3300033803	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10	Environmental	Open in IMG/M
3300033805	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034195	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M
3300034384	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FWIRElOz_00696080	2124908007	Soil	RVKGHTMARPGERISVFLFALLILALFVGLAFAAGYGIGRILL
Perma_A_C_00870160	2124908032	Soil	MARPSERISVFLFALVLLVLFVGLAFAAGYGLGRILL
B3_v_01054530	2124908039	Soil	MTRPGERITVLLFALFLLVLFVALAFAAGYGLGRILL
A2_c1_00847280	2124908043	Soil	MHTMSRSGERISVLLFALFILVLFVGLAFAAGYGLGRILL
P1_C_02072550	2140918006	Soil	MARPSERISVFLFALVLLVLFVGLAFATGYGLGRILL
A_all_C_02024240	2140918007	Soil	MSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL
b3_nosca_v_02330060	2140918025	Soil	MHTMTRPGERITVLLFALFLLVLFVALAFAAGYGLGRILL
cont_0967.00000020	2166559005	Simulated	MLTMTRPSERISVFLFAFVLLALFVGLTFAAGYLLGRVLL
E4A_08541070	2170459003	Grass Soil	MTRPGERISVLLFALLLLVLFVGLAFAAGYGLGRILL
E4A_05519210	2170459003	Grass Soil	MTSEMHTMSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL
E4A_03265450	2170459003	Grass Soil	MTRPSERISVFLFAFVLLALFVGLTFAAGYLLGRVLL
F62_07791740	2170459010	Grass Soil	YLPTSPENGEMHTMTRRGERISVFLFALAILAIFVGAAFAAGYALGRMLL
2ZMR_00987920	2170459016	Switchgrass, Maize And Mischanthus Litter	MSRSGGRISVFLFAFVLLALFVGLTFAAGYALGRILL
N55_05408690	2189573000	Grass Soil	MTRARERITVFLFAFLLLALFVGLAFAAGYGVGSILL
INPgaii200_10645542	2228664022	Soil	MLTMARPGERISVFLFALFLLVGFVLLAFAAGYGIGRILL
AL20A1W_10468535	3300000880	Permafrost	LRERLSVLLFAAFLLLAFVGLAFAAGYALGKIIL*
JGI1027J12803_1000720592	3300000955	Soil	MLTMARPGERISVFLFALFLLVGFVLLAFAAGYGIGRILL*
C688J13580_10508672	3300001205	Soil	MSRSGERISVFLFALFLLAAFVVLAFAAGYGLGKILL*
C688J14111_101787112	3300001305	Soil	MLTMSRSGERISVFLFALFLLAAFVVLAFAAGYGLGKILL*
A20PFW1_10617696	3300001532	Permafrost	MHTMARPSERISVFLFALVLLVLFVGLAFAAGYGLGRILL*
A3PFW1_102175892	3300001535	Permafrost	MHTMARPRERISVFLFALVLLVLFVGLAFAAGYGLGRILL*
A1565W1_111822692	3300001536	Permafrost	MRGLRERLSVLLFAAFLLLAFVGLAFAAGYALGKIIL*
A10PFW1_110113812	3300001538	Permafrost	MTRARERITVFLFAFLLLALFVGLAFAAGYGVGSILL*
A10PFW1_111724184	3300001538	Permafrost	MHTMSRPNERISVFLFALALLALFIGITFAAGYAIGRILL*
C688J18823_101503022	3300001686	Soil	MSRSGERISVFLFALFLLAAFVVLAFAAGYGVGKVLL*
C688J18823_104657972	3300001686	Soil	MNTMSRSGGRISVFLFALGLLALFVGLAFAVGYALGRMLL*
C688J18823_105309142	3300001686	Soil	MLTMXRSGERISVFLFALFLLVAFVVIAFAAGYGIGRILL*
C688J35102_1184403012	3300002568	Soil	MLTMSRSGERISVFLFALFLLVAFVVIAFAAGYGIGRILL*
C688J35102_1184900092	3300002568	Soil	MHTMSRSGGRISVFLFAFGLLALFVGLAFAAGYALGRVLL*
C688J35102_1199216872	3300002568	Soil	MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL*
C688J35102_1207866002	3300002568	Soil	MHTMSRSGERISVLLFALFLLVLFVGLAFAAGYGLGRILL*
C688J35102_1208869503	3300002568	Soil	MLTMSRSSDRISVFLFALFLLVAFVAVAFAAGYGLGKILL*
C688J35102_1209620822	3300002568	Soil	MLTMSRSSERISVFLFAVFILVAFVFLAFAAGYGIGRILL*
Ga0063454_1010995872	3300004081	Soil	MLTMSRSSDRISVLLFALFLVVAFVVVAFAAGYGIGKILL*
Ga0063454_1013710972	3300004081	Soil	MLTMARPGERISVFLFALFLLVAFVVIAFAAGYGIGRILL*
Ga0062595_1024553032	3300004479	Soil	MHTMSQPGGRISVFLFALIVLAVFVGVAFAAGYVVGRILL*
Ga0062591_1008752402	3300004643	Soil	MLTMSRSSERISVFLFALFLLAAFVVLAFAAGYGVGKILL*
Ga0062594_1003144792	3300005093	Soil	MLTMSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGRILL*
Ga0066679_103668422	3300005176	Soil	MLTMSRSSDRISVFRCALFLLVAFVVIAFAAGYGVGKILL*
Ga0066679_109272731	3300005176	Soil	EMHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGKILL*
Ga0066684_109367722	3300005179	Soil	MHTMTRPGERIAIFLFALVLLALFVGLAFAVGYAVGRLLL*
Ga0066675_110660862	3300005187	Soil	LHTMSRSGGRISVFLFAFALLALFVGLAFAAGYALGRILL*
Ga0065715_106192922	3300005293	Miscanthus Rhizosphere	MLTMSRSSDRISVFLFALFLLAAFVLIAFAAGYGLGRILL*
Ga0070658_107424123	3300005327	Corn Rhizosphere	LPICPKKNEMHTMTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL*
Ga0070658_109274902	3300005327	Corn Rhizosphere	MHTMSRPGERISVFLFALFLLALFVGLAFAVGYGIGRMLL*
Ga0070683_1000560623	3300005329	Corn Rhizosphere	MHTMTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL*
Ga0070683_1021553732	3300005329	Corn Rhizosphere	MHTMFRPSERISVVFFAVVLLVLFVGLAFAAGYVLGRILL*
Ga0070660_1012824911	3300005339	Corn Rhizosphere	IRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL*
Ga0070661_1001432341	3300005344	Corn Rhizosphere	PRIRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL*
Ga0070671_1012438992	3300005355	Switchgrass Rhizosphere	MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL*
Ga0070709_113746812	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MLTMSRSSDRISVFLFALFLLLAFVVIAFAAGYGLGRIFL*
Ga0070714_1007787692	3300005435	Agricultural Soil	MLTMSRSGERISVFLFALFLLVAFVVIAFAAGYGLGKILL*
Ga0070714_1010447863	3300005435	Agricultural Soil	EMHTMTRPGERISVFLFALFLLALFIGLAFAAGYGVGRILL*
Ga0070714_1016832292	3300005435	Agricultural Soil	MHTMSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL*
Ga0070713_1008820412	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MLTMARPGERISVFLFAVFLLVAFVVIAFAAGYGLGRILL*
Ga0070713_1014120122	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MLTMNRPGERISVFVFAFLLLALFVGLAFAAGYLLGRILL*
Ga0070710_114104841	3300005437	Corn, Switchgrass And Miscanthus Rhizosphere	EMHTMSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL*
Ga0070694_1001207684	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MLTMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL*
Ga0066687_104597512	3300005454	Soil	MLTMSRSSDRISVFLFALFLLVAFVVIAFAAGYGVGKILL*
Ga0070663_1003600672	3300005455	Corn Rhizosphere	MHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL*
Ga0070681_104425691	3300005458	Corn Rhizosphere	KIRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGIGRILL*
Ga0070741_10000221151	3300005529	Surface Soil	MPTMSRPGERISVFLFAVLLLALFVALTFAAGYGLGKILL*
Ga0070741_1000063936	3300005529	Surface Soil	MSRARERITVFLFALFLLALFVALAFAAGYGIGRMLV*
Ga0070741_100073297	3300005529	Surface Soil	MSRSRERISVTLFALALLALFVGLAFAAGYGVGRMLL*
Ga0070741_100243615	3300005529	Surface Soil	MSRARERISVFLFAVLLLLLFVGLAFAAGYGVGRMLL*
Ga0070741_101127283	3300005529	Surface Soil	MSQPGGRISVFLFALVVLAVFVGIAFAAGYAVGRILL*
Ga0070741_103541063	3300005529	Surface Soil	MTRARERISVFLFAVFLLALFVGLAFAAGYGLGRILL*
Ga0070741_106840682	3300005529	Surface Soil	MTRARERITVFLFALFLLALFVGLAFAAGYGLGRILL*
Ga0070741_109953132	3300005529	Surface Soil	MLTMPRPRERISVFLFALTLLGLFVGAAFAVGYLLGRILL*
Ga0070739_1000077610	3300005532	Surface Soil	MTRARERTTVFLFALLLLVLYVGLAFAAGYGLGRILL*
Ga0070739_100082224	3300005532	Surface Soil	MLTMTRPRERVSVFLFALALLALFVALTFAAGYALGRMLL*
Ga0070739_100124947	3300005532	Surface Soil	MHTMSRSGGRLSVFLFALFLLAFFLAVTFAAGYAVGKILL*
Ga0070739_100284924	3300005532	Surface Soil	MHTMTRPGERVSVFLFALALLALFVVLTFAAGYALGRILL*
Ga0070739_100737684	3300005532	Surface Soil	MTRARERSSVFLFAVFLLVLFVGLAFAAGYGLGRILL*
Ga0070734_101442652	3300005533	Surface Soil	MTRSRERISVTLFALFLLALFVVLAFAVGYGVGRMLL*
Ga0070734_103652452	3300005533	Surface Soil	MTPRARERITVFLFALFLLVLFVGLAFAAGYGLGRILL*
Ga0070735_100468603	3300005534	Surface Soil	MPITMTGTRERVSVTLFALFLLALFVGLAFAAGYGVGRMLL*
Ga0070684_1002948671	3300005535	Corn Rhizosphere	RIRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL*
Ga0070731_100007779	3300005538	Surface Soil	MLTMTRPGERISVFLFALALLALFVALTFAAGYAVGRMLL*
Ga0070731_100022714	3300005538	Surface Soil	MTRPGERISVFLFALALLALFVALTFAAGYAVGRMLL*
Ga0070731_101745313	3300005538	Surface Soil	MLTMTRPSERISVFLFAVVLLALFVGLAFAAGYLLGRILL*
Ga0070731_102427722	3300005538	Surface Soil	MMRPRDRVTVFLFAVFLLVLFVGLSFAAGYLLGRMLL*
Ga0070731_111505822	3300005538	Surface Soil	MMRPRDRVSVFLFALFLLVLFVGLSFAAGYLLGRMLL*
Ga0066697_106911232	3300005540	Soil	MSRSGGRISVFLFAFALLALFVGLAFAAGYALGRILL*
Ga0070665_1000378617	3300005548	Switchgrass Rhizosphere	MTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL*
Ga0070665_1008732902	3300005548	Switchgrass Rhizosphere	MSRSGGRISVFLFAFGLLALFVGLAFAAGYAIGRILL*
Ga0066661_101699714	3300005554	Soil	MLTMSRSGERISVFLFALFLLVAFVVLAFAAGYGIGRILL*
Ga0066692_108544772	3300005555	Soil	MSRSSDRISVFLFALFLLVAFVVIAFAAGYGLGKILL*
Ga0066704_105632322	3300005557	Soil	MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL*
Ga0066704_109924512	3300005557	Soil	MSRSGERISVFLFALFLLVAFVVLAFAAGYGIGRILL*
Ga0068855_1000554083	3300005563	Corn Rhizosphere	MTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL*
Ga0068855_1001417912	3300005563	Corn Rhizosphere	MSRPGDRISVFLFALVLLALFVGAAFAVGYLVGRILL*
Ga0068855_1001961933	3300005563	Corn Rhizosphere	MTRARERTTVFLFAVLLLALFVGLAFAAGYGIGRILL*
Ga0068855_1005219284	3300005563	Corn Rhizosphere	SPRTSEMHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL*
Ga0068855_1019183892	3300005563	Corn Rhizosphere	MTRPGERISVFLFALLLLVLFVGLAFAAGYGIGRILL*
Ga0068855_1019810082	3300005563	Corn Rhizosphere	MTRARERTTLFLFALLLLALFVGLAFAAGYGIGRILL*
Ga0066693_102811142	3300005566	Soil	MLTMSRSSDRISVFLFALFLLVAFVVLAFAAGYGVGKILL*
Ga0066702_100205146	3300005575	Soil	SGERISVFLFALFLLVAFVVLAFAAGYGIGRILL*
Ga0068854_1018108782	3300005578	Corn Rhizosphere	MSRSGGRISVFLFAIGLLALFVGLAFAAGYALGRILL*
Ga0066654_102775213	3300005587	Soil	TSEMLTMSRSSERISVFLFALFLLVAFVALAFAAGYGLGRILL*
Ga0066654_103506762	3300005587	Soil	VASEIRTMTRARERITVFLFALLLLVLFVGLAFAAGYGLGKILL*
Ga0066654_103861391	3300005587	Soil	MLTMTRHRERITVFLFALTLLGLFVGAAFAVGYLLGRILL*
Ga0068856_1004157112	3300005614	Corn Rhizosphere	MTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL*
Ga0068852_1008668422	3300005616	Corn Rhizosphere	MTRPGERISVLFFALVLLVLFVGLAFAAGYAVGRLLL*
Ga0066903_1069773862	3300005764	Tropical Forest Soil	MRERLSVFGFALFLLGSFVLLAFAAGYLLGKILL*
Ga0075284_10627032	3300005885	Rice Paddy Soil	MTRARDRLSVFLFALLLLVLFVGLAFAAGYGLGRILL*
Ga0075275_10890321	3300005892	Rice Paddy Soil	MRPGDRISVFLFALVLLVVFVGAAFAVGYIVGRILV*
Ga0070717_102939323	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MSRSSERISVFLFALGLLALFVGLAFAAGYALGRILL*
Ga0070717_114633911	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	LPTSTTSSEMPTMTRSRERISVTLFALFLLALFVVLAFAAGYGVGKMLL*
Ga0066656_108220472	3300006034	Soil	MSRSGGRISVFLFAFALLALFVGLSFAVGYALGRILL*
Ga0075417_106276512	3300006049	Populus Rhizosphere	MLTMSRSSDRISVFLFALFILVAFVALAFAAGYGLGKILL*
Ga0070712_1004430452	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MTRSRERISVTLFALFLLALFVVLAFAAGYGVGKMLL*
Ga0070712_1007491322	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRLLL*
Ga0070712_1009044632	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL*
Ga0070712_1011460442	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MARPGERISVFLFALVILALFVGLAFAAGYGIGRILL*
Ga0070712_1014196482	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL*
Ga0097621_1009930893	3300006237	Miscanthus Rhizosphere	RTMTRARERITVFLFALFLLVLFVGLAFAAGYGLGRILL*
Ga0068871_1010772762	3300006358	Miscanthus Rhizosphere	MHTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL*
Ga0075522_102235223	3300006638	Arctic Peat Soil	MFRVRERLSVFAFAAFLLALFVGLAFAAGWAVGRFLL*
Ga0079222_105933312	3300006755	Agricultural Soil	MTRDRERTTVFLFAVLVLALFVGLAFAAGYGVGRILL*
Ga0079222_120985041	3300006755	Agricultural Soil	MTRARERTTVFLFAVLVLALFVGLAFAAGYGVGRILL*
Ga0066653_105515442	3300006791	Soil	MRERLSVFAFALFLLGSFVLLAFAAGYLLGKILL*
Ga0066658_104574842	3300006794	Soil	MLTMSRSSDRISVFLFALFLLVAFVALAFAAGYGVGKILL*
Ga0079221_106353972	3300006804	Agricultural Soil	MTRARERTSVFLFAVLLLALFVGLAFAAGYGVGRILL*
Ga0079221_109018632	3300006804	Agricultural Soil	LHTMSRSGGRISVFLFALALLALFVGLAFAAGYALGRILL*
Ga0079220_114405641	3300006806	Agricultural Soil	MSQPGGRISVFLFALIVLAVFVGLAFAAGYVVGRILL*
Ga0075433_100157123	3300006852	Populus Rhizosphere	MLTMSRSSDRISVFLFALFLLVAFVALAFAAGYGLGKILL*
Ga0075434_1011939082	3300006871	Populus Rhizosphere	MAGVRDRLSVFAFAAFLLALFVGLAFAAGYVLGKILL*
Ga0075434_1012870682	3300006871	Populus Rhizosphere	MLTMSRSSERISVFLFALFLLAAFVVLAFAAGYGVGKIL
Ga0068865_1007984692	3300006881	Miscanthus Rhizosphere	MSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGRILL*
Ga0075424_1007580752	3300006904	Populus Rhizosphere	MRERLSVFGFALFLLGGFVLLAFAAGYLLGKILL*
Ga0079219_124729082	3300006954	Agricultural Soil	MSRSGGRISVFLFALGLLALFVGLAFAAGYAVGRILL*
Ga0104322_1132654	3300007819	Permafrost Soil	TMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL*
Ga0104323_1005322	3300007821	Soil	MSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL*
Ga0066710_1005269462	3300009012	Grasslands Soil	MSRSGGRISVFLFAFALLALFVGLSFAVGYALGRILL
Ga0066710_1025270752	3300009012	Grasslands Soil	MSRARERLTVFGFALLLLGLFVGLAFAAGWALGKVLL
Ga0099829_105331003	3300009038	Vadose Zone Soil	MSRSGGRISVFLFAFGLLALFVGLAFAAGYALGRILL*
Ga0099829_109130802	3300009038	Vadose Zone Soil	MARRGERISVFLFALLLLVLFIGLTFAAGYGLGRILL*
Ga0105240_121856952	3300009093	Corn Rhizosphere	MSRARERITVFLFALLLLVVFVGLAFAAGYGVGRILL*
Ga0105240_123718182	3300009093	Corn Rhizosphere	MFRPSERISVVFFAVVLLVLFVGLAFAAGYVLGRILL*
Ga0105245_111436411	3300009098	Miscanthus Rhizosphere	MFRTRERIAVVLFALGLLGLFVGGAFAVGYLVGRIVL*
Ga0066709_1031684922	3300009137	Grasslands Soil	MTRARERITVFLFALFLLVLFVGLAFAAGYGLGRILL*
Ga0105243_108647511	3300009148	Miscanthus Rhizosphere	MSRSGGRISVFLFAIGLLALFVGLAFAAGYALGRI
Ga0075423_105395972	3300009162	Populus Rhizosphere	MRDMLTMSRSSDRISVFLFALFLLVAFVALAFAAGYGLGKILL*
Ga0105241_117298731	3300009174	Corn Rhizosphere	MLTMSRSGDRISVFLFAIFLLAAFVVLAFAAGYGVGRILL*
Ga0105248_109012752	3300009177	Switchgrass Rhizosphere	MSRSGGRISVFLFALGLLALFVGLAFAAGYVLGKILL*
Ga0105238_114958222	3300009551	Corn Rhizosphere	MLTMPRPRERVSVFLFALTLLGLFVGIAFAVGYFLGRILL*
Ga0105857_11812922	3300009650	Permafrost Soil	MFLVRERLSVFAFAAFLLALFVGLAFAAGWAVGRFLL*
Ga0105854_10006065	3300009660	Permafrost Soil	MHTMARPGERISVFLFALVLLVLFVGLAFAAGYGLGRILL*
Ga0126307_100316874	3300009789	Serpentine Soil	MTRVRDRLSVFTFAAFLLALFVGLAFAAGYTLGKILL*
Ga0126307_100879204	3300009789	Serpentine Soil	MSRVRDRLSVFTFAAVLLALFVGLAFAAGYALGKVLL*
Ga0126307_105000552	3300009789	Serpentine Soil	MSRVRDRLSVFTFAAVLLVLFVGLAFAAGYALGKILL*
Ga0126313_113769792	3300009840	Serpentine Soil	MSRVRDRLSVFAFAALLLALFVGLAFAAGWALGKILL*
Ga0126313_116214142	3300009840	Serpentine Soil	MFGVRDRLSVFAFAALLLALFVGLAFAAGYALGKILL*
Ga0126315_102131014	3300010038	Serpentine Soil	RVRDRLSVFAFAGLLLALFVGLAFAAGYALGKILL*
Ga0126315_111130242	3300010038	Serpentine Soil	MFGVRDRLSVFAFAALLLALFVGLAFAAGYALGKVLL*
Ga0126309_100134045	3300010039	Serpentine Soil	MSRVRDRLSVFGFAGLLLALFVGLAFAAGYALGKILL*
Ga0126309_111267302	3300010039	Serpentine Soil	MSGVRDRLSVFAFAALLLALFVGLAFAAGYALGRILL*
Ga0126314_104849262	3300010042	Serpentine Soil	MRERLSVFSFALFLLGSFVLLAFAAGYLLGKILL*
Ga0126380_104139102	3300010043	Tropical Forest Soil	MSRRGERISVFLFALAVLAVFVGAAFAVGYALGRILL*
Ga0126380_107210232	3300010043	Tropical Forest Soil	MSRRGERISVFLFALAVLAVFVGAAFAAGYALGRILL*
Ga0126310_105761402	3300010044	Serpentine Soil	MHTMSRSGGRLSVFLFALGLLALFVGLAFAAGYALGRVLL*
Ga0126310_113577502	3300010044	Serpentine Soil	MSRVRDRLSVFTFAAVLLALFVGLAFAAGYVLGKVLL*
Ga0126384_119474222	3300010046	Tropical Forest Soil	MSRSRERISVTLFALFLLALFVVLAFAVGYGVGKMLL*
Ga0126318_103718952	3300010152	Soil	MLTMTRPSERISVFLFALFLLALFVAVTFAAGYALGRILL*
Ga0126318_107662924	3300010152	Soil	SPVTSEIRTMTRARERISVFLFALFLLVLFVGLAFAAGYGLGRILL*
Ga0134063_102004352	3300010335	Grasslands Soil	MLTMSRASDRISVFLFAVFILVAFVVLAFAAGYGLGKILL*
Ga0126378_127000662	3300010361	Tropical Forest Soil	GRKALKLHTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL*
Ga0134125_104990642	3300010371	Terrestrial Soil	MSRPGDRLSVLFFAVVLLVLFVGLAFAAGYALGRVLL*
Ga0134128_121588592	3300010373	Terrestrial Soil	MAGVRDRLSVFAFAAILLALFVGLAFAAGYVLGKILL*
Ga0126381_1008770704	3300010376	Tropical Forest Soil	MTRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL*
Ga0134126_102036224	3300010396	Terrestrial Soil	MTRPGERISVLFFALVVLVLFVGLAFAVGYAVGRLLL*
Ga0134126_119183681	3300010396	Terrestrial Soil	MTRARERITVFLFAFLLLALFVGLAFAAGYGVGRILL*
Ga0134126_129550701	3300010396	Terrestrial Soil	MSRARERISVFLFALFLLVLFVALAFAAGYGLGRMLV*
Ga0134122_126691762	3300010400	Terrestrial Soil	MTRARERTTVFLFAVLLLALFVVLAFAAGYGVGRILL*
Ga0134121_100847083	3300010401	Terrestrial Soil	MTRARERITVFVFALFLLVLFVGLAFAAGYGLGRILL*
Ga0134123_106602722	3300010403	Terrestrial Soil	MSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGKILL*
Ga0137776_14290453	3300010937	Sediment	MATGEMHTMARRGERISVFLFAIAILAIFVGAAFAAGYALGRILL*
Ga0120167_10102203	3300012001	Permafrost	MARPSERISVFLFALVLLVLFVGLAFAAGYGLGRILL*
Ga0120152_11838542	3300012011	Permafrost	MSRPNERISVFLFALALLALFIGITFAAGYAIGRILL
Ga0120159_11102262	3300012014	Permafrost	MSRPNERISVFLFALALLALFIGITFAAGYAIGRIL
Ga0137364_103508492	3300012198	Vadose Zone Soil	MREMLTMSRSSDRISVFLFALFLVVAFVAVAFAAGYGIGKIFL*
Ga0137374_102048892	3300012204	Vadose Zone Soil	MSGVRDRLSVFAFAALLLALFVGLAFAAGYALGKILL*
Ga0137376_106415292	3300012208	Vadose Zone Soil	MTRARERITVFLFALFLLVLFVGLAFAAGYGVGRILL*
Ga0137376_112623872	3300012208	Vadose Zone Soil	MREMLTMSRSSDRISVFLFALFLVVAFVVVAFAAGYGIGKILL*
Ga0137379_107440702	3300012209	Vadose Zone Soil	MSRSGGRISVFLFAFGLLALFVGLAFAAGYAVGRILL*
Ga0137377_105325242	3300012211	Vadose Zone Soil	MSRSGGRISVFLFAFALLALFVGLAFAVGYALGRILL*
Ga0150985_1054932532	3300012212	Avena Fatua Rhizosphere	MLTMSRSGERISVFLFALFLLVAFVALAFAAGYGLGKILL*
Ga0150985_1075273102	3300012212	Avena Fatua Rhizosphere	MTRSGERISVFLFALFLLVAFVVIAFAAGYGIGRILL*
Ga0150985_1128188373	3300012212	Avena Fatua Rhizosphere	RSGGRISVFLFALGLLALFVGLAFAVGYALGRMLL*
Ga0150985_1166729861	3300012212	Avena Fatua Rhizosphere	RVRDRLSVFTFAAFLLVLFVGLAFAAGYALGKILL*
Ga0150985_1171000582	3300012212	Avena Fatua Rhizosphere	MSRSSDRISVFLFALFLLVAFVAVAFAAGYGLGKILL*
Ga0137372_100616912	3300012350	Vadose Zone Soil	MHTMSRPGERISVFLFALVLLALFVGIAFAAGYALGRILL*
Ga0137366_104082282	3300012354	Vadose Zone Soil	MRDRLSVFGFALFLLGAFVLLAFAAGYLLGKILL*
Ga0137369_101165972	3300012355	Vadose Zone Soil	MRERLAVFGFALFLLGAFVLLAFAAGYVLGKILL*
Ga0150984_1106232542	3300012469	Avena Fatua Rhizosphere	MLTMTRSGERISVFLFALFLLVAFVVIAFAAGYGIGRILL*
Ga0150984_1193025672	3300012469	Avena Fatua Rhizosphere	MSRVRDRLSVFTFAAFLLVLFVGLAFAAGYALGKILL*
Ga0157328_10286021	3300012478	Arabidopsis Rhizosphere	TRTEMHTMSRSGGRISVFLFAVGLLALFVGLAFAAGYALGRILL*
Ga0137358_104796542	3300012582	Vadose Zone Soil	MSRSSDRISVFLFALFLLLAFVVIAFAAGYGLGRILL*
Ga0137398_104818252	3300012683	Vadose Zone Soil	MSRSSDRISVFLFALFLLLAFVAIAFAAGYGLGRILL*
Ga0137397_100951804	3300012685	Vadose Zone Soil	MLTMSRSSDRISVFLFALFLLTAFVVLAFAAGYGLGRILL*
Ga0137396_100802193	3300012918	Vadose Zone Soil	MSRSSDRISVFLFALFLLVAFVALAFAAGYGVGKILL*
Ga0137396_111476992	3300012918	Vadose Zone Soil	MLSMSRSSDRISVFLFALFLLTAFVVLAFAAGYGLGRILL*
Ga0153915_102065834	3300012931	Freshwater Wetlands	MHTMTRPGERISVFLFALFLLALFVILAFAAGYGVGRILL*
Ga0153915_118676282	3300012931	Freshwater Wetlands	MHTMTRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL*
Ga0126375_110214712	3300012948	Tropical Forest Soil	MRDMLTMSRSSDRISVFLFALFLLVAFVAVAFAAGYGLGKILL*
Ga0164300_101247762	3300012951	Soil	MSRSSDRISVFLFALFLLVAFVLIAFAAGYGLGRILL*
Ga0164298_103166272	3300012955	Soil	MSRSGGRISVFLFAIVLLGLFVGLAFAAGYALGRILL*
Ga0164303_108337402	3300012957	Soil	MSRSSDRISVFLFALFLLAAFVLIAFAAGYGLGRILL*
Ga0164301_100582722	3300012960	Soil	MLTMSRSSDRISVFLFALFLLVAFVLIAFAAGYGLGRILL*
Ga0164301_101402082	3300012960	Soil	MTRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL*
Ga0164301_101692163	3300012960	Soil	MSRSGGRISVFLFAIVLVGLFVGLAFAEGYALVRILL*
Ga0134087_101405352	3300012977	Grasslands Soil	MREMLTMSRSSDRISVFLFALFLVVAFVVLAFAAGYGLGKILL*
Ga0168317_10496003	3300012982	Weathered Mine Tailings	MHTMWPRGERISVFLFALVLLALFVGLTFAAGYVLGRMLL*
Ga0168317_10794232	3300012982	Weathered Mine Tailings	MSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRMLL*
Ga0164304_107644902	3300012986	Soil	MLTMSRSSDRISVFLFALFLVVAFVVVAFAAGYGVGKILL*
Ga0164307_100422762	3300012987	Soil	MLTMSRSSERITVFLFALFLLAAFVVLAFAAGYGVGRILL*
Ga0157373_113275923	3300013100	Corn Rhizosphere	MLITMPKARERISVFLFALTLLGLFVGAAFAVGYLIGRILL*
Ga0157370_111662692	3300013104	Corn Rhizosphere	MTRPRERLSVFLFAIALLALFVALTFAVGYALGRMLL*
Ga0157369_1000415014	3300013105	Corn Rhizosphere	MTRPRERLSVFLFAIALLALFVAFTFAVGYALGRMLL*
Ga0157369_100278454	3300013105	Corn Rhizosphere	MLTMPRPRERVSVFLFALTLLGLFVGAAFAVGYLIGRILL*
Ga0157369_113827091	3300013105	Corn Rhizosphere	MTRPGERISVLFFAVVLLVVFVGLAFAAGYAVGKLLL*
Ga0157374_127796931	3300013296	Miscanthus Rhizosphere	KPAGTSEMLTMSRSSDRISVFLFALFLLLAFVVIAFAAGYGLGRILL*
Ga0163162_130014022	3300013306	Switchgrass Rhizosphere	MNTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL*
Ga0120106_10566561	3300013427	Permafrost	SEMLTMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL*
Ga0120172_11183272	3300013765	Permafrost	MSRPNERISVFLFALALLALFIGITFAAGYAIGRILL*
Ga0120181_11287812	3300013766	Permafrost	MSRSGERISVLLFALFILALFVGLAFAAGYGLGRILL*
Ga0120155_10976632	3300013768	Permafrost	MARPGERISVFLFALVLLVLFVGLAFAAGYGLGRILL*
Ga0120132_11115082	3300013832	Permafrost	MTRARERTTVFLFALLLLALFVGLAFAAGYGVGRILL*
Ga0134081_103813912	3300014150	Grasslands Soil	SEMLTMSRSSERISVFLFAVFILVAFVALAFAAGYGIGRILL*
Ga0134078_103653592	3300014157	Grasslands Soil	MSRSGGRISVFLFAIALLALFVGLAFAAGYALGRILL*
Ga0134078_106144502	3300014157	Grasslands Soil	MTRARERIAVFLFALALLVLFVGLAFAAGYGIGRIIL*
Ga0134079_103646411	3300014166	Grasslands Soil	NEIRTMTRARERIAVFLFALALLVLFVGLAFAAGYGIGRIIL*
Ga0075322_11619681	3300014311	Natural And Restored Wetlands	MTRARERITVFLFAVLLLALFVGLAFAAGYGVGRILL*
Ga0182001_106226692	3300014488	Soil	MSRVRDRFSVFAFAALLLALFVGLAFAAGYALGKILL*
Ga0182019_108989312	3300014498	Fen	MSRSGERISVLLFALFLVALFVGLAFAAGYGLGRILL*
Ga0167622_10561012	3300015158	Glacier Forefield Soil	MHTMSRPGDRISVFLFALFLLALFVGAAFAAGYALGRVLL*
Ga0167623_10043903	3300015161	Glacier Forefield Soil	MSRARDRISVFAFALFLLVVFVGLAFAAGYALGKVLL*
Ga0167650_10041227	3300015203	Glacier Forefield Soil	MARPSDRISVFLFALFLLVLFVGLAFAAGYGLGRILL*
Ga0137418_102130092	3300015241	Vadose Zone Soil	MSRSSDRISVFLFALFLLTAFVVLAFAAGYGLGRILL*
Ga0137409_110834852	3300015245	Vadose Zone Soil	MSRSGERISLLLFALFLLALFVGLAFAAGYGLGRILL*
Ga0182007_103703772	3300015262	Rhizosphere	MTRARERTTVFLFALLVLALFVGLAFAAGYGVGRILL*
Ga0134089_105293342	3300015358	Grasslands Soil	MREMLTMSRSSDRISVFLFALFLLVAFVAVAFAAGYGLGKILL*
Ga0132258_100949557	3300015371	Arabidopsis Rhizosphere	MSRRGERISVFVFALAVLAVFVGAAFAAGYALGRLLL*
Ga0132258_105804784	3300015371	Arabidopsis Rhizosphere	MHTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL*
Ga0132258_128407834	3300015371	Arabidopsis Rhizosphere	PLPTEMHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL*
Ga0182035_112885142	3300016341	Soil	MHTMTRRGERISVFLFALAMLAISVGAAFAAGYAVGRILL
Ga0182038_107412602	3300016445	Soil	MHTMTRRGERISVFLFALAMLAIFVGVAFAAGYAVGRILL
Ga0134112_103648043	3300017656	Grasslands Soil	EMPTMTRSRERISVTLFALFLLALFVVLAFAAGYGVGKMLL
Ga0163161_118141232	3300017792	Switchgrass Rhizosphere	MSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGRILL
Ga0187809_102229662	3300017937	Freshwater Sediment	LPISHLTTEMLTMTRPGERISVFLFALALLALFVGLTFAAGYLLGKILL
Ga0187785_101532842	3300017947	Tropical Peatland	MTAGMPTMSRSRERIVVTLFAFLLLVLFVGLAFAAGYGLGRILL
Ga0187779_101610012	3300017959	Tropical Peatland	MSRSRERITVTLFALFLLALFVAAAFAIGYGVARMLL
Ga0187778_105159122	3300017961	Tropical Peatland	MSRSRERITVTLFALFLLALFVAAAFAIGYGVGRMLL
Ga0187776_103250942	3300017966	Tropical Peatland	MSRVRERLSVFAFAALLLALFVGLAFAAGWILGRLLL
Ga0187780_108841902	3300017973	Tropical Peatland	VKYLADMPTMSRSRERIVVTLFALCLLILFVGLAFAVGYGVGRMLL
Ga0187780_111822572	3300017973	Tropical Peatland	MTRARERITVFLFALLLLVLFVGLAFAVGYGVGRMLL
Ga0187777_101041183	3300017974	Tropical Peatland	MSRSRERIVVTLFAFLLLVLFVGLAFAAGYGLGRLLL
Ga0187777_101968463	3300017974	Tropical Peatland	MSRPGERISVFLFALFLLVLFVGLAFAAGYGLGRILL
Ga0187777_103391243	3300017974	Tropical Peatland	MLTMSRPGERVSVFLFALFLLALFVGLAFAAGYGLGRLLL
Ga0187822_100803862	3300017994	Freshwater Sediment	MTRPGERISVFLFALALLALFVALTFAAGYAVGRMLL
Ga0187766_101360672	3300018058	Tropical Peatland	MTRRGERISVFLFALAMLAIFVGVAFADGYAVGRILL
Ga0187765_109547432	3300018060	Tropical Peatland	MSRSRERISVTLFALFLLALFIAVAFAVGYGVGRMLL
Ga0187765_110533582	3300018060	Tropical Peatland	MTRSRERITVTLFALFLLALFVVLAFAVGYGVGKMLL
Ga0066667_112737962	3300018433	Grasslands Soil	MLTMSRSSDRISVFLFALFLVVAFVAVAFAAGYGIGKILL
Ga0066662_100022109	3300018468	Grasslands Soil	MLTMSRSGERISVFLFALFLLVAFVVLAFAAGYGIGRILL
Ga0066669_114397781	3300018482	Grasslands Soil	MSRSGGRISVFLFAFALLALFVGLSFAVGYALGRIL
Ga0066669_116068382	3300018482	Grasslands Soil	SRSGGRISVFLFAFALLALFVGLAFAAGYALGRILL
Ga0190267_116370482	3300019767	Soil	MTRARERLSVFAFAAFLLALFVGLAFVAGWLLGRVLL
Ga0193751_11675382	3300019888	Soil	MLTMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRI
Ga0197907_100327682	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	MTRARERTTVFLFAVLLLALFVGLAFAAGYGIGRILL
Ga0197907_110331601	3300020069	Corn, Switchgrass And Miscanthus Rhizosphere	KIRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL
Ga0206356_100009152	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	MTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL
Ga0206356_102825092	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	MSRPGERISVFLFALFLLALFVGLAFAVGYGIGRMLL
Ga0206356_110645163	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	MLTMSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL
Ga0206356_118223462	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	MSRPGDRISVFLFALVLLALFVGAAFAVGYLVGRILL
Ga0206349_16818512	3300020075	Corn, Switchgrass And Miscanthus Rhizosphere	MSRARERITVFLFALLLLVVFVGLAFAAGYGVGRILL
Ga0206352_111109562	3300020078	Corn, Switchgrass And Miscanthus Rhizosphere	MHTMTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL
Ga0206350_110448252	3300020080	Corn, Switchgrass And Miscanthus Rhizosphere	TMTRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL
Ga0206354_103057544	3300020081	Corn, Switchgrass And Miscanthus Rhizosphere	MHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL
Ga0206354_116071151	3300020081	Corn, Switchgrass And Miscanthus Rhizosphere	MHTMSRPGDRISVFLFALVLLALFVGAAFAVGYLVGRILL
Ga0206353_120415783	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	MTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL
Ga0193699_100201973	3300021363	Soil	MLTTPRSSDRISVFLFALFLLAAFVVIAFAAGYGIGRILL
Ga0193699_102464962	3300021363	Soil	MTRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL
Ga0213881_100660212	3300021374	Exposed Rock	MTRARERLSVFLFAVFLLVLFVGLAFAAGYGLGRILL
Ga0213876_103532522	3300021384	Plant Roots	MSRARERISVFLFALFLLVLFVGLAFAAGYGVGRMLL
Ga0210402_101295972	3300021478	Soil	MARRGERISVFLFALAVLAIFVGAAFAAGYALGRILL
Ga0126371_110191952	3300021560	Tropical Forest Soil	MSRRGERISVFLFALAVLAVFVGAAFAVGYALGRILL
Ga0213880_101605792	3300021953	Exposed Rock	MTRARERITVFLFALFILVLFVVLAFAAGYGVGRILL
Ga0224712_101837133	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	RARERITVFLFALLLLVVFVGLAFAAGYGVGRILL
Ga0224712_102968952	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	MTRSGDRISVFLFALVLLALFVGVAFAVGYLVGRILL
Ga0224712_103872502	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	EIHTMPGPRERVSVFLFALTLVGLFVGAAFAVGYLLGRILL
Ga0224712_104092812	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	MTRPRERLSVFLFAIALLALFVALTFAVGYALGRMLL
Ga0224712_106308192	3300022467	Corn, Switchgrass And Miscanthus Rhizosphere	MSRSSDRISVFLFALFLLAAFVVIAFAAGYGLGRILL
Ga0247661_11123382	3300024254	Soil	MSRSSDRISVFLFALFLLLAFVVIAFAAGYGLGRILL
Ga0208717_10527792	3300025574	Arctic Peat Soil	MTRPGDRISVFLFAFVLLALFVGVAFAVGYLVGRILL
Ga0207933_10081683	3300025679	Arctic Peat Soil	MTRPGDRISVFLFALVLLALFVGVAFAVGYLVGRILL
Ga0207933_11930881	3300025679	Arctic Peat Soil	RPGDRLSVFLFALVLLALFVGAAFAVGYLVGRILL
Ga0207692_106739862	3300025898	Corn, Switchgrass And Miscanthus Rhizosphere	EMHTMSRSGERISVLLFALFLLALFVGLAFAAGYGLGRILL
Ga0207680_110943072	3300025903	Switchgrass Rhizosphere	MLTMSRSGDRISVFLFALFLLAAFVVLAFAAGYGVGRILL
Ga0207705_109883982	3300025909	Corn Rhizosphere	TCLPIWPGTSEIRTMTRARERISVFLFAVFLLVLFVGLAFAAGYGLGRILL
Ga0207705_113566132	3300025909	Corn Rhizosphere	MTRPGERISVFLFALLLLVLFVGLAFAAGYGIGRILL
Ga0207705_114180822	3300025909	Corn Rhizosphere	MHTMSRPGERISVFLFALFLLALFVGLAFAVGYGIGRMLL
Ga0207684_107088982	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MLTMSRSSDRISVFLFALFLLVAFVLIAFAAGYGLGRILL
Ga0207654_109527772	3300025911	Corn Rhizosphere	MTRARERTTLFLFALLLLALFVGLAFAAGYGIGRILL
Ga0207695_108475122	3300025913	Corn Rhizosphere	MHTMFRPSERISVVFFAVVLLVLFVGLAFAAGYVLGRILL
Ga0207695_110383491	3300025913	Corn Rhizosphere	TRARERTTVFLFAVLLLALFVGLAFAAGYGVGRILL
Ga0207693_107797402	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MSRSSERISVFLFALGLLALFVGLAFAAGYALGRILL
Ga0207693_109959162	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRLLL
Ga0207693_110012872	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL
Ga0207693_113660232	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MARPGERISVFLFALVILALFVGLAFAAGYGIGRILL
Ga0207663_102561713	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MLTMTRPGERISVLLFALFLLVLFVGLAFAAGYGLGRILL
Ga0207660_108339002	3300025917	Corn Rhizosphere	MSRSSDRISVFLFALFLLAAFVLIAFAAGYGLGRILL
Ga0207660_113824952	3300025917	Corn Rhizosphere	MTRPGERISVLFFAFVLLVCFVGLAFAAGYVLGRLLL
Ga0207657_111972202	3300025919	Corn Rhizosphere	MARPSDRISVFLFALFLLVLFVGLAFATGYGLGRILL
Ga0207694_116859992	3300025924	Corn Rhizosphere	MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALG
Ga0207687_111050652	3300025927	Miscanthus Rhizosphere	MSRSGGRISVFLFAFGLLALFVGLAFAAGYAIGRILL
Ga0207687_113915742	3300025927	Miscanthus Rhizosphere	MHTMSRSGGRISVFLFAFGLLALFVGLAFAAGYALGRVLL
Ga0207700_101964184	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	EIRTMTRARERISVFLFALFLLVLFVGLAFAAGYGLGRILL
Ga0207700_110850732	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MLTMNRPGERISVFVFAFLLLALFVGLAFAAGYLLGRILL
Ga0207664_104180593	3300025929	Agricultural Soil	MLTMSRSGERISVFLFALFLLVAFVVIAFAAGYGLGKILL
Ga0207664_104487234	3300025929	Agricultural Soil	TMSRPGDRLSVLFFAFVLLVLFVGLLFAAGYALGRVLL
Ga0207664_105193682	3300025929	Agricultural Soil	MLTMSRPGERISVFLFALFLLVAFVVLAFAAGYGLGRILL
Ga0207709_117066052	3300025935	Miscanthus Rhizosphere	MAGVRDRLSVFAFAAFLLALFVGLAFAAGYVLGKILL
Ga0207665_116026982	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MTSEMHTMTRPGERISVFLFALFLLAAFVVIAFAAGYGLGRILL
Ga0207661_101976072	3300025944	Corn Rhizosphere	MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRILL
Ga0207658_100658953	3300025986	Switchgrass Rhizosphere	MPTPGERTSVVLFALVLLALFVGLAFAVGYFLGKMLL
Ga0207703_101681943	3300026035	Switchgrass Rhizosphere	MSEMRTMPTPGERTSVVLFALVLLALFVGLAFAVGYFLG
Ga0207639_122344252	3300026041	Corn Rhizosphere	IRTMTRARERTTVFLFAVLLLALFVGLAFAAGYGIGRILL
Ga0207702_109511731	3300026078	Corn Rhizosphere	ISPRTSEMHTMTRPGERISVFLFALFLLALFVGLAFAAGYGLGRILL
Ga0207648_114810462	3300026089	Miscanthus Rhizosphere	MHTMSRSGGRISVFLFAIGLLGLFVGLAFAAGYALGRILL
Ga0209901_10242702	3300026275	Permafrost Soil	MARPGERISVFLFALVLLVLFVGLAFAAGYGLGRILL
Ga0209059_10243031	3300026527	Soil	RMSEMLTMSRSGERISVFLFALFLLVAFVVLAFAAGYGIGRILL
Ga0209577_103133611	3300026552	Soil	MLTMSRSSDRISVFLFALFLLVAFVVIAFAAGYGVGKILL
Ga0209581_10000021075	3300027706	Surface Soil	MHTMTRPGERVSVFLFALALLALFVVLTFAAGYALGRILL
Ga0209178_12534982	3300027725	Agricultural Soil	MTRARERTSVFLFAVLLLALFVGLAFAAGYGVGRILL
Ga0209810_1000015546	3300027773	Surface Soil	MHTMSRSGGRLSVFLFALFLLAFFLAVTFAAGYAVGKILL
Ga0209810_100006315	3300027773	Surface Soil	MTRARERTTVFLFALLLLVLYVGLAFAAGYGLGRILL
Ga0209810_10158054	3300027773	Surface Soil	MLTMTRPRERVSVFLFALALLALFVALTFAAGYALGRMLL
Ga0209810_10787072	3300027773	Surface Soil	MTRARERSSVFLFAVFLLVLFVGLAFAAGYGLGRILL
Ga0209177_101131962	3300027775	Agricultural Soil	MSRSGGRISVFLFAIGLLALFVGLAFAAGYALGRILL
Ga0209060_101029683	3300027826	Surface Soil	RSRERISVTLFALFLLALFVVLAFAVGYGVGRMLL
Ga0209579_100285325	3300027869	Surface Soil	MLTMTRPGERISVFLFALALLALFVALTFAAGYAVGRMLL
Ga0209579_101279722	3300027869	Surface Soil	MLTMTRPSERISVFLFAVVLLALFVGLAFAAGYLLGRILL
Ga0209579_102999652	3300027869	Surface Soil	MMRPRDRVTVFLFAVFLLVLFVGLSFAAGYLLGRMLL
Ga0209590_109662042	3300027882	Vadose Zone Soil	MARRGERISVFLFALLLLVLFIGLTFAAGYGLGRILL
Ga0209006_112404222	3300027908	Forest Soil	MMRPRDRVTVFLFAVFLLVLFVGLSFAAGYLLGRVLL
Ga0137415_104468702	3300028536	Vadose Zone Soil	MSRSSDRISVFLFALFLLVAFVALAFAAGYGVGKILL
Ga0265319_10119303	3300028563	Rhizosphere	MMGPGDRISVFLFALFLLALFVGLSFAAGYLVGRMLL
Ga0265319_10286522	3300028563	Rhizosphere	MMRPGDRVSVFLFALFLLVLFVGLSFAAGYLLGRMLL
Ga0265318_103368681	3300028577	Rhizosphere	SRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL
Ga0265336_102489922	3300028666	Rhizosphere	MSRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL
Ga0307313_101560472	3300028715	Soil	MGRVRERVAVFAFAIFLLGSFVLLAFAAGYLLGKILL
Ga0307284_100972642	3300028799	Soil	MSRSSDRISVFLFALFLLVAFVLIAFAAGYGLGRILL
Ga0265338_105347852	3300028800	Rhizosphere	MTSEMHTMSRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL
Ga0311347_109041961	3300029923	Fen	MSRSSERISVLLFALFIVLLFVGLAFAAGYGLGRILL
Ga0311332_111692042	3300029984	Fen	MSRSGERISVLLFALFLVALFVGLAFAAGYGLGRILL
Ga0311334_106596601	3300029987	Fen	HTMSRSGERISVLLFALFLVALFVGLAFAAGYGLGRILL
Ga0311372_113823381	3300030520	Palsa	MFRVRERLSVFVFAAFLLAAFVGLAFAAGWAVGRFLL
Ga0170824_1058964562	3300031231	Forest Soil	KIRTMTRARERTTLFLFAVLVLALFVGLAFAAGYGVGRILL
Ga0302323_1007581283	3300031232	Fen	MHTMSRSGERISVLLFALFLVALFVGLAFAAGYGLGRILL
Ga0265340_100691142	3300031247	Rhizosphere	MHTMSRSGERISVFLFALFLLALFVGLAFAAGYGLGRILL
Ga0265340_104422102	3300031247	Rhizosphere	VRAMMRPRDRVSVFLFALFLLVLFVGLSFAAGYLLGRMLL
Ga0307506_100437513	3300031366	Soil	MHTMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL
Ga0318516_100375002	3300031543	Soil	MTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRILL
Ga0318516_103952042	3300031543	Soil	MTRSGGRISVFLFALGLLALFVGLAFAAGYALGKILL
Ga0318534_101342462	3300031544	Soil	MSRRGERISVFLFALAVLAVFVGVAFAAGYALGRILL
Ga0307408_1022894642	3300031548	Rhizosphere	MSRVRDRLSVFAFAGLLLALFVGLAFAAGYALGKILL
Ga0318573_100484842	3300031564	Soil	MTRPGERISVFVFAFFLLALFVGLAFAAGYLLGRILL
Ga0318573_101793143	3300031564	Soil	SLPTCLTTGEMHTMTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRILL
Ga0307374_1000404525	3300031670	Soil	MTRPGERISVFLFALFLLALFVALAFAAGYGLGRILL
Ga0307374_104323781	3300031670	Soil	MHTMSRSGERISVLLFALFILALFVGLAFAAGYGLGRILL
Ga0307373_102848192	3300031672	Soil	MSRSGERISVLLFALFILALFVGLAFAAGYGLGRILL
Ga0318574_103002571	3300031680	Soil	MHTMTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRILL
Ga0318496_104477841	3300031713	Soil	AVSPCRPRREGLKLHTMTRSGGRISVFLFALGLLALFVGLAFAAGYALGKVLL
Ga0318502_101478654	3300031747	Soil	LTMTRPGERISVFVFAFFLLALFVGLAFAAGYLLGRILL
Ga0318492_104632301	3300031748	Soil	LPISHPTTEMLTMTRPGERISVFVFAFFLLALFVGLAFAAGYLLGRILL
Ga0306925_101134724	3300031890	Soil	MLTMTRPGERISVFVFAFFLLALFVGLAFAAGYLLGRILL
Ga0318551_103044721	3300031896	Soil	MLTMTRPRERISVFLFALFLLGLFIALTFAAGYVLGRILL
Ga0308175_1008937432	3300031938	Soil	MTRPGERISVLFFALVVLVLFVGLAFAVGYAVGRLLL
Ga0308175_1023274042	3300031938	Soil	MTRSRERIVVFSFALFLLVLFVVLAFAAGYGVGRILL
Ga0308175_1028081781	3300031938	Soil	MSRPGDRLSVLFFAIVLLVLFVGLAFAAGYALGRVLL
Ga0308174_101535613	3300031939	Soil	MTRARERITVFCFALFLLVLFVALAFAAGYGVGRILL
Ga0308174_101700823	3300031939	Soil	MRTMTRPGERISVFLFALLLLVLFVGLAFAAGYGIG
Ga0308174_104266942	3300031939	Soil	MSRPGERISVFLFALFLLALFVGLAFAVGYVIGRMLL
Ga0308174_106095922	3300031939	Soil	MTRARERITVFLFALLLLVVFVGLAFAAGYGIGRILL
Ga0310912_113541222	3300031941	Soil	RPRERISVFVFAFFLLALFVGLAFAAGYLLGRILL
Ga0308176_101872114	3300031996	Soil	TMSRSGGRISVFLFALGLLALFVGLAFAAGYALGRVLL
Ga0308176_103655721	3300031996	Soil	ISRPTSEMHTMNRPGERISVFLFALFLLVLFVGLAFAAGYGIGRILL
Ga0308176_106031032	3300031996	Soil	MTRARERITVFLFAVLLLVAFIVLAFAAGYGIGRILL
Ga0308176_113700002	3300031996	Soil	MSRPGDRISVFLFALFLLVLFVGLAFAAGYGIGRILL
Ga0308176_122799041	3300031996	Soil	MTRARERITVFCFALFLLALFVGLAFAAGYGVGKILL
Ga0318562_107547482	3300032008	Soil	MTRPRERISVFLFALFLLGLFIALTFAAGYVLGRILL
Ga0318556_102263583	3300032043	Soil	TYRRTSEMLTMTRPRERISVFLFALFLLGLFIALTFAAGYVLGRILL
Ga0308173_100395365	3300032074	Soil	MHTMSRPGERISVFLFALFLLALFVGLAFAVGYVIGRMLL
Ga0307471_1024431402	3300032180	Hardwood Forest Soil	MLTMSRSSDRISVFLFALFLVVAFVVVAFAAGYGVGKILL
Ga0307472_1016607382	3300032205	Hardwood Forest Soil	MSRSSERITVFLFALFLLAAFVALAFAAGYGLGKILL
Ga0306920_1040697371	3300032261	Soil	GEMHTMSRRGERISVFLFALAVLAVFVGVAFAAGYALGRILL
Ga0335085_104606072	3300032770	Soil	MTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRMLL
Ga0335085_108990612	3300032770	Soil	MSRSRERISVTLFALFLLALFIAVAFAVGYGVGRM
Ga0335085_118577162	3300032770	Soil	LSRARERITVFLFALFLLVLFVVLAFAAGYGIGRMLL
Ga0335082_103472871	3300032782	Soil	LPISPRTSEMTAGMPTMSRSRERIVVTLFAFLLLVLFVGLAFAAGYGLGRILL
Ga0335082_114210702	3300032782	Soil	MSRSGERISVLLFALFLLVLFVGLAFAAGYGLGRILL
Ga0335080_106112712	3300032828	Soil	MTRSRERITVTLFALLLLALFVVLAFAAGYGVGRMLL
Ga0335081_105354161	3300032892	Soil	RATGEMPITMTGTRERISVTLFALFLLALFVGLAFAAGYGVGRMLL
Ga0335069_103377872	3300032893	Soil	MSRSGDRISVLLFALFLLVLFVGLAFAAGYGLGRILL
Ga0335069_107197023	3300032893	Soil	MHTMTRRGERISVFLFALAMLAIFVGAAFAAGYAVGRMLL
Ga0335069_112777551	3300032893	Soil	LPISHLPTEMLTMTRPSERISVFLFAIALLALFVGLTFAAGYLLGKILL
Ga0335069_121258012	3300032893	Soil	LSRARERITVFVFALFLLLLFVTLAFAAGYGIGRMLL
Ga0335075_101159216	3300032896	Soil	MSRARERITVFLFALFLLVLFVALAFAAGYGIGRMLV
Ga0335075_101565093	3300032896	Soil	MTRPGDRISVFVFAFVLLALFVAFTFAAGYVVGRMLL
Ga0335071_100497675	3300032897	Soil	MHTMSRSGDRISVLLFALFLLVLFVGLAFAAGYGLGRILL
Ga0335071_101730753	3300032897	Soil	MTRSRERISVTLFALFLLALFVVLAFAVGYGVGTILL
Ga0314868_008042_310_432	3300033758	Peatland	MHTMTRRGERIGVFLFALAMLAIFVGAAFAVGYAVGRILL
Ga0314862_0002005_1166_1288	3300033803	Peatland	MHTMTRRGERIGVFLFALAMLAIFVGAAFAAGYAVGRILL
Ga0314864_0029460_343_477	3300033805	Peatland	MTGEMHTMTRRGERIGVFLFALAMLAIFVGAAFAAGYAVGRILL
Ga0326723_0591695_27_149	3300034090	Peat Soil	MHTMTRRGERISVFLFALAVLAVFVGAAFAAGYALGRILL
Ga0370501_0005922_2998_3111	3300034195	Untreated Peat Soil	MSRSSERISVLLFALFILVLFVGLAFAAGYGLGRILL
Ga0372943_0001055_4147_4260	3300034268	Soil	MTRARERISVFLFAFALLALFVGLAFAAGYGLGRILL
Ga0372943_0025446_2212_2325	3300034268	Soil	MSRSGDRLSVLLFALFLLALFVGLAFAAGYGLGRILL
Ga0372946_0138936_21_161	3300034384	Soil	MTGTTEMLTMSRSSDRISVFLFALFLLVAFVVIAFAAGYGLGRILL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F004844

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences