Basic Information | |
---|---|
Family ID | F004744 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 425 |
Average Sequence Length | 41 residues |
Representative Sequence | MKKLSMLGIIVGAALLSAAPFSLQWSQKNVALSLDSADA |
Number of Associated Samples | 238 |
Number of Associated Scaffolds | 425 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 97.59 % |
% of genes near scaffold ends (potentially truncated) | 93.88 % |
% of genes from short scaffolds (< 2000 bps) | 89.88 % |
Associated GOLD sequencing projects | 225 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.118 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.471 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.588 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.471 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.73% β-sheet: 0.00% Coil/Unstructured: 46.27% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 425 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 1.88 |
PF13560 | HTH_31 | 1.18 |
PF00072 | Response_reg | 0.94 |
PF00589 | Phage_integrase | 0.94 |
PF04909 | Amidohydro_2 | 0.94 |
PF03734 | YkuD | 0.94 |
PF00872 | Transposase_mut | 0.71 |
PF00916 | Sulfate_transp | 0.71 |
PF13533 | Biotin_lipoyl_2 | 0.71 |
PF07690 | MFS_1 | 0.71 |
PF06863 | DUF1254 | 0.71 |
PF01068 | DNA_ligase_A_M | 0.71 |
PF06240 | COXG | 0.71 |
PF01979 | Amidohydro_1 | 0.47 |
PF16576 | HlyD_D23 | 0.47 |
PF00118 | Cpn60_TCP1 | 0.47 |
PF04226 | Transgly_assoc | 0.47 |
PF00565 | SNase | 0.47 |
PF13467 | RHH_4 | 0.47 |
PF08241 | Methyltransf_11 | 0.47 |
PF07883 | Cupin_2 | 0.47 |
PF13557 | Phenol_MetA_deg | 0.47 |
PF04545 | Sigma70_r4 | 0.47 |
PF09948 | DUF2182 | 0.47 |
PF03401 | TctC | 0.24 |
PF08238 | Sel1 | 0.24 |
PF00891 | Methyltransf_2 | 0.24 |
PF02627 | CMD | 0.24 |
PF01557 | FAA_hydrolase | 0.24 |
PF13458 | Peripla_BP_6 | 0.24 |
PF14833 | NAD_binding_11 | 0.24 |
PF05239 | PRC | 0.24 |
PF03797 | Autotransporter | 0.24 |
PF00856 | SET | 0.24 |
PF01739 | CheR | 0.24 |
PF01226 | Form_Nir_trans | 0.24 |
PF02397 | Bac_transf | 0.24 |
PF05050 | Methyltransf_21 | 0.24 |
PF06078 | DUF937 | 0.24 |
PF00656 | Peptidase_C14 | 0.24 |
PF07536 | HWE_HK | 0.24 |
PF00485 | PRK | 0.24 |
PF09361 | Phasin_2 | 0.24 |
PF13551 | HTH_29 | 0.24 |
PF13414 | TPR_11 | 0.24 |
PF00580 | UvrD-helicase | 0.24 |
PF01066 | CDP-OH_P_transf | 0.24 |
PF13751 | DDE_Tnp_1_6 | 0.24 |
PF13358 | DDE_3 | 0.24 |
PF13424 | TPR_12 | 0.24 |
PF00529 | CusB_dom_1 | 0.24 |
PF08240 | ADH_N | 0.24 |
PF07813 | LTXXQ | 0.24 |
PF13924 | Lipocalin_5 | 0.24 |
COG ID | Name | Functional Category | % Frequency in 425 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.88 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.94 |
COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 0.71 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.71 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.71 |
COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 0.71 |
COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 0.71 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.71 |
COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.71 |
COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.71 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.47 |
COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 0.47 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.47 |
COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.24 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.24 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.24 |
COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.24 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.24 |
COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 0.24 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.24 |
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.24 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.24 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.24 |
COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.24 |
COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.24 |
COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.24 |
COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.24 |
COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.24 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.24 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.12 % |
Unclassified | root | N/A | 25.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2067725001|GPWNP_F5MPXY301C0M4Y | Not Available | 502 | Open in IMG/M |
2170459002|FZY7DQ102HDBNQ | Not Available | 502 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10075718 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300000650|AP72_2010_repI_A1DRAFT_1019559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 580 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1005254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2465 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1048103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1049375 | Not Available | 754 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10006480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2745 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10008682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2424 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10024579 | Not Available | 1433 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10040104 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1072 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10051764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10078800 | Not Available | 706 | Open in IMG/M |
3300000816|AF_2010_repII_A10DRAFT_1016750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1003763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2135 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1024801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 841 | Open in IMG/M |
3300000955|JGI1027J12803_104544409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
3300002914|JGI25617J43924_10006232 | All Organisms → cellular organisms → Bacteria | 3682 | Open in IMG/M |
3300002914|JGI25617J43924_10030665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1911 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10163686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
3300005175|Ga0066673_10587222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
3300005332|Ga0066388_100533638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1805 | Open in IMG/M |
3300005332|Ga0066388_102037024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1030 | Open in IMG/M |
3300005332|Ga0066388_102284510 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
3300005332|Ga0066388_103852648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
3300005332|Ga0066388_107041034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
3300005363|Ga0008090_10114335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1026 | Open in IMG/M |
3300005364|Ga0070673_100347606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1315 | Open in IMG/M |
3300005367|Ga0070667_101989836 | Not Available | 547 | Open in IMG/M |
3300005438|Ga0070701_10326191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 951 | Open in IMG/M |
3300005467|Ga0070706_101125633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 722 | Open in IMG/M |
3300005554|Ga0066661_10711514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 589 | Open in IMG/M |
3300005555|Ga0066692_10962049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300005559|Ga0066700_10870706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
3300005713|Ga0066905_100325103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1218 | Open in IMG/M |
3300005713|Ga0066905_100645958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
3300005713|Ga0066905_100798410 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300005713|Ga0066905_100806708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 814 | Open in IMG/M |
3300005713|Ga0066905_101727641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ec3.3 | 575 | Open in IMG/M |
3300005713|Ga0066905_102160961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 518 | Open in IMG/M |
3300005764|Ga0066903_100767371 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
3300005764|Ga0066903_100900042 | Not Available | 1601 | Open in IMG/M |
3300005764|Ga0066903_101532122 | Not Available | 1260 | Open in IMG/M |
3300005764|Ga0066903_102822660 | Not Available | 942 | Open in IMG/M |
3300005764|Ga0066903_104560116 | Not Available | 738 | Open in IMG/M |
3300005764|Ga0066903_104817806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 717 | Open in IMG/M |
3300005764|Ga0066903_104854928 | Not Available | 714 | Open in IMG/M |
3300005764|Ga0066903_105552874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 664 | Open in IMG/M |
3300005764|Ga0066903_107772081 | Not Available | 551 | Open in IMG/M |
3300006028|Ga0070717_11551962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
3300006038|Ga0075365_10337843 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300006047|Ga0075024_100701539 | Not Available | 556 | Open in IMG/M |
3300006052|Ga0075029_100432874 | Not Available | 860 | Open in IMG/M |
3300006052|Ga0075029_100544085 | Not Available | 771 | Open in IMG/M |
3300006172|Ga0075018_10366161 | Not Available | 726 | Open in IMG/M |
3300006172|Ga0075018_10773037 | Not Available | 525 | Open in IMG/M |
3300006174|Ga0075014_100309109 | Not Available | 835 | Open in IMG/M |
3300006175|Ga0070712_100011215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5674 | Open in IMG/M |
3300006178|Ga0075367_11004331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
3300006186|Ga0075369_10241827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Breoghaniaceae → Breoghania → Breoghania corrubedonensis | 837 | Open in IMG/M |
3300006354|Ga0075021_10245549 | Not Available | 1101 | Open in IMG/M |
3300006794|Ga0066658_10492898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
3300006796|Ga0066665_11492694 | Not Available | 527 | Open in IMG/M |
3300006797|Ga0066659_11127176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
3300006806|Ga0079220_11669783 | Not Available | 555 | Open in IMG/M |
3300006854|Ga0075425_100183318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2405 | Open in IMG/M |
3300007788|Ga0099795_10608470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
3300009100|Ga0075418_11676622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
3300009147|Ga0114129_11794857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
3300009162|Ga0075423_12773648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300009551|Ga0105238_12206093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
3300009553|Ga0105249_12644159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
3300009792|Ga0126374_10163993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1364 | Open in IMG/M |
3300010043|Ga0126380_10657047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 836 | Open in IMG/M |
3300010043|Ga0126380_10715538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
3300010046|Ga0126384_10537319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1014 | Open in IMG/M |
3300010046|Ga0126384_10806398 | Not Available | 841 | Open in IMG/M |
3300010046|Ga0126384_11464167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 639 | Open in IMG/M |
3300010046|Ga0126384_11712856 | Not Available | 595 | Open in IMG/M |
3300010047|Ga0126382_10150259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1593 | Open in IMG/M |
3300010047|Ga0126382_12217940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
3300010048|Ga0126373_12264390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
3300010048|Ga0126373_12522998 | Not Available | 573 | Open in IMG/M |
3300010301|Ga0134070_10279284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
3300010358|Ga0126370_10902528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 798 | Open in IMG/M |
3300010358|Ga0126370_11217724 | Not Available | 701 | Open in IMG/M |
3300010358|Ga0126370_11371792 | Not Available | 666 | Open in IMG/M |
3300010358|Ga0126370_12242011 | Not Available | 539 | Open in IMG/M |
3300010358|Ga0126370_12620884 | Not Available | 504 | Open in IMG/M |
3300010359|Ga0126376_10276271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1446 | Open in IMG/M |
3300010360|Ga0126372_10148826 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
3300010361|Ga0126378_10494030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1339 | Open in IMG/M |
3300010361|Ga0126378_12919749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
3300010366|Ga0126379_10887805 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300010366|Ga0126379_12078268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
3300010366|Ga0126379_12245382 | Not Available | 646 | Open in IMG/M |
3300010366|Ga0126379_13422028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300010373|Ga0134128_11398006 | Not Available | 771 | Open in IMG/M |
3300010373|Ga0134128_12396635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 581 | Open in IMG/M |
3300010375|Ga0105239_12492552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
3300010376|Ga0126381_100907057 | Not Available | 1269 | Open in IMG/M |
3300010376|Ga0126381_102905441 | Not Available | 682 | Open in IMG/M |
3300010376|Ga0126381_103739348 | Not Available | 595 | Open in IMG/M |
3300010396|Ga0134126_10472003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1449 | Open in IMG/M |
3300010398|Ga0126383_10555104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii | 1214 | Open in IMG/M |
3300010398|Ga0126383_11391477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
3300010398|Ga0126383_11844366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
3300010398|Ga0126383_11917246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300010398|Ga0126383_12555994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
3300010398|Ga0126383_12773300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 572 | Open in IMG/M |
3300010398|Ga0126383_12779235 | Not Available | 571 | Open in IMG/M |
3300010398|Ga0126383_13216627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
3300010400|Ga0134122_10994071 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300010400|Ga0134122_12911470 | Not Available | 532 | Open in IMG/M |
3300010868|Ga0124844_1311858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
3300011119|Ga0105246_10758940 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300011120|Ga0150983_15315579 | Not Available | 601 | Open in IMG/M |
3300012189|Ga0137388_11495532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
3300012200|Ga0137382_10573576 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300012205|Ga0137362_11092546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 678 | Open in IMG/M |
3300012209|Ga0137379_10899382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
3300012212|Ga0150985_121116409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1165 | Open in IMG/M |
3300012285|Ga0137370_10420655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
3300012353|Ga0137367_10860645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 626 | Open in IMG/M |
3300012354|Ga0137366_10479322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 900 | Open in IMG/M |
3300012357|Ga0137384_11579107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300012582|Ga0137358_10848203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 603 | Open in IMG/M |
3300012948|Ga0126375_10109128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1659 | Open in IMG/M |
3300012948|Ga0126375_10959361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
3300012948|Ga0126375_11670391 | Not Available | 551 | Open in IMG/M |
3300012951|Ga0164300_10628015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 639 | Open in IMG/M |
3300012955|Ga0164298_11134498 | Not Available | 588 | Open in IMG/M |
3300012957|Ga0164303_11046669 | Not Available | 585 | Open in IMG/M |
3300012960|Ga0164301_11928882 | Not Available | 500 | Open in IMG/M |
3300012971|Ga0126369_10125471 | All Organisms → cellular organisms → Bacteria | 2372 | Open in IMG/M |
3300012971|Ga0126369_10783209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1035 | Open in IMG/M |
3300012971|Ga0126369_11395751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
3300012985|Ga0164308_10016375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4204 | Open in IMG/M |
3300012986|Ga0164304_11697073 | Not Available | 528 | Open in IMG/M |
3300013297|Ga0157378_10294694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1568 | Open in IMG/M |
3300013297|Ga0157378_12135922 | Not Available | 611 | Open in IMG/M |
3300013306|Ga0163162_10811703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1052 | Open in IMG/M |
3300013307|Ga0157372_12899537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
3300014325|Ga0163163_11350367 | Not Available | 775 | Open in IMG/M |
3300014325|Ga0163163_11903177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Citromicrobium → unclassified Citromicrobium → Citromicrobium sp. | 655 | Open in IMG/M |
3300014325|Ga0163163_12201399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
3300014326|Ga0157380_13223783 | Not Available | 521 | Open in IMG/M |
3300014968|Ga0157379_11153585 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300015077|Ga0173483_10958367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
3300015356|Ga0134073_10153776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
3300015357|Ga0134072_10278929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
3300015372|Ga0132256_100156285 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
3300015372|Ga0132256_100767283 | Not Available | 1080 | Open in IMG/M |
3300015372|Ga0132256_101001479 | Not Available | 951 | Open in IMG/M |
3300015373|Ga0132257_102614681 | Not Available | 657 | Open in IMG/M |
3300016270|Ga0182036_10646536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 852 | Open in IMG/M |
3300016270|Ga0182036_11264762 | Not Available | 615 | Open in IMG/M |
3300016294|Ga0182041_10472375 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300016294|Ga0182041_10756608 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300016294|Ga0182041_11145460 | Not Available | 708 | Open in IMG/M |
3300016294|Ga0182041_11189382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 695 | Open in IMG/M |
3300016294|Ga0182041_11871915 | Not Available | 557 | Open in IMG/M |
3300016319|Ga0182033_11427063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
3300016319|Ga0182033_11446371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
3300016341|Ga0182035_10909360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 777 | Open in IMG/M |
3300016341|Ga0182035_11789292 | Not Available | 556 | Open in IMG/M |
3300016357|Ga0182032_10322065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1228 | Open in IMG/M |
3300016357|Ga0182032_11142519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
3300016357|Ga0182032_11899783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
3300016371|Ga0182034_10023495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3733 | Open in IMG/M |
3300016371|Ga0182034_11348008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
3300016371|Ga0182034_11478030 | Not Available | 595 | Open in IMG/M |
3300016387|Ga0182040_10498842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
3300016387|Ga0182040_11494617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
3300016422|Ga0182039_10059750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → unclassified Thiotrichales → Thiotrichales bacterium HS_08 | 2641 | Open in IMG/M |
3300016422|Ga0182039_10817168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 828 | Open in IMG/M |
3300016422|Ga0182039_11579850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 598 | Open in IMG/M |
3300016422|Ga0182039_12046616 | Not Available | 527 | Open in IMG/M |
3300016445|Ga0182038_10061728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2559 | Open in IMG/M |
3300017792|Ga0163161_11356306 | Not Available | 620 | Open in IMG/M |
3300017822|Ga0187802_10438070 | Not Available | 519 | Open in IMG/M |
3300017937|Ga0187809_10378077 | Not Available | 536 | Open in IMG/M |
3300017994|Ga0187822_10034365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1366 | Open in IMG/M |
3300018006|Ga0187804_10217749 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300018007|Ga0187805_10314456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 721 | Open in IMG/M |
3300018007|Ga0187805_10320272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
3300018027|Ga0184605_10532408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 508 | Open in IMG/M |
3300018028|Ga0184608_10471992 | Not Available | 538 | Open in IMG/M |
3300018468|Ga0066662_10487939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1117 | Open in IMG/M |
3300020579|Ga0210407_11118963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
3300020583|Ga0210401_11503067 | Not Available | 531 | Open in IMG/M |
3300021082|Ga0210380_10404231 | Not Available | 625 | Open in IMG/M |
3300021403|Ga0210397_11264218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
3300021475|Ga0210392_11059054 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300021560|Ga0126371_10232410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1952 | Open in IMG/M |
3300021560|Ga0126371_10572895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1278 | Open in IMG/M |
3300021560|Ga0126371_12076099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
3300021560|Ga0126371_12111019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
3300021560|Ga0126371_12343547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 645 | Open in IMG/M |
3300021560|Ga0126371_13592840 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300021560|Ga0126371_13785899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 510 | Open in IMG/M |
3300022501|Ga0242645_1026385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
3300022512|Ga0242676_1042014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
3300022533|Ga0242662_10266362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
3300022712|Ga0242653_1116824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
3300022722|Ga0242657_1216305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 536 | Open in IMG/M |
3300025916|Ga0207663_10096326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1976 | Open in IMG/M |
3300025922|Ga0207646_10417812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1211 | Open in IMG/M |
3300025933|Ga0207706_10486919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1065 | Open in IMG/M |
3300025961|Ga0207712_10718622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 873 | Open in IMG/M |
3300026116|Ga0207674_11274237 | Not Available | 705 | Open in IMG/M |
3300026118|Ga0207675_101209472 | Not Available | 776 | Open in IMG/M |
3300026304|Ga0209240_1010805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3458 | Open in IMG/M |
3300026354|Ga0257180_1054262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
3300026371|Ga0257179_1010608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 959 | Open in IMG/M |
3300026494|Ga0257159_1049870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
3300026540|Ga0209376_1111285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1380 | Open in IMG/M |
3300026551|Ga0209648_10329460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
3300026557|Ga0179587_10425072 | Not Available | 868 | Open in IMG/M |
3300027181|Ga0208997_1059431 | Not Available | 571 | Open in IMG/M |
3300027527|Ga0209684_1005012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2209 | Open in IMG/M |
3300027824|Ga0209040_10266949 | Not Available | 850 | Open in IMG/M |
3300027874|Ga0209465_10575763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
3300027898|Ga0209067_10905186 | Not Available | 518 | Open in IMG/M |
3300027909|Ga0209382_11909124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 573 | Open in IMG/M |
3300028673|Ga0257175_1104273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 557 | Open in IMG/M |
3300028712|Ga0307285_10220280 | Not Available | 535 | Open in IMG/M |
3300028719|Ga0307301_10226783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 608 | Open in IMG/M |
3300028782|Ga0307306_10206174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 564 | Open in IMG/M |
3300028793|Ga0307299_10073362 | Not Available | 1270 | Open in IMG/M |
3300028796|Ga0307287_10226852 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300028814|Ga0307302_10281530 | Not Available | 816 | Open in IMG/M |
3300028819|Ga0307296_10081456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. dw_78 | 1725 | Open in IMG/M |
3300028828|Ga0307312_10394653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 908 | Open in IMG/M |
3300028872|Ga0307314_10293538 | Not Available | 516 | Open in IMG/M |
3300028875|Ga0307289_10216729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
3300028878|Ga0307278_10137269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1097 | Open in IMG/M |
3300028884|Ga0307308_10576552 | Not Available | 539 | Open in IMG/M |
3300030843|Ga0075392_10921915 | Not Available | 553 | Open in IMG/M |
3300031231|Ga0170824_103602677 | Not Available | 710 | Open in IMG/M |
3300031231|Ga0170824_109910541 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300031446|Ga0170820_13046057 | Not Available | 665 | Open in IMG/M |
3300031446|Ga0170820_16280325 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031543|Ga0318516_10097403 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
3300031543|Ga0318516_10400812 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300031543|Ga0318516_10695002 | Not Available | 578 | Open in IMG/M |
3300031544|Ga0318534_10173032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1248 | Open in IMG/M |
3300031544|Ga0318534_10312707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 905 | Open in IMG/M |
3300031545|Ga0318541_10490055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
3300031546|Ga0318538_10285166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
3300031546|Ga0318538_10335854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 815 | Open in IMG/M |
3300031546|Ga0318538_10630640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
3300031549|Ga0318571_10292856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
3300031549|Ga0318571_10329850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
3300031561|Ga0318528_10538334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 627 | Open in IMG/M |
3300031561|Ga0318528_10735857 | Not Available | 527 | Open in IMG/M |
3300031564|Ga0318573_10367866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 772 | Open in IMG/M |
3300031572|Ga0318515_10046070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2179 | Open in IMG/M |
3300031573|Ga0310915_10084742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2114 | Open in IMG/M |
3300031573|Ga0310915_10409183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 963 | Open in IMG/M |
3300031573|Ga0310915_11203240 | Not Available | 524 | Open in IMG/M |
3300031640|Ga0318555_10151013 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300031640|Ga0318555_10176500 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300031679|Ga0318561_10240311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 986 | Open in IMG/M |
3300031679|Ga0318561_10269539 | Not Available | 929 | Open in IMG/M |
3300031679|Ga0318561_10616273 | Not Available | 597 | Open in IMG/M |
3300031679|Ga0318561_10850678 | Not Available | 501 | Open in IMG/M |
3300031680|Ga0318574_10055226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2101 | Open in IMG/M |
3300031680|Ga0318574_10068212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1914 | Open in IMG/M |
3300031680|Ga0318574_10377990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 827 | Open in IMG/M |
3300031680|Ga0318574_10652966 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300031681|Ga0318572_10545636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
3300031681|Ga0318572_10823847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300031681|Ga0318572_10847024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
3300031713|Ga0318496_10659434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 577 | Open in IMG/M |
3300031713|Ga0318496_10695189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
3300031719|Ga0306917_10427941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1035 | Open in IMG/M |
3300031719|Ga0306917_11132259 | Not Available | 609 | Open in IMG/M |
3300031720|Ga0307469_10218517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1505 | Open in IMG/M |
3300031720|Ga0307469_11311596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 688 | Open in IMG/M |
3300031723|Ga0318493_10126170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1307 | Open in IMG/M |
3300031724|Ga0318500_10514403 | Not Available | 602 | Open in IMG/M |
3300031736|Ga0318501_10038580 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
3300031740|Ga0307468_101017463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 731 | Open in IMG/M |
3300031740|Ga0307468_101264505 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300031744|Ga0306918_10117431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1922 | Open in IMG/M |
3300031744|Ga0306918_10440496 | Not Available | 1017 | Open in IMG/M |
3300031744|Ga0306918_10956404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
3300031744|Ga0306918_11139084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
3300031744|Ga0306918_11362381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300031748|Ga0318492_10130027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1258 | Open in IMG/M |
3300031748|Ga0318492_10254101 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
3300031748|Ga0318492_10423340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
3300031751|Ga0318494_10161512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1265 | Open in IMG/M |
3300031751|Ga0318494_10848038 | Not Available | 535 | Open in IMG/M |
3300031763|Ga0318537_10239852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
3300031763|Ga0318537_10388763 | Not Available | 514 | Open in IMG/M |
3300031764|Ga0318535_10295747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
3300031764|Ga0318535_10316107 | Not Available | 698 | Open in IMG/M |
3300031764|Ga0318535_10420355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
3300031768|Ga0318509_10030529 | All Organisms → cellular organisms → Bacteria | 2622 | Open in IMG/M |
3300031769|Ga0318526_10232947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
3300031770|Ga0318521_10047049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2209 | Open in IMG/M |
3300031779|Ga0318566_10223063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
3300031779|Ga0318566_10663285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300031779|Ga0318566_10669477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
3300031780|Ga0318508_1113529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
3300031780|Ga0318508_1223624 | Not Available | 540 | Open in IMG/M |
3300031780|Ga0318508_1234786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
3300031782|Ga0318552_10708390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 513 | Open in IMG/M |
3300031792|Ga0318529_10048618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1820 | Open in IMG/M |
3300031792|Ga0318529_10051307 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
3300031792|Ga0318529_10511925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
3300031793|Ga0318548_10038232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2143 | Open in IMG/M |
3300031793|Ga0318548_10047295 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
3300031793|Ga0318548_10631130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
3300031795|Ga0318557_10061025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1609 | Open in IMG/M |
3300031796|Ga0318576_10265296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
3300031796|Ga0318576_10307125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
3300031797|Ga0318550_10371759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
3300031799|Ga0318565_10227714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 906 | Open in IMG/M |
3300031799|Ga0318565_10437248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
3300031799|Ga0318565_10513641 | Not Available | 578 | Open in IMG/M |
3300031805|Ga0318497_10093876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1603 | Open in IMG/M |
3300031819|Ga0318568_10933720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
3300031832|Ga0318499_10071798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1316 | Open in IMG/M |
3300031832|Ga0318499_10289716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
3300031833|Ga0310917_10082000 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
3300031833|Ga0310917_10359419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 988 | Open in IMG/M |
3300031833|Ga0310917_10483075 | Not Available | 843 | Open in IMG/M |
3300031833|Ga0310917_10579109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
3300031833|Ga0310917_10704710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
3300031833|Ga0310917_11051478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 544 | Open in IMG/M |
3300031835|Ga0318517_10309346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 714 | Open in IMG/M |
3300031845|Ga0318511_10331317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
3300031846|Ga0318512_10143507 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300031846|Ga0318512_10395929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
3300031879|Ga0306919_10511655 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300031879|Ga0306919_10690593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
3300031879|Ga0306919_11153745 | Not Available | 589 | Open in IMG/M |
3300031879|Ga0306919_11174849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
3300031880|Ga0318544_10108783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1048 | Open in IMG/M |
3300031880|Ga0318544_10239440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 702 | Open in IMG/M |
3300031880|Ga0318544_10448845 | Not Available | 502 | Open in IMG/M |
3300031890|Ga0306925_10095265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3163 | Open in IMG/M |
3300031890|Ga0306925_10480379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1325 | Open in IMG/M |
3300031897|Ga0318520_10159711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1312 | Open in IMG/M |
3300031897|Ga0318520_11017604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
3300031910|Ga0306923_11503158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
3300031910|Ga0306923_12561744 | Not Available | 501 | Open in IMG/M |
3300031912|Ga0306921_10260990 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
3300031912|Ga0306921_10515449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1389 | Open in IMG/M |
3300031941|Ga0310912_11302003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 551 | Open in IMG/M |
3300031942|Ga0310916_10289376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1386 | Open in IMG/M |
3300031942|Ga0310916_11384828 | Not Available | 576 | Open in IMG/M |
3300031945|Ga0310913_10122824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1774 | Open in IMG/M |
3300031945|Ga0310913_10287884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1157 | Open in IMG/M |
3300031945|Ga0310913_10297896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1137 | Open in IMG/M |
3300031945|Ga0310913_10432308 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 934 | Open in IMG/M |
3300031947|Ga0310909_10149165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1921 | Open in IMG/M |
3300031947|Ga0310909_11509040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
3300031954|Ga0306926_10310206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1952 | Open in IMG/M |
3300031954|Ga0306926_10376422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1754 | Open in IMG/M |
3300031954|Ga0306926_11354648 | Not Available | 828 | Open in IMG/M |
3300031954|Ga0306926_11417179 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300031954|Ga0306926_11886673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
3300031954|Ga0306926_12667051 | Not Available | 543 | Open in IMG/M |
3300031959|Ga0318530_10025593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2069 | Open in IMG/M |
3300031959|Ga0318530_10422473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 553 | Open in IMG/M |
3300031981|Ga0318531_10056470 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
3300031981|Ga0318531_10269437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
3300031981|Ga0318531_10385086 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300032001|Ga0306922_11505988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
3300032010|Ga0318569_10483419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 577 | Open in IMG/M |
3300032035|Ga0310911_10065617 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
3300032035|Ga0310911_10070337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1867 | Open in IMG/M |
3300032041|Ga0318549_10264440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
3300032042|Ga0318545_10043591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1503 | Open in IMG/M |
3300032044|Ga0318558_10151426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1117 | Open in IMG/M |
3300032044|Ga0318558_10426727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
3300032044|Ga0318558_10695298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 508 | Open in IMG/M |
3300032051|Ga0318532_10006311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3480 | Open in IMG/M |
3300032051|Ga0318532_10090654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1074 | Open in IMG/M |
3300032052|Ga0318506_10044976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1760 | Open in IMG/M |
3300032052|Ga0318506_10160933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 985 | Open in IMG/M |
3300032052|Ga0318506_10275290 | Not Available | 746 | Open in IMG/M |
3300032054|Ga0318570_10024898 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
3300032054|Ga0318570_10130736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1114 | Open in IMG/M |
3300032054|Ga0318570_10186271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 935 | Open in IMG/M |
3300032059|Ga0318533_10076270 | All Organisms → cellular organisms → Bacteria | 2279 | Open in IMG/M |
3300032059|Ga0318533_10081694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2206 | Open in IMG/M |
3300032059|Ga0318533_10190523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Dichotomicrobium → Dichotomicrobium thermohalophilum | 1465 | Open in IMG/M |
3300032059|Ga0318533_11039837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
3300032060|Ga0318505_10037769 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
3300032060|Ga0318505_10203766 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300032063|Ga0318504_10006925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3703 | Open in IMG/M |
3300032063|Ga0318504_10394718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
3300032065|Ga0318513_10157533 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300032065|Ga0318513_10383557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 685 | Open in IMG/M |
3300032065|Ga0318513_10627129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 526 | Open in IMG/M |
3300032076|Ga0306924_10296697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1855 | Open in IMG/M |
3300032089|Ga0318525_10214998 | Not Available | 988 | Open in IMG/M |
3300032090|Ga0318518_10090035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1521 | Open in IMG/M |
3300032091|Ga0318577_10334729 | Not Available | 723 | Open in IMG/M |
3300032180|Ga0307471_103135360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
3300032261|Ga0306920_100103347 | All Organisms → cellular organisms → Bacteria | 4219 | Open in IMG/M |
3300032261|Ga0306920_100579999 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1660 | Open in IMG/M |
3300032261|Ga0306920_100999478 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300032261|Ga0306920_102448619 | Not Available | 719 | Open in IMG/M |
3300032261|Ga0306920_103288856 | Not Available | 603 | Open in IMG/M |
3300032261|Ga0306920_103358222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
3300033289|Ga0310914_10266738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1540 | Open in IMG/M |
3300033289|Ga0310914_10670350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 932 | Open in IMG/M |
3300033289|Ga0310914_11096390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 697 | Open in IMG/M |
3300033290|Ga0318519_10530507 | Not Available | 711 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.41% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.47% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.24% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.12% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.41% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.41% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.41% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.18% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.18% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.18% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.71% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.71% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.47% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.24% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.24% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.24% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.24% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.24% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.24% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.24% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.24% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.24% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.24% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.24% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.24% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2067725001 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
3300006186 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022501 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300030843 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPWNP_04163560 | 2067725001 | Soil | MKQLRTLGIIGGTALLIAAPASLQWSHNNVLLALDSAEARTGRPHTARMA |
E1_06867990 | 2170459002 | Grass Soil | MKQLGTLGIIAGAALLLAAPFSLQWSHNNVSLSLASAEA |
AF_2010_repII_A1DRAFT_100757182 | 3300000597 | Forest Soil | MKKLSMLGIIGGAILLTATPLSLQWSQKKVALSVDSADAQVYGYGLYS |
AP72_2010_repI_A1DRAFT_10195592 | 3300000650 | Forest Soil | MKKLAMLGIIGGAAILTAAPVSLQWSQKNVALSLD |
AF_2010_repII_A100DRAFT_10052541 | 3300000655 | Forest Soil | MKKLGMLGIVGGAALLTVAPFSLQWPQDEVSLSLNSANARPL |
AF_2010_repII_A100DRAFT_10481033 | 3300000655 | Forest Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLASAEAQE |
AF_2010_repII_A100DRAFT_10493751 | 3300000655 | Forest Soil | MKKGSIIGVIVGAAVLTAAPLSLQLSHGKNVALSVDRA |
AF_2010_repII_A001DRAFT_100064804 | 3300000793 | Forest Soil | MKKLSIVGILVGAAFLTAAPFSLQWSQNHVTLALA* |
AF_2010_repII_A001DRAFT_100086825 | 3300000793 | Forest Soil | MKKLGMLGIVGGAALLTVAPFSLQWPQDEVSLSLNSANARPLT |
AF_2010_repII_A001DRAFT_100245792 | 3300000793 | Forest Soil | MLAIIVGAALLTATPLSLPWSQKNVALSLDSADA* |
AF_2010_repII_A001DRAFT_100401043 | 3300000793 | Forest Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSLNSANAR |
AF_2010_repII_A001DRAFT_100517641 | 3300000793 | Forest Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVALSLASAEARERPLT |
AF_2010_repII_A001DRAFT_100788002 | 3300000793 | Forest Soil | MKKSSMLGIAVGAALLAAVPFSLQWSHEKSVALSLDSAD |
AF_2010_repII_A10DRAFT_10167501 | 3300000816 | Forest Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLASAEA |
AP72_2010_repI_A100DRAFT_10037635 | 3300000837 | Forest Soil | MKKLSMLGMIVGAALLSAAPFSLQWSQKNVALSLDSADARVGRP |
AP72_2010_repI_A100DRAFT_10248011 | 3300000837 | Forest Soil | MKKLSMLAIIVGAGLLTATPFSLQWSQKNVALSLDSAD |
JGI1027J12803_1045444091 | 3300000955 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQVALSINSAEAQIGGAPTATS |
JGI25617J43924_100062321 | 3300002914 | Grasslands Soil | MKKLTMLGIISGAALMTVAPFSLQWSQEVSLSLRYADRLRRPR* |
JGI25617J43924_100306651 | 3300002914 | Grasslands Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKSVMLSLDGAEARAERPP |
JGIcombinedJ51221_101636861 | 3300003505 | Forest Soil | MKKLAMLGIIGGAAILTAAPLSLQWSQKNVVLSLDSAKAGTA |
Ga0066673_105872221 | 3300005175 | Soil | MKKLTMLGIISGAALLTVAPFSLQWSQDKVFLSLNSANAIV |
Ga0066388_1005336382 | 3300005332 | Tropical Forest Soil | MKKLSMLGIIAGAMLLTAAPFSLQWSQGNVALSLDSADARVDDR* |
Ga0066388_1020370241 | 3300005332 | Tropical Forest Soil | MKKLSMLGIIGGAALLTAVPFSIQWSQKNVALSLDSAEAR |
Ga0066388_1022845101 | 3300005332 | Tropical Forest Soil | MKKLSIVGILVGAAFLASAPFSLQWSQSNVVLSLDTADARVG |
Ga0066388_1038526482 | 3300005332 | Tropical Forest Soil | MESIMKKLSMLGIIVGAALLTATPFSLQWSQKNVALSLDSADARVGRPLTA |
Ga0066388_1070410341 | 3300005332 | Tropical Forest Soil | MKRLAMLGIIGGAAILTAAPISLQWSQKNVALSLDSAKAGTATSAAG |
Ga0008090_101143351 | 3300005363 | Tropical Rainforest Soil | MKKLAILGIIGGAAILTAAPVSLQWSQKNVALSLDSAKAGTATS |
Ga0070673_1003476062 | 3300005364 | Switchgrass Rhizosphere | MKKLSVLGIIGGAALLTATPISLQWSQKNVALSLDSAEARIGRPGTALSV |
Ga0070667_1019898362 | 3300005367 | Switchgrass Rhizosphere | MRSNALRSIIKKGAILGTIVAAALLTAAPFSLQWTEKTVALTLDSADARVGRP |
Ga0070714_1015859181 | 3300005435 | Agricultural Soil | MKKLGMLGIIGGAALLTVAPFSLQWSQDEVFLSLNSVNAQTEEQEPITATRT |
Ga0070701_103261912 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQLRPLGIIGGAALLIAAPFSLQWSHKNVALSLDSAEARTGRPHTAR |
Ga0070706_1011256331 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSINSAEARIA |
Ga0066661_107115141 | 3300005554 | Soil | RSIMKKGIILSTIVGAALLTAAPLSLQWSQKTVTLSLDSADA* |
Ga0066692_109620492 | 3300005555 | Soil | MKKLGMLGIIGGAALLTAVPFSLQWSQENVALSINGAEARIAGGVHR |
Ga0066700_108707061 | 3300005559 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSINSAEAR |
Ga0066905_1003251031 | 3300005713 | Tropical Forest Soil | MKKLGMLGIIGGAALLTAAPLSLQWSQKNVTLSLASAEA |
Ga0066905_1006459582 | 3300005713 | Tropical Forest Soil | MKKLSMLGIIGGAALLTAAPFSLQWSQKNVALSLD |
Ga0066905_1007984101 | 3300005713 | Tropical Forest Soil | MKKLGMLGIIGGAALLTVAPFSLQWSQDEVSLSLNSVHAR |
Ga0066905_1008067081 | 3300005713 | Tropical Forest Soil | MKKLGMLGIIGGAALLTVGPFSLQWSQDEVSLSLNSANARIGRSYYGPVSSYA |
Ga0066905_1010703482 | 3300005713 | Tropical Forest Soil | MQKLGMLGVIGGAVILTAAPLSLQWSQKDVALSLASAEAQERP |
Ga0066905_1017276411 | 3300005713 | Tropical Forest Soil | MKKFGMLGIIGGAALLTVAPFSLQWSQDEVSLSLNSANARIGRSYYGPVSSYA |
Ga0066905_1021609612 | 3300005713 | Tropical Forest Soil | MTKLGMLGTIAGAAILTAAPLSLQWSHTNVGLSLDSAEAQ |
Ga0066903_1007673715 | 3300005764 | Tropical Forest Soil | MKKVSMLGILAGAALLTATPLSLQWSQTKVALSVDSADARIGRPL |
Ga0066903_1009000421 | 3300005764 | Tropical Forest Soil | KYSLGIVVAAALLAAMPFSLQWSHENTVALSLEVLMRE* |
Ga0066903_1015321221 | 3300005764 | Tropical Forest Soil | MIKLSKLGIIGAAMLLTATPLSLQWSQKKVAISVDSADAQIYGYGLYSGYGYPAY |
Ga0066903_1028226603 | 3300005764 | Tropical Forest Soil | MKKLSMLAIIGGAALLTATPLSLQWSQKNVALSLDSADAR |
Ga0066903_1045601161 | 3300005764 | Tropical Forest Soil | MKKLSIVGILVGAAFLASAPFSLQWSQSNVVLSLDTADAR |
Ga0066903_1048178063 | 3300005764 | Tropical Forest Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLDSAEARVGRPLTATS |
Ga0066903_1048549282 | 3300005764 | Tropical Forest Soil | MMKKFSMLGIAVGAALLAAVPFSLQWSHEKSLALSLTVPMPE* |
Ga0066903_1055528742 | 3300005764 | Tropical Forest Soil | MKRLSMLGIIVGAALLTATPFSLQWSQKNVALSLDSADARVGRPLTA |
Ga0066903_1077720812 | 3300005764 | Tropical Forest Soil | MKKYSLGIVVAAALLAAMPFSLQWSHENTVALSLDSAHARV |
Ga0070717_115519622 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSINGAEARIAGGVHRRV |
Ga0075365_103378433 | 3300006038 | Populus Endosphere | MKKLGMLGIVGGAALLTVAPFSLQWSQDEVSLSLN |
Ga0075024_1007015391 | 3300006047 | Watersheds | MKKGIILSTIVGAALLTAAPLSLQWSQKTVTLSLDSADARI |
Ga0075029_1004328744 | 3300006052 | Watersheds | MKNGSILGTAALLTAAPFSLQWSQKTVALSLDSADARI |
Ga0075029_1005440851 | 3300006052 | Watersheds | MKKVTILGTIVGAALLTAAPFSLQWSQKTVTLSLDSADARIGTR* |
Ga0075018_103661611 | 3300006172 | Watersheds | MKKLSVLGIIAGAALLTATPVSLQWSQKNVVLSLDTADA |
Ga0075018_107730371 | 3300006172 | Watersheds | VKKVTILGTIVGAALLTAAPFSLQWSQKTVTLSLDSADARV |
Ga0075014_1003091091 | 3300006174 | Watersheds | VKKVIILGTIVGAALLTAAPFSLQWSQKTVTLSLDSADA |
Ga0070712_1000112159 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLGMLGIIGGAAILTAMPFSFQWLQKNVALSF* |
Ga0075367_110043312 | 3300006178 | Populus Endosphere | MKRLATLAMIGGAALLIAAPVSLQWSQQNVRLSLDSAEARTGRPLTATRMAR |
Ga0075369_102418272 | 3300006186 | Populus Endosphere | MKKLSVFGIIGGAALLAAAPFSLQWSQGTVTLSLD |
Ga0075021_102455492 | 3300006354 | Watersheds | MKKGIVLGTIVGAALLTAAPFSLQWSQKTVALSLD |
Ga0066658_104928981 | 3300006794 | Soil | MKKLTMLGIISGAALLTVAPFSLQWSQDKVFLSLN |
Ga0066665_114926941 | 3300006796 | Soil | MKKLSVLGIIAGAALLTATPVSLQWSQKNVVLSLDTADARIGR |
Ga0066659_111271763 | 3300006797 | Soil | MLGIIGGAALLTAAPFTLQWSQKSVSLSVDSADARVG |
Ga0079220_116697832 | 3300006806 | Agricultural Soil | MKKGIILGSLFGAALLTAAPFSLQWSQKTVTLSLDSADARVG |
Ga0075425_1001833187 | 3300006854 | Populus Rhizosphere | MKKLSIVGILVGAAFLSAAPFSLQWSQKNVALSLDSADAR |
Ga0099795_106084701 | 3300007788 | Vadose Zone Soil | MKRLGMLGIIGGAALLTVAPFSLQWSQDEISLSIISVNAQVGPP |
Ga0075418_116766222 | 3300009100 | Populus Rhizosphere | MKKLGMLGIIGGAALLTVEPFSLQWSQDEVSLSLNSANARIGRSYYGPV |
Ga0114129_117948571 | 3300009147 | Populus Rhizosphere | MKKLSMFGIIGGAALLTAAPFSLQLSQKNVALSLDSAEARIGRPL |
Ga0075423_127736481 | 3300009162 | Populus Rhizosphere | MKKLSMLGIIVGAALLTATPFSLQWSQKNVALSLDSADARVG |
Ga0105238_122060931 | 3300009551 | Corn Rhizosphere | MKKLSVLGIVGGAALLTAAPFSLQWTQKNVALSLDSAEARIGRPG |
Ga0105249_126441591 | 3300009553 | Switchgrass Rhizosphere | MKKLSVLGIIGGAALLTAAPFSLQWSQKNVALSLDSADARI |
Ga0126374_101639931 | 3300009792 | Tropical Forest Soil | MKKLSMLGIIAGAALLTATPLSLQWSQKNVALSLN |
Ga0126380_106570471 | 3300010043 | Tropical Forest Soil | MKKLGMLGIIGGAALLTVAPFSLQWSQDEVSLSLNSVNARIGRPLTATSI |
Ga0126380_107155383 | 3300010043 | Tropical Forest Soil | MKKLAMLGIIGGAAILTAAPVSLQWSQKNVALSLDSAEAQE |
Ga0126384_105373193 | 3300010046 | Tropical Forest Soil | MKKLSMLGIIVGAALLSAAPFSLQWSQKNVALSLDS |
Ga0126384_108063982 | 3300010046 | Tropical Forest Soil | MNKLSVLGIIVGAALLSAAPFSLQLSQKNVLSLDSA |
Ga0126384_114641671 | 3300010046 | Tropical Forest Soil | MEDRIMKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSL |
Ga0126384_117128561 | 3300010046 | Tropical Forest Soil | MEAIHEKTSMLGMIVGAALLSAAPFSLQWSQKNVALSLDS |
Ga0126382_101502593 | 3300010047 | Tropical Forest Soil | MKKLSMLAIIVGAALLTATPLSLQWSQKNVALSLDSADARVGRPLTATSV |
Ga0126382_122179401 | 3300010047 | Tropical Forest Soil | MNKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGDR* |
Ga0126373_122643901 | 3300010048 | Tropical Forest Soil | MKKLGMLGIVGGAALLTVAPFSLQWPQDEVSLSLNSANA |
Ga0126373_125229982 | 3300010048 | Tropical Forest Soil | MKKLSMLAIIGGAALLTATPLSLQWSQKNVALSLDSADARVGR |
Ga0134070_102792842 | 3300010301 | Grasslands Soil | MKKLTMLGIISGAALLTVAPFSLQWSQDKVFLSLNSANAIVRPL |
Ga0126370_109025281 | 3300010358 | Tropical Forest Soil | MKKLGMLGIIGGAALLTAAPVSLQWSQDEVSVSLNSADAR |
Ga0126370_112177241 | 3300010358 | Tropical Forest Soil | MKKLSIVGILVGAAFLTSAPLSLQWSQNNVVLSLDTAAARVGRPLTATS |
Ga0126370_113717921 | 3300010358 | Tropical Forest Soil | WIIAGAALLTAMPFSLQWSQKNMAVSLDSADARMVSV* |
Ga0126370_122420111 | 3300010358 | Tropical Forest Soil | MKKLSMLGIIAGAMLLTATPLSLQWSEANVALSLDSADA |
Ga0126370_126208841 | 3300010358 | Tropical Forest Soil | MKKLSMLAIIVGAGLLTATPFSLQWSQKTVALSLDSAD |
Ga0126376_102762711 | 3300010359 | Tropical Forest Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLLLASAEAQERP |
Ga0126372_101488264 | 3300010360 | Tropical Forest Soil | MKKLSMLAIIVGAALLTATPLSLPWSQKNVALSLDSADA* |
Ga0126378_104940301 | 3300010361 | Tropical Forest Soil | MKKLSMLAIIVGAGLLTATPFSLQWSQKNVALSLDSADARVGRPLTAT |
Ga0126378_129197492 | 3300010361 | Tropical Forest Soil | MNKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGRPL |
Ga0126379_108878053 | 3300010366 | Tropical Forest Soil | MKKLSIVGILVGAAFLTAAPFALQWSQNHVTLAHDSADARVGRPLTATSVA |
Ga0126379_120782683 | 3300010366 | Tropical Forest Soil | MKKLAILGIIGGAAILTAAPVSLQWSQKNVALSLDS |
Ga0126379_122453822 | 3300010366 | Tropical Forest Soil | MKKLSIVGMVVGAAFLTSAPLSLQWSQNNVVLSLD |
Ga0126379_134220281 | 3300010366 | Tropical Forest Soil | MKKLGMLGIIGGAALLTVAPFSLQWSQDEVSLSLNSVNARIGRPLTATSIAC |
Ga0134128_113980062 | 3300010373 | Terrestrial Soil | MKRLRTLGIIGGAALLIAAPFSLQWSHKNVALSLDSAEART |
Ga0134128_123966351 | 3300010373 | Terrestrial Soil | MKKLGILGIVGGAVLLTAAPFSLQWSQKTVAVSLDTAD |
Ga0105239_124925521 | 3300010375 | Corn Rhizosphere | MKQLGILGIIGGAALLIAAPFSLQWSQKNVSLSLDSA |
Ga0126381_1009070571 | 3300010376 | Tropical Forest Soil | MKKLSIVGIIVGAAFLTAAPFSLQWSQKNAVLSLDS |
Ga0126381_1029054411 | 3300010376 | Tropical Forest Soil | MEEIMKKLSMLGIIVGAALLTAAPVSLQWSHEKNVVLSLDR |
Ga0126381_1037393481 | 3300010376 | Tropical Forest Soil | MKKCSLGIVFAAALLAAMPFSLQWSPENTVALSLDSAHARVGRPLTATS |
Ga0134126_104720034 | 3300010396 | Terrestrial Soil | MKKLDMLGIIGGAALLTAAPLSLQWSQRNVTLWLAS |
Ga0126383_105551041 | 3300010398 | Tropical Forest Soil | MKKLTVLGIIGGAALPTAAPFSLTWSQKNVALSVDTADA |
Ga0126383_113914771 | 3300010398 | Tropical Forest Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSRANAQTSI |
Ga0126383_118443661 | 3300010398 | Tropical Forest Soil | MKKLSMFGIIVGAALLSAAPFSLQWSQKSVALSLDSADARVGRPLT |
Ga0126383_119172463 | 3300010398 | Tropical Forest Soil | MKKLTLLGVIAGAALLSATPFSLQTSQKSIVLSLDSAEAR |
Ga0126383_125559942 | 3300010398 | Tropical Forest Soil | MKRLSMLGIIVGSALLTATPFSLQWSQKNVALSLDSADARVGRPLT |
Ga0126383_127733001 | 3300010398 | Tropical Forest Soil | MKKLSMLGIVVGAALLSAAPFSLQWSQKNVALSLDSA |
Ga0126383_127792352 | 3300010398 | Tropical Forest Soil | MKKLTLLGVIVGTALLSATPFSLQTSQKSVVLSLD |
Ga0126383_132166271 | 3300010398 | Tropical Forest Soil | MNKLSVLGIIVGTALLSAAPFSLQLSQKNVLSLDSADARVGRP |
Ga0134122_109940712 | 3300010400 | Terrestrial Soil | MKQLGILGIIGGAALLIAAPFSLQWSQKNVSLSLD |
Ga0134122_127194462 | 3300010400 | Terrestrial Soil | MKKLDMLGIIGGAALLTAAPLSLQWSQRNVTLWLASAEAQERPLT |
Ga0134122_129114702 | 3300010400 | Terrestrial Soil | DGADHMKKLSVLGIIGGAALLTAAPLSLQWSQKNVALSLDSAEAE* |
Ga0124844_13118581 | 3300010868 | Tropical Forest Soil | MKKLGMLGIIGGAALLTVAPVSLQWSQEEVSLSLDSAN |
Ga0105246_107589402 | 3300011119 | Miscanthus Rhizosphere | MKRLGIVGIIGGAALLIAAPFSLQWSQKNVSLSLD |
Ga0150983_153155792 | 3300011120 | Forest Soil | MRSIIKKGTILGTIVGAALLAATPFSLQWSQKTVALSLDSADARVGR |
Ga0137388_114955322 | 3300012189 | Vadose Zone Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSINGAEARIAGG |
Ga0137382_105735762 | 3300012200 | Vadose Zone Soil | MKKLSIVGILVGAAFLTAAPFSLQWSQKNVVLSLD |
Ga0137362_110925461 | 3300012205 | Vadose Zone Soil | GGTIMKKLSMLGIIVGAALLSATPFSLQWSQKDVALSLDSADA* |
Ga0137379_108993821 | 3300012209 | Vadose Zone Soil | MKKLSIVGILVGAAFLSAAPFSLQWSQKNVALSLD |
Ga0150985_1211164094 | 3300012212 | Avena Fatua Rhizosphere | MKKLGILGIVGGAVLLTAAPFSLQWSQKTVAVSLDTADA |
Ga0137370_104206552 | 3300012285 | Vadose Zone Soil | MKRLGMLGIIGGAALLTVAPFSLQWSQDEISLSLISVNAQVG |
Ga0137367_108606451 | 3300012353 | Vadose Zone Soil | MKKLGMLGIIGGAALLTVGSPFSLQWSQDEVSLSLNSANARVGRPLT |
Ga0137366_104793223 | 3300012354 | Vadose Zone Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSISSAEARIAGDHR |
Ga0137384_115791071 | 3300012357 | Vadose Zone Soil | MKRLSMLGIIVGAALLSAAPFSLQWSQKNVALSLD |
Ga0137358_108482031 | 3300012582 | Vadose Zone Soil | MKKLAMLGIIGAAAILTAAPVSLQWSQKNVVLSLDSAKAGTATSAAGV |
Ga0126375_101091282 | 3300012948 | Tropical Forest Soil | MKKLSMLGIIAGAMLLTATPLSLQWSQGNVALSLDSADARVGRPL |
Ga0126375_109593611 | 3300012948 | Tropical Forest Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQDEVSLSLNSADARIGRP |
Ga0126375_116703911 | 3300012948 | Tropical Forest Soil | MKKLSIVGILVGAAFLTSAPLSLQWSQNNVVLSLDTA |
Ga0164300_106280152 | 3300012951 | Soil | MQKLGMLGVIGGAVILTAAPLSLQWSQKDVALSLASAEA* |
Ga0164298_111344982 | 3300012955 | Soil | MKKLSVFGIIGGAALLAAAPFSLQWSQGTVTLSLDSDDARIGRPLTAVRGAGV* |
Ga0164303_110466692 | 3300012957 | Soil | MKRLSALGIIGGAALLTAVPISPQWSQKTVTLSLDSADARIGR |
Ga0164301_119288822 | 3300012960 | Soil | MKKLSVFGIIGGATLLAAAPFSLQWSQGTVTLSID |
Ga0126369_101254712 | 3300012971 | Tropical Forest Soil | MKRLSMLAIIVGAALLTATPLSLPWSQKNVALSLDSADA* |
Ga0126369_107832091 | 3300012971 | Tropical Forest Soil | MNKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDSAD |
Ga0126369_113957513 | 3300012971 | Tropical Forest Soil | MKRLSMLAIIVGAGLLTATPFSLQWSQKNVALSLDSA |
Ga0164308_100163751 | 3300012985 | Soil | MMKKLIMLGMISGAALLTAAPFSLQWSQKTVAVSFDTAEARIGR |
Ga0164304_116970732 | 3300012986 | Soil | MKQRSTLGIIGGAALLIAAPFSLQWSHKNALLSLDSAEARTGRPLTATRIAG |
Ga0157378_102946942 | 3300013297 | Miscanthus Rhizosphere | MMKKLIMLGTISGAALLTAAPFSLQWSQKTVAVSFDTAEARIGRPGT |
Ga0157378_121359221 | 3300013297 | Miscanthus Rhizosphere | MKQRRTLGIIGGAALLITAPFSLQWSHKNALLSLD |
Ga0163162_108117031 | 3300013306 | Switchgrass Rhizosphere | MKKLAMLGIIGGAAILTAAPLSLQWSQKDVALSLASAEAQERPPTAT |
Ga0157372_128995371 | 3300013307 | Corn Rhizosphere | MKKLSVLGIIGGAALLTAAPFSLQWTQKNVALSLDSAEAR |
Ga0163163_113503672 | 3300014325 | Switchgrass Rhizosphere | MKQLRTLGIIGGAALLIAAPFSLQWSHKNALLSIDSAEARTGRPL |
Ga0163163_119031771 | 3300014325 | Switchgrass Rhizosphere | MKKLSVLGIIGGAALLAAAPFSWSQTNVALSLDSAEARIG |
Ga0163163_122013991 | 3300014325 | Switchgrass Rhizosphere | MKKLAILGIIGGAAILTAAPVSLQWSQKNVALSLASAEAREGR |
Ga0157380_132237831 | 3300014326 | Switchgrass Rhizosphere | MKRLRTLGIIGGAALLIAAPFSLQWPHKNALLSLD |
Ga0157379_111535851 | 3300014968 | Switchgrass Rhizosphere | MKKLSVFGIIGGAALLAAAPFSLQWSQGTVTLSLDSADA |
Ga0173483_109583671 | 3300015077 | Soil | MKKLSVLGIIGGAALLTAAPFSLQWTQKNVALSLDSA |
Ga0134073_101537762 | 3300015356 | Grasslands Soil | MKKLGMLGIIGGAAILTAMPLSLQWSQKSVMLSLDSAEARTE |
Ga0134072_102789291 | 3300015357 | Grasslands Soil | MKKRTMLGIISGAALLTVAPFSLQWSQDKVFLSLNSANAIVRPL |
Ga0132256_1001562851 | 3300015372 | Arabidopsis Rhizosphere | MTKLSMFGIIGGASLLVALPVSLQWSQKSVTLSLDTADARIGRPGTALS |
Ga0132256_1007672832 | 3300015372 | Arabidopsis Rhizosphere | MKQLGTLAIIGGAALLIAAPFSLQWSHKNALLSLD |
Ga0132256_1010014794 | 3300015372 | Arabidopsis Rhizosphere | MKQLSTLGIIGGAALLIAAPFSLQWSHKNALLSLD |
Ga0132257_1026146813 | 3300015373 | Arabidopsis Rhizosphere | MKQRSTLGIIGGAALLIAAPVSLQWSHKNVLLSLDSAEAR |
Ga0182036_106465363 | 3300016270 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQHEVSLSRANAQTST |
Ga0182036_112647621 | 3300016270 | Soil | MKRLTMLGIVIAAALLTAAPFSFQWSHEKNVSLSLDSADARVGR |
Ga0182041_104723751 | 3300016294 | Soil | MKKLSMLGIIVGAALLSAAPFSLQWSQKSVALSLDSADARVGRPLT |
Ga0182041_107566082 | 3300016294 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSLNSAH |
Ga0182041_111454601 | 3300016294 | Soil | MKRLSMLGIIVGAALLSAAPFSLQLSQKNVALSLDSA |
Ga0182041_111893822 | 3300016294 | Soil | MKKLDMLGIVGGAAILTAAPFSLQWSQKNVVLSLDSAKAG |
Ga0182041_118719152 | 3300016294 | Soil | MKKLSMLGIIFGTVLLTAAPFSLQWPQKNVALSLDSAEARIGRPL |
Ga0182033_114270631 | 3300016319 | Soil | MRKLSVLGVIGGAALLAAVPFSIQWSQKNVTLSLDSAE |
Ga0182033_114463711 | 3300016319 | Soil | MKKLSMLGIIGGAALLTAVPFSLQWSQKNVVLSLDSAKAGTATSAAGV |
Ga0182035_109093601 | 3300016341 | Soil | MKKLSMLAIIGGAALLAAVPVSLQWSHEKNVAVSLDRADAR |
Ga0182035_117892922 | 3300016341 | Soil | MKKLTVLGVIVGAALLSTAPFSLQWSQKSVVLSLDSADARVGRP |
Ga0182032_103220652 | 3300016357 | Soil | MNKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGRPLT |
Ga0182032_111425192 | 3300016357 | Soil | MKKLGMLWTIGVAALLTAAPFSLQWSQKNVALSLDSADARIGR |
Ga0182032_118997831 | 3300016357 | Soil | MKKLSMLGIIVGAALLTAVPFSLQWSHEKNVALSLDRADARV |
Ga0182034_100234958 | 3300016371 | Soil | MKKLSMLGIIVGAALLSAAPFSLQWSQKNVALSLDSA |
Ga0182034_113480081 | 3300016371 | Soil | MKKLSMLGIIVGAALLTATPFSLQWSQKNVALSLDSADARVGRPLT |
Ga0182034_114780301 | 3300016371 | Soil | MMKRLTMLGIVVAAALLTAAPFSLQWSHEKNVSLSL |
Ga0182040_104988421 | 3300016387 | Soil | MKRLAILGIIGGAAMLTAAPLSLQWSQKNLSLSLDSAKAQTAT |
Ga0182040_114946172 | 3300016387 | Soil | MKKLSMLGIISGAALLTAVPFTLQWSQNNVTVSLDSAEARI |
Ga0182039_100597501 | 3300016422 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWSQDEVSLSLNSVNA |
Ga0182039_108171683 | 3300016422 | Soil | MKKLGMLGIIGGAALLTVAPFPLQWPQDEVSLSLNSANARPL |
Ga0182039_115798501 | 3300016422 | Soil | MKKLSMLAIIGGAALLAAVPVSLQWSHEKNVAVSLDR |
Ga0182039_120466161 | 3300016422 | Soil | MKKLSILGIVVGAALLTAAPVSLQWSHEKNVALSLDR |
Ga0182038_100617283 | 3300016445 | Soil | MKKLDMLRIIGGAALLTAAPFSLQWSQENVALSINSAEARIGLT |
Ga0163161_113563061 | 3300017792 | Switchgrass Rhizosphere | MKKLSVFGIIGGAGLLAAAPFSLQWSQGTATLSIDSA |
Ga0187802_104380701 | 3300017822 | Freshwater Sediment | MKKGIILGTIVGAALLTAAPFSLQWSQKTVSLSLDSADARIG |
Ga0187809_103780773 | 3300017937 | Freshwater Sediment | MKKCTILGTIVGAALLTAAPLSLQWSQKTVTLSLDSAEARLGRPL |
Ga0187822_100343653 | 3300017994 | Freshwater Sediment | MKRLTAVSTVMIGAAILCAAPFSLQWSQKTVTLSLDSA |
Ga0187804_102177492 | 3300018006 | Freshwater Sediment | MKRLTAVSTVMIGAAILCAAPFSLQWSQKTVTLSLDSAEA |
Ga0187805_103144561 | 3300018007 | Freshwater Sediment | MKKSTILGTIVGAALLTAAPFSLQWSQKTVTLSLDSA |
Ga0187805_103202721 | 3300018007 | Freshwater Sediment | MKRLTAVSTVVLGAAILCAAPFSLQWSQKTVTLSLDSAEARL |
Ga0184605_105324082 | 3300018027 | Groundwater Sediment | MKKLAILGIIGGAAILTAAPLSLQWSQKNVVLSLDSAKA |
Ga0184608_104719921 | 3300018028 | Groundwater Sediment | MKQLSTLGIIGGAALLIAAPFSLQWSQMNVPLSLDSAE |
Ga0066662_104879391 | 3300018468 | Grasslands Soil | MKKLTMLGIISGAALLTVAPFSLQWSQDKVFLSLNSANAIVRPLTA |
Ga0210407_111189631 | 3300020579 | Soil | MKKLSMLGVIGGAAILTAVPLSLQWSQKDVALSLD |
Ga0210401_115030671 | 3300020583 | Soil | MKKGTIGTIVGAALLATAPFSLQWSQKAVTLSLDSADARVGRP |
Ga0210380_104042312 | 3300021082 | Groundwater Sediment | MMKKLIMLGMISGAALLTAAPFSLQWSQKTVAVSFDTAEARIGRP |
Ga0210397_112642181 | 3300021403 | Soil | MKKLAILGIIGGAAILTAAPLSLQWSQKDVALSLASAE |
Ga0210392_110590542 | 3300021475 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWSQDEVFLSLN |
Ga0126371_102324101 | 3300021560 | Tropical Forest Soil | MKKLGMLGIIGGATILAAAPLSLQWSQKNVALSLASAEAQE |
Ga0126371_105728952 | 3300021560 | Tropical Forest Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSLNS |
Ga0126371_120760991 | 3300021560 | Tropical Forest Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLA |
Ga0126371_121110191 | 3300021560 | Tropical Forest Soil | MKKLSMLGIVGGAALLTAVPFSLQWSQKNVALSFDSAEARIGR |
Ga0126371_123435472 | 3300021560 | Tropical Forest Soil | MKKLSMLGIIDGAMLLTATPLSLQWSEANVALSLDSA |
Ga0126371_135928402 | 3300021560 | Tropical Forest Soil | MKELTLLGVIVGAGLLSATPFSLQTSQKSVVLSLD |
Ga0126371_137858991 | 3300021560 | Tropical Forest Soil | MKTLGMLGIIGGAALLTVAPFSLQWPQDEVSLSLNSAN |
Ga0242645_10263851 | 3300022501 | Soil | MKKLDMLGIIGGAALLTAAPLSLQWSQRNVTLWLASA |
Ga0242676_10420142 | 3300022512 | Soil | MKKLDMLGIIGGAALLTAAPLSLQWSQRNVTLWLASAE |
Ga0242662_102663621 | 3300022533 | Soil | MKKPSMLGVICGAAILTAAPISLQWSQKDVALSLDSAEAQERPLT |
Ga0242653_11168242 | 3300022712 | Soil | MKRLAMLGIIGGAAILTAAPLSLQWSQKNVVLSLD |
Ga0242657_12163052 | 3300022722 | Soil | MKKLAMLGIIGGAAILTAAPLSLQWSQRNVVLSLDSAKAGTAR |
Ga0207663_100963264 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLGMLGIIGGAALLTAAPFSLQWSQDEVFLSLDSV |
Ga0207646_104178121 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLASAEAQSGPRAV |
Ga0207706_104869194 | 3300025933 | Corn Rhizosphere | MKKLAMLGIIGGAAILTAAPLSLQWSQKDVALSLA |
Ga0207712_107186223 | 3300025961 | Switchgrass Rhizosphere | MKKLAILGIIGGAAILTAAPLSLQWSQKDVTLSLA |
Ga0207674_112742371 | 3300026116 | Corn Rhizosphere | MKKLSMLGVICGAAILTAAPVSLQWSQKDVVLSLASAEA |
Ga0207675_1012094723 | 3300026118 | Switchgrass Rhizosphere | MKQLRTLGIIGGAALLIAAPFSLQWSQKNALLSLA |
Ga0209240_10108051 | 3300026304 | Grasslands Soil | MKKLAILGIIGGAAILTAAPLSLQWSQKNVALSLDSAKAG |
Ga0257180_10542622 | 3300026354 | Soil | MKRVGMLGIIGGAAILTAVPLSLQWSQKNVALSLDSAEAQ |
Ga0257179_10106083 | 3300026371 | Soil | MKKLAILGIIGGAAILTAAPLSLQWSQKNVALSLDSAKAGTATSAAG |
Ga0257159_10498702 | 3300026494 | Soil | MKKLAILGIIGGAAILTAAPLSLQWSQKNVALSLDSAKA |
Ga0209376_11112853 | 3300026540 | Soil | MKKLTMLGIISGAALLTVAPFSLQWSQDKVFLSLNSANA |
Ga0209648_103294601 | 3300026551 | Grasslands Soil | MKRLGMLGIIGGAAILTAVPLSLQWSQKNVALSLDSAEA |
Ga0179587_104250722 | 3300026557 | Vadose Zone Soil | MKKLSVIGIIAGAALLTATPVSLQWSQKNVVLSLDTADARIG |
Ga0208997_10594311 | 3300027181 | Forest Soil | MKQLSTLGIIGGAALLIAAPFSLQWSQKNVPLSLDSAEARIARPLTATRIA |
Ga0209684_10050124 | 3300027527 | Tropical Forest Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLLLA |
Ga0209040_102669491 | 3300027824 | Bog Forest Soil | MKKGIILGTIVAAAFLTAAPFSLQWSQKTVSLSLDSADARIGHPLTPGS |
Ga0209465_105757631 | 3300027874 | Tropical Forest Soil | MTRLSILGILIGAALLSAAPFSLQWSQKNVALSLDSADAR |
Ga0209067_109051861 | 3300027898 | Watersheds | MKKVTILGTIVGAALLTAAPFSLQWSQKTVTLSLDSADARIGHPLT |
Ga0209382_119091241 | 3300027909 | Populus Rhizosphere | MKKLGMLGIIGGAALLTVEPFSLQWSQDEVSLSLNSANARIERSYYGPVS |
Ga0257175_11042732 | 3300028673 | Soil | MKKLAILGIIGGAAILTAAPLSLQWSQKNVALSLDSAKAGT |
Ga0307285_102202801 | 3300028712 | Soil | MKKLSVFGIIGGAALLAAAPFSLQCSQGTATLSVDSADAR |
Ga0307301_102267831 | 3300028719 | Soil | MKKLGMLGTIGGAALLTVAPFSLQWSQDEVSLSLNSATSIA |
Ga0307306_102061741 | 3300028782 | Soil | MKRLGMLWIIGGAALLIAAPFSLQWSQKNVPLSLDSA |
Ga0307299_100733621 | 3300028793 | Soil | MKQLSTLGIIGGAALLIAAPFSLQWSQKNVPLSLYSAEAR |
Ga0307287_102268521 | 3300028796 | Soil | MKQRGILGIIGGAALLIAAPFSLQWSQKNVSLSLNSAEARTATR |
Ga0307302_102815303 | 3300028814 | Soil | MKQLSTLGIIGGAALLIAAPFSLQWSQKNAMLSLDSAEARTGRPLTAT |
Ga0307296_100814561 | 3300028819 | Soil | MKRLGMLWIIGGAALLIAAPFSLQWSQKNVPLSLDSAEARIGRPL |
Ga0307312_103946531 | 3300028828 | Soil | MKRLGMLWIIGGAALLIAAPFSLQWSQKNVPLSLDSAEARIGRPLTA |
Ga0307314_102935382 | 3300028872 | Soil | MRQLRTLGIIGGAALLIAAPFSLQWSQKNVPLSLDSAEARTATRI |
Ga0307289_102167293 | 3300028875 | Soil | MKQLSTLGIIGGAALLIAAPFSLQWSQKNVALSLD |
Ga0307278_101372691 | 3300028878 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSINSAEARIAGGVH |
Ga0307308_105765521 | 3300028884 | Soil | MKQLSTLGIIGGAALLIAAPFSLQWSQKNALLSLDS |
Ga0075392_109219151 | 3300030843 | Soil | MKKRIILGTIVGAALLAAAPFSLQWSQKTVTLSIDSADARV |
Ga0170824_1036026771 | 3300031231 | Forest Soil | MKKGTILGTIVGAALLTAAPFSLQWSQKTVALSLDSADARVGRPL |
Ga0170824_1099105412 | 3300031231 | Forest Soil | MRSIIKKGTILGTIVGAALLTAAPFSLQWSQKTVALSLDSADA |
Ga0170820_130460571 | 3300031446 | Forest Soil | MKKGIILGTIVGAALLTAAPFSLQWSQKTVALSLDSADARIG |
Ga0170820_162803251 | 3300031446 | Forest Soil | MRSIIKKGTILGTIVGAALLTAAPFSLQWSQKTVALSL |
Ga0318516_100974031 | 3300031543 | Soil | MNKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGRPLTAT |
Ga0318516_104008121 | 3300031543 | Soil | MKKLGILGIIGGAALLTAAPFSLQWSQENVALSINGAEARIAGGVHRR |
Ga0318516_106950021 | 3300031543 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLDS |
Ga0318534_101730321 | 3300031544 | Soil | MNKLCVLGIIVGAALLSAAPFSLQWSQKNVALSLDSAD |
Ga0318534_103127072 | 3300031544 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLAS |
Ga0318541_104900552 | 3300031545 | Soil | MKRLSMLGIIVGAALLSAAPFSLQWSQKNVALSLDNADA |
Ga0318538_102851661 | 3300031546 | Soil | MKKLGMIGIIGGAALLTAAPFSLQWSQENVALSIN |
Ga0318538_103358541 | 3300031546 | Soil | MKKLAILGIIGGAAILTAAPISLQWSQKNVALSLD |
Ga0318538_106306402 | 3300031546 | Soil | MNKLSVLGIIVGAALLSATPFSLQWSQKNVALSLDSADARVGR |
Ga0318571_102928563 | 3300031549 | Soil | MKKLSMLGIVVGAALLTATPFSLQWSQKNVALSLY |
Ga0318571_103298501 | 3300031549 | Soil | MKKLSMLAIIVGAGLLTATPFSLQWSQKNVALSLDSADARVGRPL |
Ga0318528_105383342 | 3300031561 | Soil | MKKLGMLGIIGGAALLTAAPLSLQWSQKNVTLSLA |
Ga0318528_107358572 | 3300031561 | Soil | MKKLTVLGVIVGAALLSTAPFSLQWSQKSVVLSLDSAD |
Ga0318573_103678661 | 3300031564 | Soil | MKKLSMLGIVGGAALLTSVPLSLQWSQKNVALSLDSA |
Ga0318515_100460701 | 3300031572 | Soil | MKKLTVLGVIVGAALLSTAPFSLQWSQKSVVLSLDSA |
Ga0310915_100847421 | 3300031573 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQDEVSLPRAN |
Ga0310915_104091833 | 3300031573 | Soil | MKKLSILGIVVGAALLTAAPVSLQWSHEKNVAVSLD |
Ga0310915_112032401 | 3300031573 | Soil | MMKKFSVLGIIVGAALLTAAPVSLQWSHEKKVAISLDR |
Ga0318555_101510131 | 3300031640 | Soil | MKKLSTLVIIVGAALLTAAPVSLQWSHEKNVAVSLD |
Ga0318555_101765001 | 3300031640 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSINGAEA |
Ga0318561_102403112 | 3300031679 | Soil | MNKLSVLGIIVGAALLSATPFSLQWSQKNVALSLD |
Ga0318561_102695391 | 3300031679 | Soil | MKKLSMLGIIVGAALLSAAPFSLQLSQRNVALSLD |
Ga0318561_106162731 | 3300031679 | Soil | MKKLTVLGVIVGAALLSTAPFSLQWSQKSVVLSLDSADA |
Ga0318561_108506781 | 3300031679 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVMLSLD |
Ga0318574_100552263 | 3300031680 | Soil | MKKLSMLGIIVGAALLTTAPFSLQWSQKNVALSLDSADARVG |
Ga0318574_100682124 | 3300031680 | Soil | MNKLSVLGIIVGAALLSATPFSLQWSQKNVALSLDSADARVG |
Ga0318574_103779901 | 3300031680 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSLNSANARPLT |
Ga0318574_106529661 | 3300031680 | Soil | MKKLSTLGIIVGAALLTAAPVSLQWSHEKNVAVSL |
Ga0318572_105456361 | 3300031681 | Soil | MKRLAMLGIIGGAAILTAAPLSLQWSQKNVVLSLDSAKAGTATSA |
Ga0318572_108238471 | 3300031681 | Soil | MKKLSMLGIISAAALLTAVPFSLQWSQNNVTLSLDSAEAR |
Ga0318572_108470242 | 3300031681 | Soil | MNKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVG |
Ga0318496_106594341 | 3300031713 | Soil | MKRLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLA |
Ga0318496_106951892 | 3300031713 | Soil | MKKFSMLGIIGGAALLTAVPFSIQWSQKNVTLSLD |
Ga0306917_104279413 | 3300031719 | Soil | MKKLAMLGIIGGAAILTATPLSLQWSQKNVVLSLD |
Ga0306917_111322592 | 3300031719 | Soil | MKKLSILGIVFGATLLTAVPLSVQWSPEKSVAVSVDRA |
Ga0307469_102185173 | 3300031720 | Hardwood Forest Soil | MKRLSALGIIGGAALLTAVPISPQWSQKTVTLSLDSADARIGRP |
Ga0307469_113115962 | 3300031720 | Hardwood Forest Soil | MKKLGMVGIIGGAALLTAAPLSLQWSQKNVALTLDSA |
Ga0318493_101261703 | 3300031723 | Soil | MNKLCVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGRPLT |
Ga0318500_105144031 | 3300031724 | Soil | MKKLTVLGVIVGAALLSTAPFSLQWSQKSVVLSLDSADAR |
Ga0318501_100385801 | 3300031736 | Soil | MNKLSVFGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVG |
Ga0307468_1010174631 | 3300031740 | Hardwood Forest Soil | MKRLSMLGIIGGAALLIAAPFSLQWSQKNVPLSLGGAE |
Ga0307468_1012645051 | 3300031740 | Hardwood Forest Soil | MKKLGMLGIIGGAALLTVAPFSLQWSQDEVFLSLNSVNAQ |
Ga0306918_101174311 | 3300031744 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSLNSANA |
Ga0306918_104404963 | 3300031744 | Soil | MKKLSILGIVVGAALLTAAPVSLQWSHEKNVAVSL |
Ga0306918_109564041 | 3300031744 | Soil | MKKLSMLGIIVGAALLSAAPFSLQWPQKNVALSLDSADSRVG |
Ga0306918_110785572 | 3300031744 | Soil | MTKLGVLGTIAGAAILTAAPLSLQWSHTKVGLSLDSAEAQE |
Ga0306918_111390843 | 3300031744 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQDEVSLSLSS |
Ga0306918_113623811 | 3300031744 | Soil | MKKLAMLGIIGGAAILTAAPLSLQWSQKNVVLSLDSAKAETATS |
Ga0318492_101300271 | 3300031748 | Soil | MKKLTMLGIVVGAALLTATPFSLQWSQKNVALSLD |
Ga0318492_102541012 | 3300031748 | Soil | MKKLSILGIIVGAALLTAVPFSLQWSHEKNVALSLDRADARVG |
Ga0318492_104233402 | 3300031748 | Soil | MKKLSMLGIVVGAALLTATPFSLQWSQKNVALSLDRADARVGQ |
Ga0318494_101615122 | 3300031751 | Soil | MNKLCVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADAR |
Ga0318494_108480382 | 3300031751 | Soil | MKKLSILGIVVGAALLAATPFSLQWSQENNVAVSLDRADAK |
Ga0318537_102398521 | 3300031763 | Soil | MKKLTTLGIIAGAALLTATPFSLQWSQKNVALSLDSADARIG |
Ga0318537_103887632 | 3300031763 | Soil | MNKLSVFGIIVGAALLSAAPFSLHWSQKNVALSLDSADARVGRPLTAT |
Ga0318535_102957472 | 3300031764 | Soil | MKKLSMLGIVVGAALLTATPFSLQWSQKNVVLSLDRADA |
Ga0318535_103161071 | 3300031764 | Soil | MKKLSMLAIIGGAALFAAVPVSLQWSHEKNVAVSLDRADARVGRPL |
Ga0318535_104203551 | 3300031764 | Soil | MKKLAMLGIIGGAAILTAAPVSLQWSQKNVALSLDSAQARDGRPLTHPR |
Ga0318509_100305291 | 3300031768 | Soil | MKKLDMLRIIGGAALLTAAPFSLQWSQENVALSINSAEARIGLTAT |
Ga0318526_102329471 | 3300031769 | Soil | MKKLSMLGIVVGAALLTATPFSLQWSQKNVALSLYR |
Ga0318521_100470493 | 3300031770 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSLNSAHA |
Ga0318543_105617272 | 3300031777 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSHTNVGLSLDSAEAQER |
Ga0318566_102230632 | 3300031779 | Soil | MKRLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLAS |
Ga0318566_106632852 | 3300031779 | Soil | MKKLSMLGIISGAALLTAVPFTLQWSQNNVTVSLD |
Ga0318566_106694771 | 3300031779 | Soil | MNKLSVFGIIVGAALLSAAPFSLQWSQKNVALSLDSADAR |
Ga0318508_11135291 | 3300031780 | Soil | MKKLSMLGIVVGAALLTATPFSLQWSQKNVALSLYRADA |
Ga0318508_12236241 | 3300031780 | Soil | MTKLSMLGIIVGAALLTAAPVSLQWSLEMNVVLSLDRADARV |
Ga0318508_12347861 | 3300031780 | Soil | MKRLAMLGIIGGAAILTAAPLSLQWSQKNVVLSLDSAKAGTATSAAG |
Ga0318552_107083902 | 3300031782 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLDSAEARVGRPL |
Ga0318529_100486184 | 3300031792 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQHEVSLSCANAQTSTAR |
Ga0318529_100513072 | 3300031792 | Soil | MKKLDMLRIIGGAALLTAAPFSLQWSQENVALSINSAEARIGLTATN |
Ga0318529_105119252 | 3300031792 | Soil | MKKLGMLWTIGVAALLTAAPFSLQWSQKNVALSLD |
Ga0318548_100382321 | 3300031793 | Soil | MKKLTVLGVIVGAALLSTAPFSLQWSQKSVVLSLDS |
Ga0318548_100472954 | 3300031793 | Soil | MKKLSMLGIVVGAALLTATPFSLQWSQKNVVLSLDRADARVGQ |
Ga0318548_106311302 | 3300031793 | Soil | MTKLGMLGTIAGAAILTAAPLSLQWSHTNVGLSLASAEAQ |
Ga0318557_100610251 | 3300031795 | Soil | MKRLAILGIIGGAAMLTATPLSLQWSQKNVALSLDRAK |
Ga0318576_102652961 | 3300031796 | Soil | MNKLCVLGIIVGAALLSAAPFSLQWSQKNVALSLDSA |
Ga0318576_103071251 | 3300031796 | Soil | MKKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDS |
Ga0318550_103717591 | 3300031797 | Soil | MKKLTMLGIVVGAALLTATPFSLQWSQKNVALSLDRADA |
Ga0318565_102277142 | 3300031799 | Soil | MNKLCVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADA |
Ga0318565_104372483 | 3300031799 | Soil | MKKLSMLGIVVGAALLTATPFSLQWSQKNVALSLYRADARVGQ |
Ga0318565_105136411 | 3300031799 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLDSAEARVGRP |
Ga0318497_100938761 | 3300031805 | Soil | MNKLSVLGIIVGAALLSATPFSLQWSQKNVALSLDSADARVGRPLT |
Ga0318568_109337201 | 3300031819 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSINGAEARIAGGVHRR |
Ga0318499_100717982 | 3300031832 | Soil | MNKLCVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVG |
Ga0318499_102897162 | 3300031832 | Soil | MKKLSMLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVG |
Ga0310917_100820001 | 3300031833 | Soil | MKKLSMLGIISGAALLTAVPFSLQWSQNNVTLSLDSAEAR |
Ga0310917_103594191 | 3300031833 | Soil | MKKLGMLGIIGAAAILTAAPLSLQWSQTNVALSLDSALAREARPLYRYGSADC |
Ga0310917_104830751 | 3300031833 | Soil | MKKLVVLGIIGGAALLTAVPLSPHWSQQGVSLSVD |
Ga0310917_105791092 | 3300031833 | Soil | MKKLAILGIIGGAAILTAAPVSLQWSQKDVALSLDSAK |
Ga0310917_107047101 | 3300031833 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLDSADARVG |
Ga0310917_110514781 | 3300031833 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLASAE |
Ga0318517_103093461 | 3300031835 | Soil | MKKLSMLGIIVGAALLSAAPFSLQWSQKSVALSLDSADAR |
Ga0318511_103313171 | 3300031845 | Soil | MKRLAMLGIIGGAAILTAAPLSLQWSQKNVVLSLDSAKAGTATSAAGV |
Ga0318512_101435071 | 3300031846 | Soil | MKKLSMLGIIGGAALLAAAPFSLQWSQKNVALSLDSADARIGRP |
Ga0318512_103959291 | 3300031846 | Soil | MKKLAILGIIGGAAILTAAPISLQWSQKNVALSLDSAKAGTA |
Ga0306919_105116551 | 3300031879 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSINGAEARIAGGVHRRVY |
Ga0306919_106905931 | 3300031879 | Soil | MKRLGMLGIIGGAALLTAAPFSLQWSQDEVSLSLS |
Ga0306919_111537451 | 3300031879 | Soil | MKKLSMLAIIGGAALLAAVPVSLQWSHEKNVAVSL |
Ga0306919_111748491 | 3300031879 | Soil | MKKLAMLGIIGGAAILTAAPLSLQWSQKNVVLSLDSAKAGTSAAGVSR |
Ga0318544_101087832 | 3300031880 | Soil | MNKLCVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGRPL |
Ga0318544_102394401 | 3300031880 | Soil | MKKLTVLGVIVGAALLSTAPFSLQWSQKSVVLSLD |
Ga0318544_104488451 | 3300031880 | Soil | MKKLSIVGILVGAAFLTSAPLSLQWSQNNVVLSLDTANAR |
Ga0306925_100952651 | 3300031890 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLDSA |
Ga0306925_104803794 | 3300031890 | Soil | MKKLSMLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGRPLTA |
Ga0318520_101597112 | 3300031897 | Soil | MKKFSMLGIIGGAALLTAVPFSIQWSQKNVTLSLDSAE |
Ga0318520_110176042 | 3300031897 | Soil | MKKLSMLGIIVGAALLTAVPFSLQWSHEKNVALSLD |
Ga0306923_113790101 | 3300031910 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSHTNVGLSLASAEAQ |
Ga0306923_115031581 | 3300031910 | Soil | MKKLSMLGIVGGAALLTAVPFSLQWSQKNVALSFDSAEARIGRAAHCDER |
Ga0306923_125617442 | 3300031910 | Soil | MKKQSVVGILVGAALLSAAPFSFQWTEKNLALSLNTAD |
Ga0306921_102609901 | 3300031912 | Soil | MKKLSIVGILVGAALLTSAPFSLQSSQNSVVLSLDTADARVGRPL |
Ga0306921_105154492 | 3300031912 | Soil | MKKLSMLAIIGGAALLAAVPVSLQWSHEKNVAVSLD |
Ga0310912_113020032 | 3300031941 | Soil | MKKLAMLGIIGGAAILTAAPLSLQWSQKNVVLSLDSAKAGTATSAA |
Ga0310916_102893762 | 3300031942 | Soil | MKKLSIVGILVGAALLTSAPFSLQSSQNSVVLSLDTADARV |
Ga0310916_113848281 | 3300031942 | Soil | MKKLTVLGVIVGAALLSTAPFSLQWSQKSVVLSLDSADARV |
Ga0310913_101228243 | 3300031945 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQHEVSLSRANAQTSTAGVHRR |
Ga0310913_102878842 | 3300031945 | Soil | MKKLSMLGIIVGAALLSAAPLSLQLSQKNVALSLD |
Ga0310913_102978961 | 3300031945 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLASAEAQ |
Ga0310913_104323084 | 3300031945 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLDSAEA |
Ga0310910_103284181 | 3300031946 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLASAEAQER |
Ga0310909_101491653 | 3300031947 | Soil | MKKLTVLWIIASAALFTTAPFSLQWSQKTVAVSLDSADARV |
Ga0310909_115090401 | 3300031947 | Soil | MKKLSMLGIIVGAALLTAVPFSLQWSHEKNVALSLDRADARVGQP |
Ga0306926_103102067 | 3300031954 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLASA |
Ga0306926_103764223 | 3300031954 | Soil | MKKLSMLAIIGGAALLAAVPVSLQWSHEKNVAVSLDRADARVGRP |
Ga0306926_113546482 | 3300031954 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKNVTLSLDSAEARIGRPLTATS |
Ga0306926_114171793 | 3300031954 | Soil | MKKLNILGIVVGAALLTAAPVSLQWSHEKNVAVSL |
Ga0306926_118866733 | 3300031954 | Soil | MKKLAILGIIGGAAMLTAAPLSLQWSQKNLSLSLDSAKAQTATS |
Ga0306926_126670511 | 3300031954 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLDSAEARVGIPL |
Ga0318530_100255931 | 3300031959 | Soil | MKKLSMLGIIVGAALLTTAPFSLQWSQKNVALSLDSAD |
Ga0318530_104224732 | 3300031959 | Soil | MKKLSILGIVVGAALLTAAPFSLQWSHESNVALSLDR |
Ga0318531_100564702 | 3300031981 | Soil | MKKLSMLGIIVGAALLSAAPFSLQWSQKSVALSLDS |
Ga0318531_102694372 | 3300031981 | Soil | MKKLTMLGIVVGAALLTATPFSLQWSQKNVALSLDRADDQR |
Ga0318531_103850861 | 3300031981 | Soil | MKKLSTLVIIVGAALLTAAPVSLQWSHEKNVAVSLDRADAR |
Ga0306922_115059882 | 3300032001 | Soil | MKRLAMLGIIGAAAILTAAPLSLQWSQKNVVLSLDSA |
Ga0318569_104834192 | 3300032010 | Soil | MKKLDMLRIIGGAALLTAAPFSLQWSQENVALSINSAEARIGLTA |
Ga0310911_100656171 | 3300032035 | Soil | MNKLSVFGIIVGAALLSAAPFSLQWSQKNVALSLD |
Ga0310911_100703372 | 3300032035 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSLNSANARPLTSIA |
Ga0318549_102644402 | 3300032041 | Soil | MKKLDMLRIIGGAALLTAAPFSLQWSQENVALSIN |
Ga0318545_100435911 | 3300032042 | Soil | MNKLSVFGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGRPLTATC |
Ga0318558_101514262 | 3300032044 | Soil | MNKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDSA |
Ga0318558_104267271 | 3300032044 | Soil | MKKLSMLGIVVGAALLIATPFSLQWSQKNVALSLDRADARVG |
Ga0318558_106952981 | 3300032044 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLD |
Ga0318532_100063116 | 3300032051 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSRANAGTSTA |
Ga0318532_100906541 | 3300032051 | Soil | MKKLGMLRIIGGAALLTVAPFSLQWSQENVALSINSAEARIA |
Ga0318506_100449764 | 3300032052 | Soil | MKRLAILGIIGGAAMLTAAPLSLQWSQKNLSLSLDSA |
Ga0318506_101609332 | 3300032052 | Soil | MNKLCVLGIIVGAALLSAAPFSLQWSQKNVALSLD |
Ga0318506_102752901 | 3300032052 | Soil | MTKLSMLGIIVGAALLTAAPVSLQWSHEKNVVLSLD |
Ga0318570_100248983 | 3300032054 | Soil | MKKLDMLRIIGGAALLTAAPFSLQWSQDEVSLSLS |
Ga0318570_101307362 | 3300032054 | Soil | MKKLSMLGIVVGAALLTATPFSLQWSQKNVVLSLDRADARVGQPLTAGSV |
Ga0318570_101862711 | 3300032054 | Soil | MNKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGRPLTATS |
Ga0318533_100762701 | 3300032059 | Soil | MKKLSLLGILAGAALLTATPLSLQWSQKTVALSVD |
Ga0318533_100816943 | 3300032059 | Soil | MKKLGMLGIIGGAALLTVAPFSLQWPQDEVSLSLNSAHAR |
Ga0318533_101905231 | 3300032059 | Soil | MKKLSILGIIFGAALLTAVPLSIQWSPQKSVAVSLD |
Ga0318533_110398372 | 3300032059 | Soil | MKKLTMLGIVVGAALLTATPFSLQWSQKNVALSLDRADARVGQPLT |
Ga0318505_100377691 | 3300032060 | Soil | MKKLSMLGIIVGAALLTTAPFSLQWSQKNVALSLD |
Ga0318505_102037661 | 3300032060 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQENVALSINGAEARIAGGVHRRVYH |
Ga0318504_100069251 | 3300032063 | Soil | MKKLDMLRIIGGAALLTAAPFSLQWSQENVALSINSAEARIGLTATNV |
Ga0318504_100815541 | 3300032063 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSHTNVGPSLDSAE |
Ga0318504_103947183 | 3300032063 | Soil | MKKLGMLGIIGGAALLTAAPFSLQWSQDEVSLSLS |
Ga0318513_101575333 | 3300032065 | Soil | MKKLSMLGIIGGAALLAATPFSLQWSQKNVALSLDSA |
Ga0318513_103835571 | 3300032065 | Soil | MKKLSMLGIVVGAALLIATPFSLQWSQKNVALSLDRADARVGQPL |
Ga0318513_106271291 | 3300032065 | Soil | MKKLGMLGIIGGAALLTAAPLSLQWSQKNVALSLDSAEAQSGPRA |
Ga0306924_102966975 | 3300032076 | Soil | MKKLSMLGIIVGAALLSAAPFSLQWSQKNVALSLDSADA |
Ga0318525_102149981 | 3300032089 | Soil | MKKLSMLAIIGGAALFAAVPVSLQWSHEKNVAVSLDRADARVGRP |
Ga0318525_105114191 | 3300032089 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSQKTVALSLDRAEAREGRQSTA |
Ga0318518_100900354 | 3300032090 | Soil | MKKLGMLGIIGGAAILTAVPLSLQWSHTNVGLSLASA |
Ga0318518_103939472 | 3300032090 | Soil | MKRLGMLGIIGGAALLTAAPLSLQWSQENVTLSLASAEAQE |
Ga0318577_103347291 | 3300032091 | Soil | MNKLSVLGIIVGAALLSAAPFSLQWSQKNVELSLDSADARVG |
Ga0307471_1031353601 | 3300032180 | Hardwood Forest Soil | MKKLGMLGIIGGAALLTAAPLSLQWSQKNVTLLLAS |
Ga0306920_1001033478 | 3300032261 | Soil | MKRLSMLGIIVGAALLSAAPFSLQLSQKNVALSLDSADA |
Ga0306920_1005799991 | 3300032261 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVVLSLDSAE |
Ga0306920_1009994782 | 3300032261 | Soil | MKKLSMLGIIGGAALLTAVSFSLQWSQNKCDLSLDSVLPKSKN |
Ga0306920_1024486191 | 3300032261 | Soil | MKKLSILGIVFGATLLTAVPLSVQWSPEKSVAVSVDRAD |
Ga0306920_1032888562 | 3300032261 | Soil | MKKLTLIGVIVGAALLSATPFSLQMSQKSVVLSLDSAEARVGRPLTAT |
Ga0306920_1033582222 | 3300032261 | Soil | MKKLSMLGIVVGAALLTAAPVSLQWSHEKNVVLSLD |
Ga0310914_102667381 | 3300033289 | Soil | MKKLAILGIIGGAAMLTAAPLSLQWSQKNLSLSLDSAKAQTATST |
Ga0310914_106703501 | 3300033289 | Soil | MKKLTLLGVIVGAALLSATPFSLQTSQKSVMLSLYSA |
Ga0310914_110963902 | 3300033289 | Soil | MKKLSVLGIIVGAALLSAAPFSLQWSQKNVALSLDSADARVGR |
Ga0318519_105305071 | 3300033290 | Soil | MKKLSMLGIIVGAALLSAAPFSLQWSQESVALSLDS |
⦗Top⦘ |