Basic Information | |
---|---|
Family ID | F004638 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 429 |
Average Sequence Length | 41 residues |
Representative Sequence | SLNRLLVELAIATQIPMSEWVEAEDILTAIEILEKRNGN |
Number of Associated Samples | 231 |
Number of Associated Scaffolds | 429 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 11.29 % |
% of genes near scaffold ends (potentially truncated) | 86.01 % |
% of genes from short scaffolds (< 2000 bps) | 82.52 % |
Associated GOLD sequencing projects | 205 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.69 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (90.676 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.084 % of family members) |
Environment Ontology (ENVO) | Unclassified (57.809 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.380 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 429 Family Scaffolds |
---|---|---|
PF05257 | CHAP | 0.93 |
PF05065 | Phage_capsid | 0.93 |
PF04860 | Phage_portal | 0.93 |
PF13539 | Peptidase_M15_4 | 0.47 |
PF03354 | TerL_ATPase | 0.23 |
PF00149 | Metallophos | 0.23 |
PF04586 | Peptidase_S78 | 0.23 |
PF01844 | HNH | 0.23 |
COG ID | Name | Functional Category | % Frequency in 429 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.93 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.23 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.23 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.80 % |
Unclassified | root | N/A | 4.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001523|JGI1221J15618_1011650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1350 | Open in IMG/M |
3300001605|Draft_10115430 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → Phycisphaeraceae → unclassified Phycisphaeraceae → Phycisphaeraceae bacterium | 1882 | Open in IMG/M |
3300001968|GOS2236_1014523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1807 | Open in IMG/M |
3300002202|metazooDRAFT_1257108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300002294|B570J29584_1000205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7149 | Open in IMG/M |
3300002294|B570J29584_1006944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300002296|B570J29587_1011910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300002408|B570J29032_109713557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300003394|JGI25907J50239_1067122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300004126|Ga0066179_10030989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
3300004240|Ga0007787_10110206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1294 | Open in IMG/M |
3300005517|Ga0070374_10613898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300005528|Ga0068872_10239930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
3300005580|Ga0049083_10298182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300005581|Ga0049081_10288669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 567 | Open in IMG/M |
3300005583|Ga0049085_10004686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5447 | Open in IMG/M |
3300005584|Ga0049082_10000730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9815 | Open in IMG/M |
3300005584|Ga0049082_10333739 | Not Available | 502 | Open in IMG/M |
3300005585|Ga0049084_10021960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2540 | Open in IMG/M |
3300005662|Ga0078894_10334267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1373 | Open in IMG/M |
3300005662|Ga0078894_10836629 | Not Available | 803 | Open in IMG/M |
3300005832|Ga0074469_10897311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300006030|Ga0075470_10181230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300006802|Ga0070749_10173517 | All Organisms → Viruses → Predicted Viral | 1244 | Open in IMG/M |
3300006802|Ga0070749_10206312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → unclassified Cellulomonas → Cellulomonas sp. 73-92 | 1124 | Open in IMG/M |
3300006802|Ga0070749_10245889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1014 | Open in IMG/M |
3300006802|Ga0070749_10284030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 931 | Open in IMG/M |
3300006802|Ga0070749_10352837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300006802|Ga0070749_10796945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300006805|Ga0075464_10457947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300006805|Ga0075464_10487822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300006805|Ga0075464_10607089 | Not Available | 674 | Open in IMG/M |
3300006805|Ga0075464_10704964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300006805|Ga0075464_10882961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300006874|Ga0075475_10163284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
3300006875|Ga0075473_10013577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3150 | Open in IMG/M |
3300006875|Ga0075473_10155623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300006875|Ga0075473_10188019 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300006919|Ga0070746_10546687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300006920|Ga0070748_1077642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1286 | Open in IMG/M |
3300006920|Ga0070748_1235983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300007162|Ga0079300_10145846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 646 | Open in IMG/M |
3300007234|Ga0075460_10034020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1966 | Open in IMG/M |
3300007234|Ga0075460_10142803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
3300007319|Ga0102691_1031894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300007363|Ga0075458_10121354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
3300007516|Ga0105050_10532430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300007538|Ga0099851_1053156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1588 | Open in IMG/M |
3300007538|Ga0099851_1124867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
3300007538|Ga0099851_1192157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300007540|Ga0099847_1067904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
3300007540|Ga0099847_1174584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300007541|Ga0099848_1068772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
3300007541|Ga0099848_1118773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
3300007541|Ga0099848_1168309 | Not Available | 802 | Open in IMG/M |
3300007542|Ga0099846_1131760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
3300007542|Ga0099846_1202301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 700 | Open in IMG/M |
3300007542|Ga0099846_1218940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300007542|Ga0099846_1346407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 504 | Open in IMG/M |
3300007640|Ga0070751_1391168 | Not Available | 502 | Open in IMG/M |
3300007722|Ga0105051_10816598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300007960|Ga0099850_1182245 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
3300007974|Ga0105747_1043838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1302 | Open in IMG/M |
3300008055|Ga0108970_10887819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
3300008114|Ga0114347_1011530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4432 | Open in IMG/M |
3300008114|Ga0114347_1178201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300008117|Ga0114351_1102824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1662 | Open in IMG/M |
3300008259|Ga0114841_1001188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14895 | Open in IMG/M |
3300008266|Ga0114363_1012152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4021 | Open in IMG/M |
3300008266|Ga0114363_1015293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3495 | Open in IMG/M |
3300008266|Ga0114363_1024957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2587 | Open in IMG/M |
3300008266|Ga0114363_1031634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2230 | Open in IMG/M |
3300008266|Ga0114363_1091264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300008266|Ga0114363_1112534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300008266|Ga0114363_1199116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300008266|Ga0114363_1210348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300008266|Ga0114363_1210645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300008266|Ga0114363_1215563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300008266|Ga0114363_1236397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300008266|Ga0114363_1237086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300008267|Ga0114364_1093747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
3300008448|Ga0114876_1130520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
3300008448|Ga0114876_1206873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300008450|Ga0114880_1043855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1925 | Open in IMG/M |
3300008450|Ga0114880_1060569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
3300008450|Ga0114880_1072647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1393 | Open in IMG/M |
3300008450|Ga0114880_1165997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300008450|Ga0114880_1195493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300008450|Ga0114880_1200780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300008450|Ga0114880_1222021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300008459|Ga0114865_1085611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
3300009068|Ga0114973_10074877 | Not Available | 1952 | Open in IMG/M |
3300009068|Ga0114973_10314749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300009081|Ga0105098_10381661 | Not Available | 695 | Open in IMG/M |
3300009082|Ga0105099_10432565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300009091|Ga0102851_10139430 | All Organisms → Viruses → Predicted Viral | 2185 | Open in IMG/M |
3300009111|Ga0115026_10628689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300009152|Ga0114980_10005285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8609 | Open in IMG/M |
3300009152|Ga0114980_10373970 | Not Available | 820 | Open in IMG/M |
3300009155|Ga0114968_10104933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1723 | Open in IMG/M |
3300009158|Ga0114977_10032362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3274 | Open in IMG/M |
3300009158|Ga0114977_10054334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2476 | Open in IMG/M |
3300009158|Ga0114977_10321265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300009158|Ga0114977_10468235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300009158|Ga0114977_10682909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300009159|Ga0114978_10126933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1660 | Open in IMG/M |
3300009159|Ga0114978_10205472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1242 | Open in IMG/M |
3300009159|Ga0114978_10331175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
3300009159|Ga0114978_10397890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300009159|Ga0114978_10418557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300009159|Ga0114978_10502976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300009160|Ga0114981_10192156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
3300009161|Ga0114966_10079284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2247 | Open in IMG/M |
3300009161|Ga0114966_10365248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
3300009161|Ga0114966_10616367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300009163|Ga0114970_10032465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3463 | Open in IMG/M |
3300009163|Ga0114970_10161672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1339 | Open in IMG/M |
3300009163|Ga0114970_10202824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1166 | Open in IMG/M |
3300009163|Ga0114970_10547309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 627 | Open in IMG/M |
3300009163|Ga0114970_10595554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300009165|Ga0105102_10450667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300009168|Ga0105104_10824688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300009169|Ga0105097_10560422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300009180|Ga0114979_10144537 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
3300009180|Ga0114979_10638446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300009181|Ga0114969_10030366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3735 | Open in IMG/M |
3300009181|Ga0114969_10073048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2245 | Open in IMG/M |
3300009181|Ga0114969_10404154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300009181|Ga0114969_10534889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300009181|Ga0114969_10568937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300009181|Ga0114969_10598041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300009183|Ga0114974_10097529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1896 | Open in IMG/M |
3300009183|Ga0114974_10606111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300009183|Ga0114974_10649000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300009184|Ga0114976_10176577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1186 | Open in IMG/M |
3300009184|Ga0114976_10347213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300009184|Ga0114976_10631093 | Not Available | 542 | Open in IMG/M |
3300009184|Ga0114976_10642632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300009194|Ga0114983_1000659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14359 | Open in IMG/M |
3300009419|Ga0114982_1098942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300009450|Ga0127391_1068079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300009450|Ga0127391_1083332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300009469|Ga0127401_1149955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300009470|Ga0126447_1045600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1086 | Open in IMG/M |
3300009532|Ga0129360_1010016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300010160|Ga0114967_10327195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300010160|Ga0114967_10634310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300010354|Ga0129333_10198782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1823 | Open in IMG/M |
3300010354|Ga0129333_10351249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
3300010354|Ga0129333_11024078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300010354|Ga0129333_11461132 | Not Available | 561 | Open in IMG/M |
3300010370|Ga0129336_10401282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300010885|Ga0133913_10132418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6675 | Open in IMG/M |
3300010885|Ga0133913_10181907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5610 | Open in IMG/M |
3300010885|Ga0133913_10945243 | All Organisms → Viruses → Predicted Viral | 2234 | Open in IMG/M |
3300010885|Ga0133913_11046225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2107 | Open in IMG/M |
3300010885|Ga0133913_11362651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1807 | Open in IMG/M |
3300011114|Ga0151515_10668 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14448 | Open in IMG/M |
3300011116|Ga0151516_10640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16361 | Open in IMG/M |
3300012013|Ga0153805_1002442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3511 | Open in IMG/M |
3300012017|Ga0153801_1005288 | Not Available | 2436 | Open in IMG/M |
3300012017|Ga0153801_1100008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300012266|Ga0136712_1041940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300012666|Ga0157498_1003511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2636 | Open in IMG/M |
3300012666|Ga0157498_1017841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1111 | Open in IMG/M |
3300012722|Ga0157630_1270925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
3300012764|Ga0157624_1176918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300013004|Ga0164293_10332565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
3300013004|Ga0164293_10388672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
3300013004|Ga0164293_10393127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300013004|Ga0164293_10399958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 925 | Open in IMG/M |
3300013004|Ga0164293_10534887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
3300013005|Ga0164292_10094186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2266 | Open in IMG/M |
3300013005|Ga0164292_10125060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1908 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10719198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300013372|Ga0177922_10185005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300013372|Ga0177922_11227933 | All Organisms → Viruses → Predicted Viral | 1271 | Open in IMG/M |
3300014811|Ga0119960_1033555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300017716|Ga0181350_1141516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300017716|Ga0181350_1145107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300017716|Ga0181350_1146422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300017722|Ga0181347_1155755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300017723|Ga0181362_1057443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
3300017736|Ga0181365_1010560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2302 | Open in IMG/M |
3300017736|Ga0181365_1063924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
3300017736|Ga0181365_1168665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300017754|Ga0181344_1023583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1899 | Open in IMG/M |
3300017754|Ga0181344_1096407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300017754|Ga0181344_1125792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 737 | Open in IMG/M |
3300017754|Ga0181344_1142201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300017761|Ga0181356_1073849 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
3300017761|Ga0181356_1185861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300017774|Ga0181358_1221912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300017777|Ga0181357_1012610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3374 | Open in IMG/M |
3300017777|Ga0181357_1019921 | All Organisms → Viruses → Predicted Viral | 2668 | Open in IMG/M |
3300017777|Ga0181357_1087862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1186 | Open in IMG/M |
3300017777|Ga0181357_1103055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1080 | Open in IMG/M |
3300017777|Ga0181357_1146631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300017777|Ga0181357_1205518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300017777|Ga0181357_1223867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300017777|Ga0181357_1226137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300017777|Ga0181357_1260025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300017777|Ga0181357_1295172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300017777|Ga0181357_1302515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300017777|Ga0181357_1314317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300017778|Ga0181349_1091355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
3300017778|Ga0181349_1122676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
3300017778|Ga0181349_1248442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300017778|Ga0181349_1290213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300017780|Ga0181346_1146117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
3300017780|Ga0181346_1292388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300017784|Ga0181348_1148454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
3300017784|Ga0181348_1179105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
3300017784|Ga0181348_1301452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300017785|Ga0181355_1161105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300017785|Ga0181355_1222617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300017785|Ga0181355_1230881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300017785|Ga0181355_1353546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300017785|Ga0181355_1376461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300019784|Ga0181359_1014594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2889 | Open in IMG/M |
3300019784|Ga0181359_1263125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300020159|Ga0211734_11195243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300020161|Ga0211726_10971273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300020172|Ga0211729_10852168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
3300020205|Ga0211731_11031254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300020527|Ga0208232_1017359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
3300020571|Ga0208723_1009348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1705 | Open in IMG/M |
3300020571|Ga0208723_1029833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300020603|Ga0194126_10441312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300021140|Ga0214168_1073774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300021519|Ga0194048_10089666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
3300021962|Ga0222713_10720503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300021963|Ga0222712_10112843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1882 | Open in IMG/M |
3300021963|Ga0222712_10666614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300021963|Ga0222712_10785932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300022179|Ga0181353_1011639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2228 | Open in IMG/M |
3300022190|Ga0181354_1069514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
3300022190|Ga0181354_1136970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300022198|Ga0196905_1010185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3122 | Open in IMG/M |
3300022198|Ga0196905_1055180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
3300022198|Ga0196905_1073102 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 942 | Open in IMG/M |
3300023174|Ga0214921_10100094 | All Organisms → Viruses → Predicted Viral | 2181 | Open in IMG/M |
3300024346|Ga0244775_10502912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 990 | Open in IMG/M |
3300024346|Ga0244775_11235566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300024350|Ga0255167_1040923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300024864|Ga0255271_1141428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300025451|Ga0208426_1023221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300025645|Ga0208643_1023407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2128 | Open in IMG/M |
3300025645|Ga0208643_1141586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300025646|Ga0208161_1077533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
3300025674|Ga0208162_1104176 | Not Available | 839 | Open in IMG/M |
3300025687|Ga0208019_1096629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
3300025687|Ga0208019_1205989 | Not Available | 511 | Open in IMG/M |
3300025840|Ga0208917_1119940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300025848|Ga0208005_1178702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300025889|Ga0208644_1013232 | Not Available | 5496 | Open in IMG/M |
3300025889|Ga0208644_1048083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Mobiluncus → Mobiluncus mulieris | 2387 | Open in IMG/M |
3300025889|Ga0208644_1052007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2263 | Open in IMG/M |
3300025896|Ga0208916_10007199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4354 | Open in IMG/M |
3300026457|Ga0255160_1037524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300026478|Ga0255156_1082497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300027133|Ga0255070_1024278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 991 | Open in IMG/M |
3300027137|Ga0255092_1017550 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
3300027365|Ga0209300_1000781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14357 | Open in IMG/M |
3300027396|Ga0255146_1023324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
3300027595|Ga0255122_1066631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300027621|Ga0208951_1184453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300027627|Ga0208942_1001447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8616 | Open in IMG/M |
3300027627|Ga0208942_1006360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3996 | Open in IMG/M |
3300027642|Ga0209135_1097229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 991 | Open in IMG/M |
3300027644|Ga0209356_1058777 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
3300027644|Ga0209356_1172339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300027679|Ga0209769_1029177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1918 | Open in IMG/M |
3300027683|Ga0209392_1102749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300027689|Ga0209551_1011492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3066 | Open in IMG/M |
3300027710|Ga0209599_10029506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1497 | Open in IMG/M |
3300027710|Ga0209599_10184074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300027721|Ga0209492_1078051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
3300027721|Ga0209492_1148820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300027732|Ga0209442_1228638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300027732|Ga0209442_1297237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300027733|Ga0209297_1020186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3177 | Open in IMG/M |
3300027733|Ga0209297_1175554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300027734|Ga0209087_1275060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300027734|Ga0209087_1332875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300027744|Ga0209355_1272718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300027754|Ga0209596_1018092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4319 | Open in IMG/M |
3300027754|Ga0209596_1290467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300027754|Ga0209596_1340452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300027759|Ga0209296_1280126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300027763|Ga0209088_10333094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300027782|Ga0209500_10015501 | All Organisms → Viruses → Predicted Viral | 4555 | Open in IMG/M |
3300027782|Ga0209500_10063811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1918 | Open in IMG/M |
3300027782|Ga0209500_10170447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
3300027785|Ga0209246_10025287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2240 | Open in IMG/M |
3300027798|Ga0209353_10166454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
3300027804|Ga0209358_10195398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
3300027808|Ga0209354_10013871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3213 | Open in IMG/M |
3300027814|Ga0209742_10246656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300027816|Ga0209990_10138545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1160 | Open in IMG/M |
3300027892|Ga0209550_10718562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300027963|Ga0209400_1098071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
3300027969|Ga0209191_1188744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
3300027973|Ga0209298_10001674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14290 | Open in IMG/M |
3300027973|Ga0209298_10256305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300027976|Ga0209702_10108911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Mobiluncus → Mobiluncus mulieris | 1288 | Open in IMG/M |
3300028025|Ga0247723_1005154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5950 | Open in IMG/M |
3300028027|Ga0247722_10280737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300028113|Ga0255234_1118781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300028394|Ga0304730_1035241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2548 | Open in IMG/M |
3300028394|Ga0304730_1083459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1435 | Open in IMG/M |
3300028394|Ga0304730_1091603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1342 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10285573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300031539|Ga0307380_10854085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300031565|Ga0307379_10542723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
3300031566|Ga0307378_10714311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300031669|Ga0307375_10783152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300031707|Ga0315291_10170385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2253 | Open in IMG/M |
3300031707|Ga0315291_10887880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300031707|Ga0315291_11287044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300031746|Ga0315293_10417823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
3300031746|Ga0315293_11074574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300031758|Ga0315907_10036783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4377 | Open in IMG/M |
3300031758|Ga0315907_10278945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1378 | Open in IMG/M |
3300031772|Ga0315288_10416114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1356 | Open in IMG/M |
3300031772|Ga0315288_10505203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1191 | Open in IMG/M |
3300031787|Ga0315900_10085353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3136 | Open in IMG/M |
3300031787|Ga0315900_10294709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1349 | Open in IMG/M |
3300031787|Ga0315900_11039212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300031787|Ga0315900_11068382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300031857|Ga0315909_10045248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4121 | Open in IMG/M |
3300031857|Ga0315909_10111991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2327 | Open in IMG/M |
3300031857|Ga0315909_10188949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1646 | Open in IMG/M |
3300031857|Ga0315909_10202299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1572 | Open in IMG/M |
3300031857|Ga0315909_10277456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1268 | Open in IMG/M |
3300031857|Ga0315909_10395286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300031857|Ga0315909_10803275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300031873|Ga0315297_10509228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1012 | Open in IMG/M |
3300031873|Ga0315297_11179866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300031951|Ga0315904_10424901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
3300031951|Ga0315904_10776934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300031952|Ga0315294_10832798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300031963|Ga0315901_10909806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
3300031997|Ga0315278_10824958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300031997|Ga0315278_11454907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300031999|Ga0315274_10590594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
3300031999|Ga0315274_11968036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300032046|Ga0315289_10429049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1301 | Open in IMG/M |
3300032046|Ga0315289_10443918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1270 | Open in IMG/M |
3300032050|Ga0315906_10016706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8268 | Open in IMG/M |
3300032050|Ga0315906_10373386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1253 | Open in IMG/M |
3300032053|Ga0315284_10626394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1279 | Open in IMG/M |
3300032053|Ga0315284_10804012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
3300032053|Ga0315284_11052436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
3300032053|Ga0315284_11462401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300032093|Ga0315902_10109185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2977 | Open in IMG/M |
3300032093|Ga0315902_10562043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 971 | Open in IMG/M |
3300032093|Ga0315902_10719373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300032093|Ga0315902_11299112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300032118|Ga0315277_11105517 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
3300032118|Ga0315277_11152489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300032118|Ga0315277_11198842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300032118|Ga0315277_11219459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300032173|Ga0315268_10563757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
3300032177|Ga0315276_11927651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300032256|Ga0315271_10677722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
3300032342|Ga0315286_10796512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
3300032342|Ga0315286_11841652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300032397|Ga0315287_10633097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1266 | Open in IMG/M |
3300032401|Ga0315275_10323225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1728 | Open in IMG/M |
3300032516|Ga0315273_12014452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300032516|Ga0315273_13025847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300033233|Ga0334722_11000607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300033981|Ga0334982_0021008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3801 | Open in IMG/M |
3300033993|Ga0334994_0202476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1073 | Open in IMG/M |
3300033993|Ga0334994_0276527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300033993|Ga0334994_0389688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300033996|Ga0334979_0095198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1862 | Open in IMG/M |
3300034012|Ga0334986_0413078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
3300034050|Ga0335023_0009370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5735 | Open in IMG/M |
3300034061|Ga0334987_0027847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4977 | Open in IMG/M |
3300034061|Ga0334987_0048496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3544 | Open in IMG/M |
3300034061|Ga0334987_0592825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300034061|Ga0334987_0696094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300034064|Ga0335001_0343191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300034066|Ga0335019_0001657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14552 | Open in IMG/M |
3300034066|Ga0335019_0767623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300034073|Ga0310130_0081762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300034082|Ga0335020_0586929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300034092|Ga0335010_0350875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300034092|Ga0335010_0593331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300034101|Ga0335027_0054314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3222 | Open in IMG/M |
3300034101|Ga0335027_0063909 | All Organisms → Viruses → Predicted Viral | 2919 | Open in IMG/M |
3300034101|Ga0335027_0188524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1476 | Open in IMG/M |
3300034101|Ga0335027_0449646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300034101|Ga0335027_0472215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300034102|Ga0335029_0461073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300034103|Ga0335030_0519974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
3300034104|Ga0335031_0163665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1530 | Open in IMG/M |
3300034104|Ga0335031_0284848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
3300034104|Ga0335031_0311914 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
3300034105|Ga0335035_0055406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2606 | Open in IMG/M |
3300034105|Ga0335035_0222017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1152 | Open in IMG/M |
3300034106|Ga0335036_0387769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300034106|Ga0335036_0562867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300034106|Ga0335036_0770091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300034110|Ga0335055_0046187 | All Organisms → Viruses → Predicted Viral | 2023 | Open in IMG/M |
3300034118|Ga0335053_0406324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300034119|Ga0335054_0783033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300034120|Ga0335056_0207987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1125 | Open in IMG/M |
3300034121|Ga0335058_0299993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
3300034121|Ga0335058_0619627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300034166|Ga0335016_0277583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
3300034167|Ga0335017_0128942 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
3300034167|Ga0335017_0439260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300034167|Ga0335017_0448362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300034168|Ga0335061_0204467 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
3300034200|Ga0335065_0173464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1423 | Open in IMG/M |
3300034272|Ga0335049_0228979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1290 | Open in IMG/M |
3300034272|Ga0335049_0528979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300034279|Ga0335052_0041138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2869 | Open in IMG/M |
3300034283|Ga0335007_0535998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300034284|Ga0335013_0159863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1525 | Open in IMG/M |
3300034355|Ga0335039_0114758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1551 | Open in IMG/M |
3300034356|Ga0335048_0313574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.08% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.69% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.35% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.16% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.36% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.56% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.33% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.10% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.10% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.86% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.40% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.17% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.93% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.93% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.93% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.70% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.47% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.47% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.47% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.23% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.23% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.23% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.23% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.23% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.23% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.23% |
Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.23% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.23% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.23% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.23% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.23% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.23% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.23% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.23% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.23% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001523 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007319 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009532 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, Depth 3m; RNA IDBA-UD | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012266 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
3300024864 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
3300027137 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027814 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-3-8_10 (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
3300028113 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034167 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1221J15618_10116501 | 3300001523 | Hypersaline | RDGRIWHPKSYPVGSLNRTLVELAIATQIPMSEWQTAEQIMTAIEILEKRNGK* |
Draft_101154303 | 3300001605 | Hydrocarbon Resource Environments | ASGSLGRLIVELAIATQIPMQYWETAEDILTALEILKERSGR* |
GOS2236_10145234 | 3300001968 | Marine | NHLILEVALATGIPAQFWDNAEDLMTAVEILKERNGRGRA* |
metazooDRAFT_12571082 | 3300002202 | Lake | EAVSPKSWAVGSLNRILIEVAIATSIPMSEWKTEEDLLTAIEILERQNGR* |
B570J29584_10002051 | 3300002294 | Freshwater | PAGSLNRLLVELALATQIPMSEWVDSDDILTAIEVLEQRYGK* |
B570J29584_10069442 | 3300002294 | Freshwater | KPKSHKAGSLNRLLVELAIATKIPMSEWVEAEDILTAIEILEKRNGS* |
B570J29587_10119102 | 3300002296 | Freshwater | PKSHQVGSLNRLLVQLAIATHIPMSEWVDGEDVLTAIEILEERHGS* |
B570J29032_1097135573 | 3300002408 | Freshwater | PKSHPVGSLSRLLVQLSMATQIPMSEWVDGSDILTALEILEDRHKK* |
JGI25907J50239_10671223 | 3300003394 | Freshwater Lake | PKSFQRGSINRLLIELAIATSIPMSEWESAEQILTAVEILKERKNDN* |
Ga0066179_100309891 | 3300004126 | Freshwater Lake | CRPKSHPAGSLSRLLVELAIATKIPMSEWVEADDIMTAIEVLEARHGS* |
Ga0007787_101102063 | 3300004240 | Freshwater Lake | KSYPAGSINRTLIELSIATGIPMSEWQTAEDILTAIEILEKRNRG* |
Ga0070374_106138981 | 3300005517 | Freshwater Lake | LVELAIATQIPMSEWVDAEDILTAIEILEARHGK* |
Ga0068872_102399301 | 3300005528 | Freshwater Lake | GSVSRLLVELAIATQIPMDKWQSAEDILTAIEVLEERNRGK* |
Ga0049083_102981822 | 3300005580 | Freshwater Lentic | LIELAIATSIPMSEWESAEQILTAVEILKERKNGN* |
Ga0049081_102886691 | 3300005581 | Freshwater Lentic | RPKSHKAGSLNRLLVELAIATHIPMSEWVDADDILTAIEILEARNGN* |
Ga0049085_100046863 | 3300005583 | Freshwater Lentic | MNRILVELAIATGIPMQYWKDGESILTAIEILEKRNGK* |
Ga0049082_100007305 | 3300005584 | Freshwater Lentic | VIDLAIATSIPMNEWQTAEQILTAMEILEKRNGS* |
Ga0049082_103337392 | 3300005584 | Freshwater Lentic | LVELAIATKIPMSEWVEAEDILTAIEVLEARYGK* |
Ga0049084_100219603 | 3300005585 | Freshwater Lentic | MNRILVELAIATGIPMEYWKDGESILTAIEILEKRNGK* |
Ga0078894_103342671 | 3300005662 | Freshwater Lake | SVSRLLIELAIATHIPMDQWQTAEDILTAVEILEQRNGK* |
Ga0078894_108366293 | 3300005662 | Freshwater Lake | LVELAIATQIPMSEWVDAEDILTAIEVLEARYGK* |
Ga0074469_108973112 | 3300005832 | Sediment (Intertidal) | SLNRIIVEVAIATQIPMSEWQTAEDLLTAIEILERQNGR* |
Ga0075470_101812302 | 3300006030 | Aqueous | SHPVGSLSRLLIELAIATGIPHQYWDNAEDVITALEILEKRSE* |
Ga0070749_100571324 | 3300006802 | Aqueous | TLVELAIETGIPMQYWDDADDIATAAEILEMKNGRGEHRL* |
Ga0070749_101735172 | 3300006802 | Aqueous | LVELAIATKIPMSEWVDAEDILTAIEVLEARYGK* |
Ga0070749_102063123 | 3300006802 | Aqueous | PKSHKRGSLGRLLVELAIATKIPMQYWTEADDILTAIEILEQQNDR* |
Ga0070749_102458891 | 3300006802 | Aqueous | RRPKSHKSGSISRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGGT* |
Ga0070749_102840301 | 3300006802 | Aqueous | GSISRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGG* |
Ga0070749_103528373 | 3300006802 | Aqueous | PKSHPVGSVSRLIIELAIATKIPPSEWTDAQDILTALEILERNSGQ* |
Ga0070749_107969451 | 3300006802 | Aqueous | HPAGSLSRLLVELAIATQIPMSEWVDSDDILTAIEVLEQRYGK* |
Ga0075464_104579471 | 3300006805 | Aqueous | RYSIRGSRKPKSYAVGSLNRVLVELALATGIPMKEWETAEQIYTAIEILEKRNGK* |
Ga0075464_104878222 | 3300006805 | Aqueous | LVELAIATQIPMSEWVEAEDILTAIEILERRNGN* |
Ga0075464_106070892 | 3300006805 | Aqueous | SYAAGSVSRTLIELAIATGIPMSEWETAEAILTAIEILEKRNGK* |
Ga0075464_107049641 | 3300006805 | Aqueous | RILVEVAIATGIPMSEWTTAEQIYTAFEILEKQNGV* |
Ga0075464_108829612 | 3300006805 | Aqueous | VNRILVELAIATGIPMSEWVTAEQIYTAKEILEERQ* |
Ga0075475_101632841 | 3300006874 | Aqueous | HKSGSISRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGGT* |
Ga0075473_100135774 | 3300006875 | Aqueous | YPAGSLNRIIVELAIATGIPMSEWIEAEQILTAIEVLEKRNGN* |
Ga0075473_101556233 | 3300006875 | Aqueous | GGSVGRLIVELAIATGIPMSEWTSAEDIMTAIEVLEKRNGTRRNQL* |
Ga0075473_101880191 | 3300006875 | Aqueous | KSHPVGSVSRLIIELAIATKIPPSEWTDAQDILTALEILERQNG* |
Ga0070746_105466871 | 3300006919 | Aqueous | SLGRLIVELAIATKIPMEHWRNAEDILTALEILEKQNGK* |
Ga0070748_10776421 | 3300006920 | Aqueous | NRILVELAIATGIPMSEWTTAEQIYTAFEILEKQNGV* |
Ga0070748_12359832 | 3300006920 | Aqueous | MNRILGELAIATGIPMEYWKDGESILTAIEILEKRNGK* |
Ga0079300_101458461 | 3300007162 | Deep Subsurface | PKSHKAGSLNRLLVELAIATKIPMSEWVDADDILTAIEVLEARSGK* |
Ga0075460_100340203 | 3300007234 | Aqueous | GSISRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGGT* |
Ga0075460_101428033 | 3300007234 | Aqueous | KSHKRGSLGRLLVELAIATKIPMQYWTEADDILTAIEILEKQNDR* |
Ga0102691_10318941 | 3300007319 | Freshwater Lake | RPKSHPTGSLSRLIVELAIATRIPMSEWTDASDILTALEVLKERNGSR* |
Ga0075458_101213541 | 3300007363 | Aqueous | KSHPVGSVSRLIIELAIATKIPPSEWTDAQDILTALEILERNSGQ* |
Ga0105050_105324301 | 3300007516 | Freshwater | PKSHERGSLSRLLVELSMATRIPMSEWTNAEDILTALEILEAQNGR* |
Ga0099851_10531563 | 3300007538 | Aqueous | LLVELAIATGIPVQYWDDADDIVTALEILEKRNGG* |
Ga0099851_11248671 | 3300007538 | Aqueous | SLSRLLIELAIATGIPHQYWDNAEDVITALEILEKNNGT* |
Ga0099851_11921571 | 3300007538 | Aqueous | GGRSRPKSHRRGSLGRVLVELAIATKIPMQYWTDADDIVTALEILEQQNGR* |
Ga0099847_10679041 | 3300007540 | Aqueous | HPVGSLSRLLIELAIATGIPHQYWDNAEDVITALEILEKNNGT* |
Ga0099847_11745841 | 3300007540 | Aqueous | HKRGSLGRLIVELAIATKIPMEYWRNADDILTALEILEKQNGK* |
Ga0099848_10687721 | 3300007541 | Aqueous | SLSRLLIELAIATGIPAQYWDNAEDVITALEILEKRNGQGGI* |
Ga0099848_11187731 | 3300007541 | Aqueous | SHPVGSLSRLLIELAIATGIPHQYWDNAEDVITALEILEKNNGT* |
Ga0099848_11683093 | 3300007541 | Aqueous | ERGSLNRLIVELAIATQIPMPYWDNAEDILTALEILKERSGG* |
Ga0099846_11317601 | 3300007542 | Aqueous | KSHPVGSLSRLLIELAIATGIPHQYWDNAEDVITALEILEKNNGT* |
Ga0099846_12023013 | 3300007542 | Aqueous | LIVELAIATKIPMEHWRTAEDILTALEILEQQNGK* |
Ga0099846_12189401 | 3300007542 | Aqueous | KSHPVGSLSRLLIELAIATGIPHQYWDNAEDVITALEILEKRSE* |
Ga0099846_13464071 | 3300007542 | Aqueous | KEGSLNRLLVELAIATHIPMSVWVDAEDILTAIVILEKRNGK* |
Ga0070751_13911682 | 3300007640 | Aqueous | RPKSHKRGSLGRVLVELAIATKIPMQYWTDADDIVTALEILEQQNGR* |
Ga0105051_108165981 | 3300007722 | Freshwater | GSLSRLLVELSMATRIPMSEWTNAEDILTALEILEAQNGR* |
Ga0099850_11822453 | 3300007960 | Aqueous | LSRLLIELAIATGIPHQYWDNAEDVITALEILEKNNGT* |
Ga0105747_10438381 | 3300007974 | Estuary Water | LLVELAIATNIPMSEWVDADDILTAIEVLEARYGK* |
Ga0108970_108878193 | 3300008055 | Estuary | LIVELAIATQIPMVHWQTAEDILTAVEILEARTK* |
Ga0114347_10115301 | 3300008114 | Freshwater, Plankton | CEPKSHPVGSLSRLLVQLSIATQIPMSEWVDGSDVLTALEILEDRHK* |
Ga0114347_11782011 | 3300008114 | Freshwater, Plankton | LNRLLVELAIATKIPMSEWVDADDILTAIEILEARNG* |
Ga0114351_11028243 | 3300008117 | Freshwater, Plankton | SRLLVQLSIATQIPMSEWVDGSDVLTALEILEDRHK* |
Ga0114841_100118823 | 3300008259 | Freshwater, Plankton | LVELAIATQIPMREWVEAEDILTAIEVLEARHGK* |
Ga0114363_10121521 | 3300008266 | Freshwater, Plankton | CKPKSHPVGSLSRLLVQLSIATQIPMSEWVDGSDVLTALEILEDRHKK* |
Ga0114363_10152931 | 3300008266 | Freshwater, Plankton | RGNSDKPHPSGSLSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGRR* |
Ga0114363_10249571 | 3300008266 | Freshwater, Plankton | SLSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGGR* |
Ga0114363_10316341 | 3300008266 | Freshwater, Plankton | PHPSGSLSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGGR* |
Ga0114363_10912644 | 3300008266 | Freshwater, Plankton | MGRALVILALATNIPMQYWESAEDILTALEILEKRNNG* |
Ga0114363_11125341 | 3300008266 | Freshwater, Plankton | SLSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGRR* |
Ga0114363_11991162 | 3300008266 | Freshwater, Plankton | GRLIVELAIATKIPMQYWDNAEDILTALEILKERNG* |
Ga0114363_12103481 | 3300008266 | Freshwater, Plankton | RGNSDKPHPSGSLSRLIVELAIATQIPMQYWDTAEDIATALEIIKERNGRR* |
Ga0114363_12106451 | 3300008266 | Freshwater, Plankton | GGSVGRLIVELAIATGIPMSEWTSAEDIMTAIEVLEKRNGTRGNQL* |
Ga0114363_12155632 | 3300008266 | Freshwater, Plankton | VELALATQIPMDHWQSAEDILTAIEVLEERNRGR* |
Ga0114363_12363972 | 3300008266 | Freshwater, Plankton | AGSLNRLLVELAIATHIPMSEWVDGEDILTAIEILEKRNGN* |
Ga0114363_12370862 | 3300008266 | Freshwater, Plankton | PKSWPVGSLNRALIELAIASRIPMSEWKTAEDVLTGIEILERQNGR* |
Ga0114364_10937473 | 3300008267 | Freshwater, Plankton | GSLNRIIVEVAIATQIPMSEWQTAEDLLTAIEILERQNGR* |
Ga0114876_11305203 | 3300008448 | Freshwater Lake | SRIVVELAIATKIPMSEWTTAEQILTAFEILEQQHGG* |
Ga0114876_12068731 | 3300008448 | Freshwater Lake | PKSHPRGSVSRLLVELAIATQIPMDHWRSAEDILTAIEILEQRNGK* |
Ga0114880_10438553 | 3300008450 | Freshwater Lake | RPKSHPRGSVSRLLVELAIATQIPMDKWQSAEDILTAIEVLEERNRGK* |
Ga0114880_10605691 | 3300008450 | Freshwater Lake | VELAIATQIPMSEWTTAEQIMTAIEILEKKHGQGR* |
Ga0114880_10726473 | 3300008450 | Freshwater Lake | KSHPRGSVSRLLVDLAIATQIPMSEWQTAEDILTAIEILEERNNRG* |
Ga0114880_11659971 | 3300008450 | Freshwater Lake | LIVELAIATQIPMSEWTDAEDILTALEVLKERNK* |
Ga0114880_11954932 | 3300008450 | Freshwater Lake | VGSLSRLLVQLSIATQIPMSEWVDGSDVLTALEILEDRYKK* |
Ga0114880_12007801 | 3300008450 | Freshwater Lake | VGSLSRLLVQLSIATQIPMSEWVDGSDVLTALEILEDRHKK* |
Ga0114880_12220212 | 3300008450 | Freshwater Lake | RLLVELAIATHIPMSEWVDADDILTAIEVLEARNGS* |
Ga0114865_10856113 | 3300008459 | Freshwater Lake | LVELAIATQIPMSEWVDAEDILTAIEILEERHGK* |
Ga0114973_100748772 | 3300009068 | Freshwater Lake | LVELAIATQIPMSEWVDAEDILTAIEILEQRYGG* |
Ga0114973_103147493 | 3300009068 | Freshwater Lake | LVELAIATKIPMSEWVDASDILTAIEVLEARYGK* |
Ga0105098_103816613 | 3300009081 | Freshwater Sediment | LAIATGIPMSEWREAEDILTAFEILKERNESGRG* |
Ga0105099_104325653 | 3300009082 | Freshwater Sediment | REPKSYAVGSLNRLLVELAIATNIPMSEWHTAEQIVTAIEILEKRNGR* |
Ga0102851_101394304 | 3300009091 | Freshwater Wetlands | SRLLIELAIATGIPMSEWNDASDILTAIEVLEERNGK* |
Ga0115026_106286892 | 3300009111 | Wetland | LVELAIATHIPMSEWVDAEDILTAIEVLEARYGK* |
Ga0114980_1000528511 | 3300009152 | Freshwater Lake | MNRILVELAIATGIPMSEWVTAEQVITAIEVLEKRNGR* |
Ga0114980_103739703 | 3300009152 | Freshwater Lake | LVELAIATQIPMSEWVDADDILTAIEVLEARYGK* |
Ga0114968_101049333 | 3300009155 | Freshwater Lake | LIELAIATSIPMSEWESAEQILTAVEILKERSNG* |
Ga0114977_100323624 | 3300009158 | Freshwater Lake | MLVELAIATHIPMSEWVDADDILTAIEVLEARSGK* |
Ga0114977_100543342 | 3300009158 | Freshwater Lake | LVELAIATQIPMSEWVEAEDILTAIEVLEARYGK* |
Ga0114977_103212651 | 3300009158 | Freshwater Lake | GSLSRLLVELAIATQIPMSEWVDGEDVLTAIEILEERNGN* |
Ga0114977_104682352 | 3300009158 | Freshwater Lake | SLNRVLVELALATGIPMKEWETAEQIYTAIEILEKRNGK* |
Ga0114977_106829091 | 3300009158 | Freshwater Lake | SRLLVELAIPTQIPMREWVDAEAILSAIEALEVRYDK* |
Ga0114978_101269331 | 3300009159 | Freshwater Lake | LSRLLVELAIATQIPMSEWVDGEDVLTAIEILEERYGK* |
Ga0114978_102054721 | 3300009159 | Freshwater Lake | LSRLLVELAIATQIPMSEWVDGEDVLTAIEILEERNGN* |
Ga0114978_103311752 | 3300009159 | Freshwater Lake | LVELAIATQIPMSQWVEAEDILTAIEILEARYGK* |
Ga0114978_103978903 | 3300009159 | Freshwater Lake | PVGSLNRLLVQLAIATQIPMSEWVDGEDILTALEILEERYGK* |
Ga0114978_104185571 | 3300009159 | Freshwater Lake | RLLVELAIATNIPMSEWVDADDILTAIEVLEARYGK* |
Ga0114978_105029761 | 3300009159 | Freshwater Lake | LVEVAIATGIPMREWTTADDILTAIEILEKRNGV* |
Ga0114981_101921563 | 3300009160 | Freshwater Lake | PKSHPAGSLSRLLVELAIATKIPMSEWVDADDILTAIEVLEARYGK* |
Ga0114966_100792841 | 3300009161 | Freshwater Lake | NRLLVELALATHIPMSDWVDADDIFTAIEVLEARNGS* |
Ga0114966_103652482 | 3300009161 | Freshwater Lake | LVELAIATQIPMSEWVDAADILTAIEVLEARYGK* |
Ga0114966_106163671 | 3300009161 | Freshwater Lake | SISRTLVELAIVTGIPMREWETAEAILTAIEILEKRNGK* |
Ga0114970_100324655 | 3300009163 | Freshwater Lake | LVQLAIATQIPMSEWVDGEDVLTAIEILEERYGK* |
Ga0114970_101616723 | 3300009163 | Freshwater Lake | GSINYLLIELAIATSIPMSEWESAEQILTAVEILKERSNG* |
Ga0114970_102028241 | 3300009163 | Freshwater Lake | ILVDLALATGIPMQYWETAEDVLTAIEILEAKNDR* |
Ga0114970_105473091 | 3300009163 | Freshwater Lake | YLLVELAIATSIPMSEWESAEQILTAVEILEKRNAK* |
Ga0114970_105955541 | 3300009163 | Freshwater Lake | INYLLIELAIATSIPMSEWESAEQILTAVEILEKRNAK* |
Ga0105102_104506671 | 3300009165 | Freshwater Sediment | RLLVELAIATQIPMSEWVEAEDILTAIEILERRNGK* |
Ga0105104_108246881 | 3300009168 | Freshwater Sediment | AGSLSRLLVELAIATQIPMSEWVDSDDILTAIEVLEKRNGS* |
Ga0105097_105604222 | 3300009169 | Freshwater Sediment | KPKSHPAGSLNRLLVELAIATQIPMSEWVDADDILTAIEVLEKRNGS* |
Ga0114979_101445373 | 3300009180 | Freshwater Lake | LVELAIATNIPMSEWVDADDILTAIEVLEARYGK* |
Ga0114979_106384462 | 3300009180 | Freshwater Lake | GRYPIRGSGQPKSYAAGSLNRVLVELALATGIPMKEWETAEQIYTAIEILEKRNGK* |
Ga0114969_100303661 | 3300009181 | Freshwater Lake | SRERRPKSYAVGSLSRIVVELALATNIPMSEWTTAEQILTAMEILEKRNGR* |
Ga0114969_100730481 | 3300009181 | Freshwater Lake | SINYLLVELAIATSIPMSEWESAEQILTAVEILEKRNAK* |
Ga0114969_104041543 | 3300009181 | Freshwater Lake | RLLVELAIATQIPMSEWVDAEDILTAIEILEQRYGG* |
Ga0114969_105348891 | 3300009181 | Freshwater Lake | PKSHQRGSINRLIVELAIATQIPMSEWRSAEDILTALEILEKRNG* |
Ga0114969_105689371 | 3300009181 | Freshwater Lake | RIVVELAIATKIPMSEWTTAEQILTAFEILEQQHGG* |
Ga0114969_105980412 | 3300009181 | Freshwater Lake | RGTPKSYQRGSLSRLLVELAIATQIPMSQWQTAEEVLTALEILESKRGK* |
Ga0114974_100975293 | 3300009183 | Freshwater Lake | RLLVQLAIATQIPMSEWVDGEDILTAIEILEERNGN* |
Ga0114974_106061111 | 3300009183 | Freshwater Lake | RVLVELAIATGIPMKEWETAEQIYTAIEILEKRNGNKGR* |
Ga0114974_106490001 | 3300009183 | Freshwater Lake | AGSLSRLLVELAIATNIPMSEWVDADDILTAIEVLEARYGK* |
Ga0114976_101765771 | 3300009184 | Freshwater Lake | KSHPAGSLSRLLVELAIATQIPMSEWVDGEDVLTAIEILEERNGN* |
Ga0114976_103472133 | 3300009184 | Freshwater Lake | EPGSISRLLIEVAIATGIAMSEWQSAEDILTALEVLKERNGN* |
Ga0114976_106310932 | 3300009184 | Freshwater Lake | LVELAIATKIPMSEWVDASDILTAIEVLEERRGK* |
Ga0114976_106426321 | 3300009184 | Freshwater Lake | KSHPAGSLSRLLVELAIATQIPMSEWVDGEDVLTAIEILEERYGK* |
Ga0114983_10006598 | 3300009194 | Deep Subsurface | VELAIATQIPMSEWQTAEQIMTAIEILEKKYGSQGR* |
Ga0114982_10989423 | 3300009419 | Deep Subsurface | VSRLIVELAIATQIPMVHWQTAEDILTAVEILEARTK* |
Ga0127391_10680791 | 3300009450 | Meromictic Pond | IVELAIATKIPMDYWRNADDILTALEKLEKQNGK* |
Ga0127391_10833322 | 3300009450 | Meromictic Pond | LIVELAIATQIPMREWETAEDILTAIEVLKERNEPGRG* |
Ga0127401_11499552 | 3300009469 | Meromictic Pond | RGSINRLIVELAIATQIPMREWETAEDILTAIEVLKERNEPGRG* |
Ga0126447_10456003 | 3300009470 | Meromictic Pond | RLLIELAIATGIPHQYWDNAEDVITALEILEKNNGT* |
Ga0129360_10100162 | 3300009532 | Meromictic Pond | KSHKRGSINRLIVELAIATQIPMREWETAEDILTAIEVLKERNEPGRG* |
Ga0114967_103271952 | 3300010160 | Freshwater Lake | LVELAIATQIPMSEWVDGEDVLTAIEILEERYGK* |
Ga0114967_106343102 | 3300010160 | Freshwater Lake | RGSLSYLIVELSIATGIPMSEWVDAADILTALEILEKRNGGK* |
Ga0129333_101987824 | 3300010354 | Freshwater To Marine Saline Gradient | LVELAIATHIPMSEWVDADDILTAIEILERRNGN* |
Ga0129333_103512493 | 3300010354 | Freshwater To Marine Saline Gradient | SRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGG* |
Ga0129333_110240781 | 3300010354 | Freshwater To Marine Saline Gradient | SISRLIIELAVATGIPMSEWQTWEDLLTGIEVLKEQNGGAGSKRL* |
Ga0129333_114611321 | 3300010354 | Freshwater To Marine Saline Gradient | KSYPAGSLNRLLIELAIATGIPVQYWENAEDLLTAIEVLEKRNGRH* |
Ga0129336_104012821 | 3300010370 | Freshwater To Marine Saline Gradient | VGSVSRLLVELAIATKIPMKYWDDGEDVLTAIEILKEQNGNV* |
Ga0133913_1013241813 | 3300010885 | Freshwater Lake | LVELAIATHIPMSEWETAEQILTAVEILEQQNGN* |
Ga0133913_101819079 | 3300010885 | Freshwater Lake | GSLNRVLVELALATGIPMKEWETAEQIYTAIEILEKRNGNKGR* |
Ga0133913_109452432 | 3300010885 | Freshwater Lake | VNRILVELAIATGIPMSEWITAEQIYTAKEILEARE* |
Ga0133913_110462251 | 3300010885 | Freshwater Lake | RLLVELAIATQIPMSEWVEAEDILTAIEILEKRNGK* |
Ga0133913_113626511 | 3300010885 | Freshwater Lake | EAGSLSRLLVELAIATKIPMSEWVEPEDILTAIEILKERK* |
Ga0151515_106688 | 3300011114 | Freshwater | LVELAIATKIPMSEWVDASDILTAIEVLEERYGK* |
Ga0151516_1064012 | 3300011116 | Freshwater | LVELAIATQIPMSEWVEAEDILTAIEILEARHGK* |
Ga0153805_10024421 | 3300012013 | Surface Ice | GSVSRLIVELAIATGIPMPYWQSAEDILTAIEILEKNGEHKKSR* |
Ga0153801_10052883 | 3300012017 | Freshwater | LIELAIATSIPMSEWESAEQILTAVEILKERKNDN* |
Ga0153801_11000081 | 3300012017 | Freshwater | GSVSRLIVELAIATGIPMSEWQSAEDILTAIEILEKNGEHEKSR* |
Ga0136712_10419401 | 3300012266 | Freshwater | SLNRLLVELAIATKIPMSEWVDADDILTAIEILEARNG* |
Ga0157498_10035114 | 3300012666 | Freshwater, Surface Ice | SHPAGSLSRLLVELAIATQIPMSEWVDSDDILTAIEVLEQRYGK* |
Ga0157498_10178411 | 3300012666 | Freshwater, Surface Ice | KSHPVGSISRLLVELAIATQIPMREWVEAEDVLTALDILKERSNGR* |
Ga0157630_12709252 | 3300012722 | Freshwater | LVQLAIATQIPMSEWVDADDILTAIEILEERHGK* |
Ga0157624_11769182 | 3300012764 | Freshwater | GSFSRLLVQLTIATQLTVSEWTNADDILTAIEILEGDNK* |
Ga0164293_103325651 | 3300013004 | Freshwater | KPKSHKAGSLNRLLVELAIATKIPMSEWVDADDILTAIEVLEARNGS* |
Ga0164293_103886723 | 3300013004 | Freshwater | LVELAIATKIPMSEWVDAEDILTAIEVLEAKYGK* |
Ga0164293_103931271 | 3300013004 | Freshwater | HPEGSVSRLLIAVAIATQIPMSEWTDAEDLLTAVEILKERGNG* |
Ga0164293_103999581 | 3300013004 | Freshwater | SVSRLLIAVAIATQIPMSEWTSAEDLLTAVEILKERG* |
Ga0164293_105348873 | 3300013004 | Freshwater | PKSYAVGSLNRIIVELAIATQIPMSEWTTAEQILTALEILERQNERQR* |
Ga0164292_100941863 | 3300013005 | Freshwater | SVSRLLVELSIATQIPMSEWTDAQDIITALEILEKRNGRS* |
Ga0164292_101250604 | 3300013005 | Freshwater | RPKSHKAGSLNRLLVELAIATHIPMSEWVDADDILTAIEVLEARNGS* |
(restricted) Ga0172373_107191981 | 3300013131 | Freshwater | SLSRLLVQLALATQIPMSEWVEADDIYTAIEILEQRNGK* |
Ga0177922_101850052 | 3300013372 | Freshwater | RLLVELAIATQIPMSEWVDSDDILTAIEVLEQRYGK* |
Ga0177922_112279331 | 3300013372 | Freshwater | IGRLLVEVAVATGIPMSEWQSAEDLLTAVEILERRNDDR* |
Ga0119960_10335551 | 3300014811 | Aquatic | VSQSRSRSINYLLVELAIATSIPMSEWESAEQILTAVEILEKRNAK* |
Ga0181350_11415161 | 3300017716 | Freshwater Lake | AGSLNRLLVELAIATHIPMSEWVDADDILTAIEILEARNGN |
Ga0181350_11451071 | 3300017716 | Freshwater Lake | KSHKAGSLNRLLVELAIATQIPMSEWVDAEDILTAIEILEARHGR |
Ga0181350_11464221 | 3300017716 | Freshwater Lake | GSLSRIVVELAIATKIPMSEWTTAEQILTAFEILEQQHGG |
Ga0181347_11557551 | 3300017722 | Freshwater Lake | PAGSLSRLLVELAIATKIPMSEWVDADDILTAIEVLEARHGS |
Ga0181362_10574433 | 3300017723 | Freshwater Lake | LSRLLVELAIATQIPMNEWVDADDILTAIEVLEARYGK |
Ga0181365_10105601 | 3300017736 | Freshwater Lake | SYSRGSLSYLIVELSIATGIPMSEWVDAADIMTALEIMEKRNGRK |
Ga0181365_10639241 | 3300017736 | Freshwater Lake | PAGSLNRLLVELALATQIPMSEWVDADDIYTAIEVLEARNGS |
Ga0181365_11686651 | 3300017736 | Freshwater Lake | LLVELAIATSIPMSEWESAEQILTAVEILKERNNGN |
Ga0181344_10235833 | 3300017754 | Freshwater Lake | PKSHPVGSLSRLLVQLSIATQIPMSEWVDGSDVLTALEILEDRHK |
Ga0181344_10964071 | 3300017754 | Freshwater Lake | NRLLVELAIATKIPMSEWVDAEDILTAIEVLEARHGS |
Ga0181344_11257921 | 3300017754 | Freshwater Lake | RPKSYPVGSINRTLIELSVATGIPMSEWQTAEDILTAIEILEKRNRG |
Ga0181344_11422011 | 3300017754 | Freshwater Lake | SHKAGSLNRLLVELAIATHIPMSEWVDADDILTAIEILERRNGN |
Ga0181356_10738491 | 3300017761 | Freshwater Lake | RLLVELAIATQIPMSEWVDADDILTALEVLEARYGK |
Ga0181356_11858611 | 3300017761 | Freshwater Lake | KAGSLNRLLVELAIATQIPMSEWVDAEDILTAIEVLEARYGK |
Ga0181358_12219121 | 3300017774 | Freshwater Lake | AGSLSRLLVELAIATNIPMSEWVDADDILTAIEVLEARYGN |
Ga0181357_10047461 | 3300017777 | Freshwater Lake | RHTAGSLGRVIVELAIATGIPMSEWRTAEDILTAIEVLEKRNERRNRV |
Ga0181357_10126105 | 3300017777 | Freshwater Lake | SRGSLSYLIVELSIATGIPMSEWVDAADIMTALEVLEKRNGRK |
Ga0181357_10199211 | 3300017777 | Freshwater Lake | SHKAGSLNRLLVELAIATQIPMSEWVDAEDILTAIEILEARYGK |
Ga0181357_10878621 | 3300017777 | Freshwater Lake | LIELAIATSIPMSEWESAEQILTAVEILKERKNDN |
Ga0181357_11030551 | 3300017777 | Freshwater Lake | PKSHKAGSLNRLLVELAIATHIPMSEWVDADDILTAIEILEKRNGK |
Ga0181357_11466311 | 3300017777 | Freshwater Lake | SRGSLSYLIVELSIATGIPMSEWVDAADIMTALEVLEKRNGGK |
Ga0181357_12055181 | 3300017777 | Freshwater Lake | NRLIVELAIATQIPMSEWSSAEDILTALEILEKRNGGH |
Ga0181357_12238672 | 3300017777 | Freshwater Lake | PKSHKAGSLNRLLVELAIATHIPMSEWVDADDILTAIEILEARNGN |
Ga0181357_12261371 | 3300017777 | Freshwater Lake | NSHKAASLNRLLVELAIATHIPMSEWVDADDILTAIEVLEARNGK |
Ga0181357_12600252 | 3300017777 | Freshwater Lake | HKRGSIGRLLVEVAIATGIPMREWESAEDLLTAIEILEKRNG |
Ga0181357_12951721 | 3300017777 | Freshwater Lake | RGSINRLLVELAIATSIPMKEWETAEQILTAAEILKERNHGN |
Ga0181357_13025151 | 3300017777 | Freshwater Lake | SHPAGSLNRLLVQLAIATQIPMSEWVDADDIYTAIEILEQRNGK |
Ga0181357_13143172 | 3300017777 | Freshwater Lake | IGRLLVEVAIATGIPMSEWQNAEDLLTAVEILERRNDVG |
Ga0181349_10913551 | 3300017778 | Freshwater Lake | NRLLVELAIATHIPMSEWVDADDILTAIEILEARNGN |
Ga0181349_11226761 | 3300017778 | Freshwater Lake | RLLVELAIATSIPMREWESAEQILTAVEILEEQNGK |
Ga0181349_12484421 | 3300017778 | Freshwater Lake | NRLLIELAIATSIPMSEWESAEQILTAVEILKERKNGN |
Ga0181349_12902131 | 3300017778 | Freshwater Lake | NRSIVELAIATQIPMSEWQSAEDILTAIEILEKRNGV |
Ga0181346_11461171 | 3300017780 | Freshwater Lake | SRGSLSYLIVELSIATGIPMSEWVDAADILAALEIMEKRNGRK |
Ga0181346_12923881 | 3300017780 | Freshwater Lake | SHKRGSLNRLIVELAIATQIPMSEWQSAEDILTAIEILEKRNGV |
Ga0181348_11484543 | 3300017784 | Freshwater Lake | YSRGSLSYLIVELSIATGIPMSEWVDAADIMTALEVLEKRNGGK |
Ga0181348_11791053 | 3300017784 | Freshwater Lake | SINYLLIELAIATSIPMNEWESAEQILTAVEILKERSNG |
Ga0181348_13014522 | 3300017784 | Freshwater Lake | RLLVELALATHIPISEWVDADDIYTAIEVLEARYGK |
Ga0181355_11611053 | 3300017785 | Freshwater Lake | SRLLVELAIATQIPMDHWQSAEDILTAIEILEQRNGK |
Ga0181355_12226173 | 3300017785 | Freshwater Lake | RCGPKSHPRGSVSRLLVELAIATHIPMDKWETAEDILTAIEILEERHGK |
Ga0181355_12308811 | 3300017785 | Freshwater Lake | PKSHAAGSLNRLLVELALATHIPMSEWVDADDIYTAIEVLEARYGK |
Ga0181355_13535462 | 3300017785 | Freshwater Lake | KPKSFQRGSINRLLIELAIATSIPMSEWESAEQILTAVEILKERKNGN |
Ga0181355_13764611 | 3300017785 | Freshwater Lake | GCEPKSHPAGSLSRVLVELAIATQIPMSEWVEAEDILTAIEILEKRNGN |
Ga0181359_10145941 | 3300019784 | Freshwater Lake | KSYSRGSLSYLIVELSIATGIPMSEWVDAADIMTALEIMEKRNGRK |
Ga0181359_12631252 | 3300019784 | Freshwater Lake | PVGSLNRLLVELALATHIPMSEWVDADDIFTAIEVLEARHGSQ |
Ga0211734_111952433 | 3300020159 | Freshwater | PKSHASGSVGRLVVELAIATGIPMSEWTSAEDILTAVEILEKRNGKK |
Ga0211726_109712731 | 3300020161 | Freshwater | PKRYERGSLNRLLVELAIATHIPMSEWETAEQILTAVEILEQQNGN |
Ga0211729_108521682 | 3300020172 | Freshwater | IVELAIATGIPMPYWQSAEDILTAIEILEKNGGGKRSG |
Ga0211731_110312542 | 3300020205 | Freshwater | NRILVELAIATGIAMSEWVTAEQIYTAKEILEERSRGQ |
Ga0208232_10173593 | 3300020527 | Freshwater | AGSLNRLLVELAIATKIPMSEWVEAEDILTAIEILEKRNGS |
Ga0208723_10093481 | 3300020571 | Freshwater | SHPVGSLSRLLVQLSMATQIPMSEWVDGSDILTALEILEDRHK |
Ga0208723_10298333 | 3300020571 | Freshwater | PRGSVSRLLVELSIATHIPMSEWQSAEDILTAIEILEARNRG |
Ga0194126_104413121 | 3300020603 | Freshwater Lake | NRLLVELAIATHIPMSEWVDADDILTAIEILEARNGK |
Ga0214168_10737741 | 3300021140 | Freshwater | LLVELALATQIPMSEWVDSDDILTAIEVLEQRYGK |
Ga0194048_100896661 | 3300021519 | Anoxic Zone Freshwater | PKSHPVGSLNRLLVQLAIATQIPMSEWVDGEDVLTAIEILEERYGK |
Ga0222713_107205031 | 3300021962 | Estuarine Water | PKSYPVGSLNRLIVELAIATHIPMESWQTAEQILTAIEILEKNNGR |
Ga0222712_101128434 | 3300021963 | Estuarine Water | LNRLLVELALATQIPMSEWVDSDDILTAIEVLEQRYGK |
Ga0222712_106666141 | 3300021963 | Estuarine Water | PTSHPRGSVSRLLVELALATQIPMDHWQTAEDILTAVEILEERNRGR |
Ga0222712_107859322 | 3300021963 | Estuarine Water | ERGSIGRLLVEVAIATGIPMREWESAEDILTAIEILEKQNGV |
Ga0181353_10116391 | 3300022179 | Freshwater Lake | AIATGIPMSEWTSAEDIMTAIEVLEKRNGTRGNQL |
Ga0181354_10695141 | 3300022190 | Freshwater Lake | YSRGSLSYLIVELSIATGIPMSEWVDAADIMTALEIMEKRNGRK |
Ga0181354_11369701 | 3300022190 | Freshwater Lake | SRGSLSYLIVELSIATGIPMSEWVDAADIMTALEILEKRNGGK |
Ga0196905_10101851 | 3300022198 | Aqueous | GSLNRLIVELAIATQIPMPYWDNAEDILTALEILKERSGG |
Ga0196905_10551801 | 3300022198 | Aqueous | SISRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGG |
Ga0196905_10731023 | 3300022198 | Aqueous | HPVGSLSRLLIELAIATGIPHQYWDNAEDVITALEILEKNNGT |
Ga0214921_101000941 | 3300023174 | Freshwater | SHEPGSISRLLIEVAIATGIAMSEWQSAEDILTALEVLKERNGN |
Ga0244775_105029123 | 3300024346 | Estuarine | HSRGSVSRLLVELAIATQIPMDKWQSAEDILTAIEILEERNRGK |
Ga0244775_112355661 | 3300024346 | Estuarine | RLLVEVAIATGIPMREWESAEDLLTAIEILEKRNG |
Ga0255167_10409233 | 3300024350 | Freshwater | VSRLLVELAIATQIPMDHWQTAEDILTAIEILEQRNGK |
Ga0255271_11414282 | 3300024864 | Freshwater | LVELAIATGIPMKEWETAEQIYTAIEILEKRNGNKGR |
Ga0208426_10232211 | 3300025451 | Aqueous | IGRLLVEVAVATGIPMSEWQSAEDLLTAVEILERRNDDR |
Ga0208643_10234071 | 3300025645 | Aqueous | NRILVELAIATGIPMSEWTTAEQIYTAFEILEKQNGV |
Ga0208643_11415861 | 3300025645 | Aqueous | GSLNRLIVELAIATQIPMSEWQSAEDILTALEILEKRNG |
Ga0208161_10775331 | 3300025646 | Aqueous | KSGSISRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGGT |
Ga0208162_11041763 | 3300025674 | Aqueous | SGSLNRLVVELAIATQIPMRYWETAEDILTALEILKDRNGRQG |
Ga0208019_10966293 | 3300025687 | Aqueous | SISRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGGT |
Ga0208019_12059891 | 3300025687 | Aqueous | HKRGSLGRLLVELAIATKIPMQYWTEADDILTAIEILEQQNDR |
Ga0208917_11199401 | 3300025840 | Aqueous | HKSGSISRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGGT |
Ga0208005_11787021 | 3300025848 | Aqueous | ILLIELAIATGIPHQYWDNAEDVITALEILEKRSE |
Ga0208644_10132329 | 3300025889 | Aqueous | RPKSHKRGSLGRLLVELAIATKIPMQYWTEADDILTAIEILEKQNDR |
Ga0208644_10480831 | 3300025889 | Aqueous | RPKSHKRGSLGRLLVELAIATKIPMQYWTEADDILTAIEILEQQNDR |
Ga0208644_10520073 | 3300025889 | Aqueous | GSISRLLVELAIATGIPVQYWDDADDIVTALEILEKRNGG |
Ga0208916_100071998 | 3300025896 | Aqueous | CRPKSHQAGSLNRLLVELAIATHIPMSEWVEAEDILTAIEILEKRNGS |
Ga0255160_10375243 | 3300026457 | Freshwater | HQRGSVSRLIVELAIATQIPMVYWQTAEDILTAVEILEARTK |
Ga0255156_10824972 | 3300026478 | Freshwater | LLVELAIATQIPMDHWQTAEDILTAIEILEQRNGK |
Ga0255070_10242783 | 3300027133 | Freshwater | LIVELAIATNIPMQYWTDAEDIVTAVELLERRNNG |
Ga0255092_10175503 | 3300027137 | Freshwater | LLVELAIATNIPMSEWVDADDILTAIEVLEARYGK |
Ga0209300_100078117 | 3300027365 | Deep Subsurface | VELAIATQIPMSEWQTAEQIMTAIEILEKKYGSQGR |
Ga0255146_10233241 | 3300027396 | Freshwater | LNRVLVELALTTGIPMKEWETAEQIFTAIEILEKRNGNKGR |
Ga0255122_10666312 | 3300027595 | Freshwater | SHPAGSLNRLLVELAIATKIPMSEWVDAEDILTAIEVLEARYGK |
Ga0208951_11844532 | 3300027621 | Freshwater Lentic | RLLVELAIATNIPMSEWVDADDILTAIEVLEARYGK |
Ga0208942_10014474 | 3300027627 | Freshwater Lentic | MNRILVELAIATGIPMQYWKDGESILTAIEILEKRNGK |
Ga0208942_10063603 | 3300027627 | Freshwater Lentic | LIELAIATSIPMSEWESAEQILTAVEILKERKNGN |
Ga0209135_10972293 | 3300027642 | Freshwater Lake | LLVELAIATQIPMSEWVDAEDILTAIEILEARHGK |
Ga0209356_10587773 | 3300027644 | Freshwater Lake | LLVELAIATHIPMSEWVDADDILTAIEILEARNGN |
Ga0209356_11723391 | 3300027644 | Freshwater Lake | PKSHKAGSLNRLLVELAIATQIPMSEWVDAEDILTAIEILEARHGK |
Ga0209769_10291773 | 3300027679 | Freshwater Lake | LNRLLVELAIATHIPMSEWVDADDILTAIEILEARNGN |
Ga0209392_11027493 | 3300027683 | Freshwater Sediment | KRGSLGRLIVELAIATKIPMEHWRTGEDILTALEILEQQNGK |
Ga0209551_10114924 | 3300027689 | Freshwater Lake | RPKSHKAGSLNRLLVELAIATQIPMSEWVDAEDILTAIEILEARHGK |
Ga0209599_100295061 | 3300027710 | Deep Subsurface | VSRLIVELAIATQIPMVHWQTAEDILTAVEILEARTK |
Ga0209599_101840742 | 3300027710 | Deep Subsurface | LLVELAIATRIPMDYWRTAEDILTAIEVLEERNGK |
Ga0209492_10780513 | 3300027721 | Freshwater Sediment | HPRGSVSRLLVELAIATQIPMDHWQSAEDILTAIEILEKRNG |
Ga0209492_11488203 | 3300027721 | Freshwater Sediment | KSHKAGSLNRLLVELAIATKIPMSEWVDADDILTAIEILEARNG |
Ga0209442_12286383 | 3300027732 | Freshwater Lake | SLNRLLVELAIATQIPMSEWVDAEDILTAIEILEARHGK |
Ga0209442_12972372 | 3300027732 | Freshwater Lake | KSFQRGSINRLLVELAIATSIPMSEWESAEQILTAVEILKEHKNDN |
Ga0209297_10201864 | 3300027733 | Freshwater Lake | MLVELAIATHIPMSEWVDADDILTAIEVLEARSGK |
Ga0209297_11755543 | 3300027733 | Freshwater Lake | RLLVELAIATQIPMSEWVDGEDVLTAIEILEERNGN |
Ga0209087_12750602 | 3300027734 | Freshwater Lake | PKSHPAGSLSRLLVELAIATQIPMSEWVDAEDILTAIEVLEARYGK |
Ga0209087_13328752 | 3300027734 | Freshwater Lake | AGSLSRLLVELAIATQIPMSEWVDGEDVLTAIEILEERYGK |
Ga0209355_12727183 | 3300027744 | Freshwater Lake | YKRGSINYLLVELAIATSIPMSEWESAEQILTAVEILEKRNGN |
Ga0209596_10180925 | 3300027754 | Freshwater Lake | RSRERRPKSYAVGSLSRIVVELALATNIPMSEWTTAEQILTAMEILEKRNGR |
Ga0209596_12904671 | 3300027754 | Freshwater Lake | PKSHQRGSINRLIVELAIATQIPMSEWRSAEDILTALEILEKRNG |
Ga0209596_13404522 | 3300027754 | Freshwater Lake | MLVELAIATGIPMSEWVTAEQIYTAKEILEEQSRGQ |
Ga0209296_12801261 | 3300027759 | Freshwater Lake | SRRGTPKSYQRGSLSRLLVELAIATQIPMSQWQTAEEVLTALEILESKRGK |
Ga0209088_103330941 | 3300027763 | Freshwater Lake | RYPIRGSGQPKSYAAGSLNRVLVELALATGIPMKEWETAEQIYTAIEILEKRNGK |
Ga0209500_100155013 | 3300027782 | Freshwater Lake | VNRILVELAIATGIPMSEWITAEQIYTAKEILEARE |
Ga0209500_100638111 | 3300027782 | Freshwater Lake | GSLNRLLVQLAIATQIPMSEWVDGEDVLTAIEILEERYGK |
Ga0209500_101704473 | 3300027782 | Freshwater Lake | PKSHPAGSLSRLLVELAIATQIPMSEWVDGEDVLTAIEILEERNGN |
Ga0209246_100252871 | 3300027785 | Freshwater Lake | LLVELAIATQIPMSEWVDAEDILTAIEILEARYGK |
Ga0209353_101664543 | 3300027798 | Freshwater Lake | VDLALATGIPMSEWQTAEQIYTALEILEKQNGGQR |
Ga0209358_101953983 | 3300027804 | Freshwater Lake | PKSHPVGSLNRLLIELAIATGIPHQYWDNADDVLTALEILEKRNG |
Ga0209354_100138714 | 3300027808 | Freshwater Lake | KSHKAGSLNRLLVELAIATQIPMSEWVDAEDILTAIEILEARYGK |
Ga0209742_102466561 | 3300027814 | Marine Sediment | ELAIATGIPMSEWRSAEDILTALEVLERRNGGGKGAR |
Ga0209990_101385453 | 3300027816 | Freshwater Lake | GRPKSHPRGSVSRLLVELAIATQIPMDKWQSAEDILTAIEVLEERNRGK |
Ga0209550_107185621 | 3300027892 | Freshwater Lake | INRLIVELAIATQIPMSEWRSAEDILTALELLEKRNG |
Ga0209400_10980713 | 3300027963 | Freshwater Lake | SRIVVELAIATKIPMSEWTTAEQILTAFEILEQQHGG |
Ga0209191_11887441 | 3300027969 | Freshwater Lake | SRLLVELALATQIPMDHWRSAEDILTAIEILEERNRGR |
Ga0209298_100016748 | 3300027973 | Freshwater Lake | MNRILVELAIATGIPMSEWVTAEQVITAIEVLEKRNGR |
Ga0209298_102563051 | 3300027973 | Freshwater Lake | SLNRLLVELAIATQIPMSEWVEAEDILTAIEILEKRNGN |
Ga0209702_101089111 | 3300027976 | Freshwater | HERGSLSRLLVELSIATRIPMSEWTNAEDILTALEILEAQNGR |
Ga0247723_10051541 | 3300028025 | Deep Subsurface Sediment | PKSHARGSVSRLLVELAIATRIPMDHWKTAEDILTAIEILEERNGK |
Ga0247722_102807371 | 3300028027 | Deep Subsurface Sediment | LIVELAIATHIPMSEWTSAEDIMTAIEILEKRNGD |
Ga0255234_11187811 | 3300028113 | Freshwater | RLLIELAIATHIPMSEWTSAEDILTAIEVLEERNGK |
Ga0304730_10352411 | 3300028394 | Freshwater Lake | GRKRRPKSYAVGSLSRIVVELAIATKIPMSEWTTAEQILTAFEILEQQHGG |
Ga0304730_10834593 | 3300028394 | Freshwater Lake | AAGSLNRLLVELALATHIPMSEWVDADDIFTAIEVLEARNGS |
Ga0304730_10916031 | 3300028394 | Freshwater Lake | LVRYRGRYSIRGSTKPKSYAVGSLNRVLVELALATGIPMKEWETAEQIYTAIEILEKRNGNKGR |
(restricted) Ga0247840_102855731 | 3300028581 | Freshwater | RLLVELAIATKIPMSEWVDADDILTAIEILEARNG |
Ga0307380_108540852 | 3300031539 | Soil | MIVELAVETGIPMSEWRTAEQILTAFEVLEAKHGN |
Ga0307379_105427231 | 3300031565 | Soil | LNRLIVELAIATQIPMRYWETAEDILTALEILKDRNGRQG |
Ga0307378_107143113 | 3300031566 | Soil | SLSRLLVELAIATSIPMKNWETAEEVLTALEILEQRNGK |
Ga0307375_107831522 | 3300031669 | Soil | LLVELAIATQIPMSEWVDSDDILTAIEVLEQRDGK |
Ga0315291_101703854 | 3300031707 | Sediment | LIVELAIATQIPMSEWTSAEDILTALEILEKRNGV |
Ga0315291_108878801 | 3300031707 | Sediment | NYLLVELAIATSIPMNEWESAEQILTAVEILKERSNG |
Ga0315291_112870441 | 3300031707 | Sediment | GSINRLLIELAIATSIPMSEWESAEQILTAVEILKERKND |
Ga0315293_104178231 | 3300031746 | Sediment | SINRLLIELAIATSIPMSEWESAEQILTAVEILKERKNGN |
Ga0315293_109781031 | 3300031746 | Sediment | RERRPKSYAVGSLSRIVVELALATNIPMSEWTTAEQILTAMEILEKRNGR |
Ga0315293_110745741 | 3300031746 | Sediment | KSFQRGSINRLLIELAIATSIPMSEWESAEQILTAVEILKERNNGN |
Ga0315907_100367837 | 3300031758 | Freshwater | SHPVGSLSRLLVQLSIATQIPMSEWVDGSDVLTALEILEDRHK |
Ga0315907_102789451 | 3300031758 | Freshwater | RGSVSRLLVELAIATQIPMDHWQTAEDILTAIEVLEQRNGK |
Ga0315288_104161143 | 3300031772 | Sediment | CKPKSHPAGSLSRLLVELAIATKIPISEWVDADDIMTAIEVLEARHGN |
Ga0315288_105052033 | 3300031772 | Sediment | LNRIIVELAIATKIPMSEWTTAEQILTAFEILERNHGV |
Ga0315900_100853531 | 3300031787 | Freshwater | DLAIATQIPMREWVDADDIATALDILKERNGQRNSLRPR |
Ga0315900_102947093 | 3300031787 | Freshwater | SLNRLLVELAIATHIPMSEWVDADDILTAIEILEARNGN |
Ga0315900_110392122 | 3300031787 | Freshwater | RPKSHPRGSVSRLLIELAIATQIPMDKWQSAEDILTAIEVLEERNRGK |
Ga0315900_110683821 | 3300031787 | Freshwater | SHPAGSLNRLLVELALATQIPMSEWVDSDDILTAIEVLEQRYGK |
Ga0315909_100452487 | 3300031857 | Freshwater | NRLLVELAIATQIPMSEWVDADDILTAIEVLEQRYGK |
Ga0315909_101119911 | 3300031857 | Freshwater | GNSDKPHPSGSLSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGRR |
Ga0315909_101889493 | 3300031857 | Freshwater | GSLSRLLVQLSIATQIPMSEWVDGSDVLTALEILEDRHK |
Ga0315909_102022993 | 3300031857 | Freshwater | NSNKPHPSGSLSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGGR |
Ga0315909_102774563 | 3300031857 | Freshwater | TLIELSIATGIPMSEWQTAEDILTAIEILEKRNRG |
Ga0315909_103952861 | 3300031857 | Freshwater | KPHPSGSLSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGRR |
Ga0315909_108032751 | 3300031857 | Freshwater | ASGSVSRLLVELAIATGIPMQYWESAEDVLTAIEVLEKQNGDKRAR |
Ga0315297_105092281 | 3300031873 | Sediment | LVELSIATGIPMSEWVDAADILTALEILEKRNGRS |
Ga0315297_111798662 | 3300031873 | Sediment | KSHKRGSLSHLIVELAIATHIPMSEWTSAEDILSAIEILEKRNGV |
Ga0315904_104249013 | 3300031951 | Freshwater | SVSRLIVELAIATQIPMSEWSNAEDILTAIEVLEKRNGG |
Ga0315904_107769343 | 3300031951 | Freshwater | QSIKPKSHASGSVGRLVVELAIATGIPMSEWSSAEDILTAVEILEKRNGKK |
Ga0315294_108327983 | 3300031952 | Sediment | LSRIVVELAIATKIPMSEWTTAEQILTAFEILEQQHGG |
Ga0315901_102649793 | 3300031963 | Freshwater | SRRCRSRWGRPKSHPRGSVSRLLVELAIATQIPMDKWQSAEDILTAIEVLEERNRGK |
Ga0315901_109098062 | 3300031963 | Freshwater | PKSHPRGSVSRLLVELALATQIPMDHWQSAEDILTAVEILEERNRGR |
Ga0315278_108249581 | 3300031997 | Sediment | KSYSRGSLSYLIVELSIATGIPMSEWVDAADILTALEILEKRNGGK |
Ga0315278_114549071 | 3300031997 | Sediment | PKSYSRGSLSYLIVELSIATGIPMSEWVDAADIMTALEILEKQNGRK |
Ga0315274_105905943 | 3300031999 | Sediment | LVELAIATSIPMREWETAEQILTAAEILKERKDGN |
Ga0315274_119680361 | 3300031999 | Sediment | LLIELAIATSIPMSEWESAEQILTAVEILEKRNGN |
Ga0315289_104290493 | 3300032046 | Sediment | RLLVELALATQIPMSEWVDADDIFTAIEVLEARYDK |
Ga0315289_104439183 | 3300032046 | Sediment | YSRGSLSYLLVELSIATGIPMSEWVDAADILTALEILEKRNGRS |
Ga0315906_1001670617 | 3300032050 | Freshwater | YLIVELSIATGIPMSEWVDAADILTALEILEKRNGGK |
Ga0315906_103733861 | 3300032050 | Freshwater | LNRLLVQLAIATRIPMSEWVDADDIYTAIEILEQRNGS |
Ga0315284_106263941 | 3300032053 | Sediment | PGSIGRLLVEVAVATGIPMSEWQSAEDLLTAVEILERRNNDL |
Ga0315284_108040121 | 3300032053 | Sediment | YRSRKCEPKSYAVGSLSRIIVELALATNIPMSEWTTAEQILTAMEILEKRNGR |
Ga0315284_110524361 | 3300032053 | Sediment | CRPKSHPAGSLSRLLVELAIATNIPMSEWVDADDIMTAIEVLEARHGN |
Ga0315284_114624012 | 3300032053 | Sediment | HKRGSLGHLIVELAIATQIPMSEWTSAEDILTALEILEKRNGV |
Ga0315902_101091854 | 3300032093 | Freshwater | SLSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGRR |
Ga0315902_105620431 | 3300032093 | Freshwater | KSYPVGSLNRLIVELSIATQIPMSEWQTAEQILTALEILEKRNGK |
Ga0315902_107193731 | 3300032093 | Freshwater | SLSRLLVELAIATQIPMSEWVEADDILTAIEVLEQRYGK |
Ga0315902_112991121 | 3300032093 | Freshwater | KSHPAGSLSRLLVELAIATQIPMSEWVDSDDILTAIEVLEQRYGK |
Ga0315277_111055173 | 3300032118 | Sediment | RGSINYLLVELAIATSIPMSEWESAEQILTAVEILEKRNGN |
Ga0315277_111524892 | 3300032118 | Sediment | LVELAIATSIPMKEWETAEQILTAAEILKERNNGN |
Ga0315277_111988422 | 3300032118 | Sediment | MLVELAIATGIPMSEWITAEQIYTAKEILEEQSRGQ |
Ga0315277_112194592 | 3300032118 | Sediment | YRSRECRPKSYAVGSLSRIIVELAIATKIPMSEWTTAEQILTAFEILERNHGV |
Ga0315268_105637573 | 3300032173 | Sediment | NYLLIELAIATSIPMSEWESAEQILTAVEILEKRNAK |
Ga0315276_119276512 | 3300032177 | Sediment | LLVELAIATSIPMSEWESAEQILTAVEILKERKNGN |
Ga0315271_106777221 | 3300032256 | Sediment | KPGSIGRLLVEVAVATGIPMSEWQSAEDLLTAVEILERRNDDR |
Ga0315286_107965122 | 3300032342 | Sediment | LIVQLSVATGIAMDQWKSAEDILTAIEILEKKNGI |
Ga0315286_118416522 | 3300032342 | Sediment | LVEVAVATGIPMSEWQSAEDLLTAVEILERRNDDL |
Ga0315287_106330973 | 3300032397 | Sediment | LIVELSIATGIPMSEWVDAADILTALEILEKRNGGK |
Ga0315275_103232251 | 3300032401 | Sediment | SYKRGSINYLLIELAIATSIPMNEWESAEQILTAVEILKERSNG |
Ga0315273_120144521 | 3300032516 | Sediment | RPKSYAVGSLSRIVVELAIATKIPMSEWTTAEQILTAFEILEQQHGG |
Ga0315273_130258472 | 3300032516 | Sediment | LIVQLSVATGIAMDQWKSAEDILTAIEILEKKNGIQGNQRPR |
Ga0334722_110006071 | 3300033233 | Sediment | AVGSLSRIVVELAIATKIPMSEWTTAEQILTAFEILERDHGI |
Ga0334982_0021008_300_407 | 3300033981 | Freshwater | VELAIATQIPMSEWQTAEQIMTAIEILEKKHGQGR |
Ga0334994_0202476_2_142 | 3300033993 | Freshwater | KSHTRGSVSRLLVELAIATQIPMDHWQSAEDILTAIEILEERNRGR |
Ga0334994_0276527_2_115 | 3300033993 | Freshwater | SRLLVEVAIATGIPMGEWTSADDILTAIEILEKRNGV |
Ga0334994_0389688_533_676 | 3300033993 | Freshwater | NGRNREPKSYAVGSLNRLRVDLDIATNIPMSEWHTAEQILTAIEILE |
Ga0334979_0095198_850_960 | 3300033996 | Freshwater | VELAIATQIPMSEWQTAEQIMTAIEILEKKHGSQGR |
Ga0334986_0413078_3_128 | 3300034012 | Freshwater | RGSVSRLLVELAIATQIPMDQWQTAEDILTAVEILEQRNGK |
Ga0335023_0009370_5587_5733 | 3300034050 | Freshwater | RRPKSYAVGSLSRIVVELAIATKIPMSEWTTAEQILTAFEILEQQHGG |
Ga0334987_0027847_1_111 | 3300034061 | Freshwater | LLVELALATQIPMDHWQSAEDILTAIEVLEERNRGR |
Ga0334987_0048496_2_139 | 3300034061 | Freshwater | KSHKAGSLNRLLVELAIVTKIPMSEWVDADDILTAIEILEARNGS |
Ga0334987_0592825_519_656 | 3300034061 | Freshwater | KSYAAGSLNRTIVELAIATHIPMSEWQTAEQIITAIEILEKRNGS |
Ga0334987_0696094_3_143 | 3300034061 | Freshwater | PKSHREGSLSRLLVELAIATQIPMSEWVDADDIMTAVEILERRNGK |
Ga0335001_0343191_674_808 | 3300034064 | Freshwater | SVGRLIVELAIATGIPMSEWTSAEDIMTAIEVLEKRNGTRGNQL |
Ga0335019_0001657_14414_14551 | 3300034066 | Freshwater | KSYAVGSLNRLLVELAIATNIPMSEWHTAEQILTAIEILEKRNGK |
Ga0335019_0767623_432_545 | 3300034066 | Freshwater | RLLVELAIATQIPMDHWQSAEDILTAIEILEERNRGR |
Ga0310130_0081762_1_111 | 3300034073 | Fracking Water | RLLVELAIATGIPVQYWDDADDIVTALEILEKRNGG |
Ga0335020_0586929_3_128 | 3300034082 | Freshwater | AGSLSRLLVELAIATQIPMSEWVDSDDILTAIEVLEQRYGK |
Ga0335010_0350875_706_825 | 3300034092 | Freshwater | NRTIVELAIATQIPMSEWQTAEQILTAIEILEKRNGQGR |
Ga0335010_0593331_1_111 | 3300034092 | Freshwater | RLLVELAIATHIPMSEWVDADDILTAIEVLEARSGK |
Ga0335027_0054314_1890_1997 | 3300034101 | Freshwater | VELAIATQIPMSEWQTAEQIMTAIEILEKRNGQGR |
Ga0335027_0063909_3_155 | 3300034101 | Freshwater | GNSSKPHPSGSLSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGRR |
Ga0335027_0188524_1359_1475 | 3300034101 | Freshwater | LSRLLVELAIATQIPMSEWVDGEDILTALEILEQRNGR |
Ga0335027_0449646_3_128 | 3300034101 | Freshwater | AGSLSRLLVELAIATQIPMSEWVDSDDILTAIEVLEARYGK |
Ga0335027_0472215_3_140 | 3300034101 | Freshwater | SHPRGSVSRLLVELALATQIPMNHWQSAEDILTAVEILEERNRGR |
Ga0335029_0461073_2_139 | 3300034102 | Freshwater | KSHPRGSVSRLLVELAIATQIPMDHWHSAEDILTAIEILEQRNGK |
Ga0335030_0519974_2_130 | 3300034103 | Freshwater | HPVGSLSRLLVQLSIATQIPMSEWVDGSDVLTALEILEDRHK |
Ga0335031_0163665_1401_1529 | 3300034104 | Freshwater | KAGSLNRLLVELAIATKIPMSEWVDADDILTAIEILEARNGS |
Ga0335031_0284848_962_1081 | 3300034104 | Freshwater | LSRLIVELAIATQIPMQYWDTAEDIATALEILKERNGRR |
Ga0335031_0311914_2_151 | 3300034104 | Freshwater | KRHTAGSLGRLLVELAIETGIPMSEWRTAEDILTAIDVLEKRNERRNRV |
Ga0335035_0055406_2465_2605 | 3300034105 | Freshwater | PKSHAAGSLSRLLVELAIATNIPMSEWVDADDILTAIEVLEARYGK |
Ga0335035_0222017_2_154 | 3300034105 | Freshwater | WGRPKSHPRGSVSRLLVELAIATQIPMDKWQSAEDILTAIEVLEERNRGK |
Ga0335036_0387769_780_899 | 3300034106 | Freshwater | SLNRLLVELAIATKIPMSEWVDADDILTAIEILEARNGS |
Ga0335036_0562867_3_113 | 3300034106 | Freshwater | RLIVELAIATQIPMSEWQTAEQILTAIEILEKRNGK |
Ga0335036_0770091_443_553 | 3300034106 | Freshwater | MLVELAIATGIPMSEWVTAEQIYTAKEILEKQSRGQ |
Ga0335055_0046187_2_109 | 3300034110 | Freshwater | LLVELALATHIPMDKWETAEDILTAIEILEARNHG |
Ga0335053_0406324_715_825 | 3300034118 | Freshwater | RLVVELAIATGIPMSEWSSAEDILTAVEVLEKRNGK |
Ga0335054_0783033_3_140 | 3300034119 | Freshwater | KSHARGSVSRLLVELAIATRIPMDHWKTAEDILTAIEVLEERNGK |
Ga0335056_0207987_989_1123 | 3300034120 | Freshwater | SHPAGSLSRLLVELAIATQIPMSEWVEAEDILTAIEILEKRNGN |
Ga0335058_0299993_796_930 | 3300034121 | Freshwater | GSLGRLLVELAIATGIPMSEWQTAEDILTAIEVLEKRNERRNRL |
Ga0335058_0619627_3_143 | 3300034121 | Freshwater | PKSHPAGSLSRLLVELAIATQIPMSEWVEAEDILTAIEILERRNGK |
Ga0335016_0277583_897_1037 | 3300034166 | Freshwater | PKSHKAGSLNRLLVELAIATHIPMSEWVDADDILTAIEILEARNGK |
Ga0335017_0128942_1330_1482 | 3300034167 | Freshwater | RPKSHKRGSINRLLVELAIATHIPMREWETAEDILTAIEVLKERNEPGRS |
Ga0335017_0439260_584_700 | 3300034167 | Freshwater | LSRLLVELAIATQIPMSEWVDSDDILTAIEVLEQRYGK |
Ga0335017_0448362_580_690 | 3300034167 | Freshwater | RLLVEVAIATGIPMGEWTSADDILTAIEILEKRNGV |
Ga0335061_0204467_908_1045 | 3300034168 | Freshwater | AGSLGRLLVELAIATGIPMSEWQTAEDILTAIDVLEKRNERRSRV |
Ga0335065_0173464_2_142 | 3300034200 | Freshwater | PKSHPAGSLNRLLVELALATQIPMSEWVDSDDILTAIEVLEQRYGK |
Ga0335049_0228979_1181_1288 | 3300034272 | Freshwater | LVDLAIATQIPMSEWQTAEDILTAIEILEERNNRG |
Ga0335049_0528979_1_141 | 3300034272 | Freshwater | KSYSRGSLNYLIVELSIATGIPMSEWVDAADILTALEILEKRNGGK |
Ga0335052_0041138_2730_2867 | 3300034279 | Freshwater | PKSYAAGSLNRTIVELAIATQIPMSEWQTAEQIMTAIEILEKRNG |
Ga0335007_0535998_1_129 | 3300034283 | Freshwater | PAGSLSRLLVELAIATQIPMSEWVDSDDILTAIEVLEQRYGK |
Ga0335013_0159863_2_139 | 3300034284 | Freshwater | PKSHKRGSLNRLIVELAIATQIPMKEWTSAEDILTALEILEKRNG |
Ga0335039_0114758_1433_1549 | 3300034355 | Freshwater | SYLIVELSIATGIPMSEWVDAADILTALEILEKRNGGK |
Ga0335048_0313574_1_141 | 3300034356 | Freshwater | RPKSHKAGSLNRLLVELAIATHIPMSEWVDADDILTAIEILEARNG |
⦗Top⦘ |