Basic Information | |
---|---|
Family ID | F004350 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 442 |
Average Sequence Length | 49 residues |
Representative Sequence | MKPYILGAICVWFVCGIAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVDN |
Number of Associated Samples | 196 |
Number of Associated Scaffolds | 442 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 78.35 % |
% of genes near scaffold ends (potentially truncated) | 27.15 % |
% of genes from short scaffolds (< 2000 bps) | 78.96 % |
Associated GOLD sequencing projects | 162 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.68 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.855 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (14.480 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.715 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.611 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.87% β-sheet: 0.00% Coil/Unstructured: 55.13% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 442 Family Scaffolds |
---|---|---|
PF07238 | PilZ | 2.49 |
PF07589 | PEP-CTERM | 2.49 |
PF03734 | YkuD | 2.04 |
PF08557 | Lipid_DES | 1.81 |
PF00378 | ECH_1 | 1.58 |
PF06480 | FtsH_ext | 1.58 |
PF00291 | PALP | 1.36 |
PF13302 | Acetyltransf_3 | 1.36 |
PF13473 | Cupredoxin_1 | 1.36 |
PF00226 | DnaJ | 1.13 |
PF13432 | TPR_16 | 1.13 |
PF00230 | MIP | 1.13 |
PF01814 | Hemerythrin | 1.13 |
PF00248 | Aldo_ket_red | 1.13 |
PF04964 | Flp_Fap | 0.90 |
PF04828 | GFA | 0.90 |
PF00265 | TK | 0.90 |
PF01925 | TauE | 0.68 |
PF13469 | Sulfotransfer_3 | 0.68 |
PF02423 | OCD_Mu_crystall | 0.68 |
PF16189 | Creatinase_N_2 | 0.68 |
PF04030 | ALO | 0.68 |
PF13676 | TIR_2 | 0.68 |
PF01321 | Creatinase_N | 0.68 |
PF07715 | Plug | 0.68 |
PF05960 | DUF885 | 0.68 |
PF00196 | GerE | 0.45 |
PF00873 | ACR_tran | 0.45 |
PF01329 | Pterin_4a | 0.45 |
PF01979 | Amidohydro_1 | 0.45 |
PF00144 | Beta-lactamase | 0.45 |
PF01594 | AI-2E_transport | 0.45 |
PF09948 | DUF2182 | 0.45 |
PF02739 | 5_3_exonuc_N | 0.45 |
PF13594 | Obsolete Pfam Family | 0.45 |
PF03372 | Exo_endo_phos | 0.45 |
PF00313 | CSD | 0.45 |
PF02897 | Peptidase_S9_N | 0.45 |
PF05569 | Peptidase_M56 | 0.45 |
PF00487 | FA_desaturase | 0.45 |
PF13645 | YkuD_2 | 0.45 |
PF00773 | RNB | 0.45 |
PF09933 | DUF2165 | 0.45 |
PF06123 | CreD | 0.45 |
PF08212 | Lipocalin_2 | 0.45 |
PF08279 | HTH_11 | 0.45 |
PF01757 | Acyl_transf_3 | 0.45 |
PF03946 | Ribosomal_L11_N | 0.45 |
PF08240 | ADH_N | 0.45 |
PF14907 | NTP_transf_5 | 0.45 |
PF00892 | EamA | 0.45 |
PF03118 | RNA_pol_A_CTD | 0.45 |
PF02678 | Pirin | 0.45 |
PF00149 | Metallophos | 0.23 |
PF13561 | adh_short_C2 | 0.23 |
PF00380 | Ribosomal_S9 | 0.23 |
PF13545 | HTH_Crp_2 | 0.23 |
PF02705 | K_trans | 0.23 |
PF14559 | TPR_19 | 0.23 |
PF05742 | TANGO2 | 0.23 |
PF03965 | Penicillinase_R | 0.23 |
PF05036 | SPOR | 0.23 |
PF02403 | Seryl_tRNA_N | 0.23 |
PF04366 | Ysc84 | 0.23 |
PF00009 | GTP_EFTU | 0.23 |
PF00171 | Aldedh | 0.23 |
PF07040 | DUF1326 | 0.23 |
PF12698 | ABC2_membrane_3 | 0.23 |
PF04237 | YjbR | 0.23 |
PF00550 | PP-binding | 0.23 |
PF07617 | DUF1579 | 0.23 |
PF08007 | JmjC_2 | 0.23 |
PF04055 | Radical_SAM | 0.23 |
PF01339 | CheB_methylest | 0.23 |
PF07486 | Hydrolase_2 | 0.23 |
PF02586 | SRAP | 0.23 |
PF01914 | MarC | 0.23 |
PF12697 | Abhydrolase_6 | 0.23 |
PF06439 | 3keto-disac_hyd | 0.23 |
PF00515 | TPR_1 | 0.23 |
PF01124 | MAPEG | 0.23 |
PF01804 | Penicil_amidase | 0.23 |
PF16320 | Ribosomal_L12_N | 0.23 |
PF13519 | VWA_2 | 0.23 |
PF00293 | NUDIX | 0.23 |
PF02737 | 3HCDH_N | 0.23 |
PF00583 | Acetyltransf_1 | 0.23 |
PF01546 | Peptidase_M20 | 0.23 |
PF00486 | Trans_reg_C | 0.23 |
PF07885 | Ion_trans_2 | 0.23 |
PF08450 | SGL | 0.23 |
PF07110 | EthD | 0.23 |
PF00654 | Voltage_CLC | 0.23 |
PF13692 | Glyco_trans_1_4 | 0.23 |
PF01510 | Amidase_2 | 0.23 |
PF07883 | Cupin_2 | 0.23 |
PF07690 | MFS_1 | 0.23 |
PF13185 | GAF_2 | 0.23 |
PF15902 | Sortilin-Vps10 | 0.23 |
PF13490 | zf-HC2 | 0.23 |
PF00106 | adh_short | 0.23 |
PF00534 | Glycos_transf_1 | 0.23 |
PF13376 | OmdA | 0.23 |
PF04228 | Zn_peptidase | 0.23 |
PF00034 | Cytochrom_C | 0.23 |
PF01226 | Form_Nir_trans | 0.23 |
PF01243 | Putative_PNPOx | 0.23 |
PF02801 | Ketoacyl-synt_C | 0.23 |
PF00908 | dTDP_sugar_isom | 0.23 |
PF04226 | Transgly_assoc | 0.23 |
PF08818 | DUF1801 | 0.23 |
PF01435 | Peptidase_M48 | 0.23 |
PF00133 | tRNA-synt_1 | 0.23 |
PF00664 | ABC_membrane | 0.23 |
PF13414 | TPR_11 | 0.23 |
PF06574 | FAD_syn | 0.23 |
PF02656 | DUF202 | 0.23 |
PF01551 | Peptidase_M23 | 0.23 |
PF13463 | HTH_27 | 0.23 |
PF00296 | Bac_luciferase | 0.23 |
PF01171 | ATP_bind_3 | 0.23 |
PF09970 | DUF2204 | 0.23 |
PF01047 | MarR | 0.23 |
PF12710 | HAD | 0.23 |
PF08768 | THAP4_heme-bd | 0.23 |
PF07394 | DUF1501 | 0.23 |
COG ID | Name | Functional Category | % Frequency in 442 Family Scaffolds |
---|---|---|---|
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 2.04 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 2.04 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 1.58 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 1.13 |
COG1435 | Thymidine kinase | Nucleotide transport and metabolism [F] | 0.90 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.90 |
COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.90 |
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.68 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.68 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.68 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.68 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.68 |
COG0080 | Ribosomal protein L11 | Translation, ribosomal structure and biogenesis [J] | 0.45 |
COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.45 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.45 |
COG0557 | Exoribonuclease R | Transcription [K] | 0.45 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.45 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.45 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.45 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.45 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.45 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.45 |
COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.45 |
COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 0.45 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.45 |
COG3040 | Bacterial lipocalin Blc | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.45 |
COG4452 | Inner membrane protein CreD involved in colicin E2 resistance | Defense mechanisms [V] | 0.45 |
COG4776 | Exoribonuclease II | Transcription [K] | 0.45 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.23 |
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.23 |
COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0196 | FAD synthase | Coenzyme transport and metabolism [H] | 0.23 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.23 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.23 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.23 |
COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.23 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.23 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.23 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.23 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.23 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.23 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.23 |
COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.23 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.23 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.23 |
COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 0.23 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.23 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.23 |
COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 0.23 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.23 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.23 |
COG2321 | Predicted metalloprotease | General function prediction only [R] | 0.23 |
COG2366 | Acyl-homoserine lactone (AHL) acylase PvdQ | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.23 |
COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.23 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.23 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.23 |
COG3332 | Uncharacterized stress-responsive protein, TANGO2 (Transport and Golgi organisation 2) family, contains NRDE motif | General function prediction only [R] | 0.23 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.23 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.23 |
COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.23 |
COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.23 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.23 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.23 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.23 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.23 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.23 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.86 % |
Unclassified | root | N/A | 8.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_164442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1011 | Open in IMG/M |
2199352024|deeps__Contig_72306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 680 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100611958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2101 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101744707 | Not Available | 1967 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105734737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1751 | Open in IMG/M |
3300000955|JGI1027J12803_100658251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 617 | Open in IMG/M |
3300001915|JGI24741J21665_1058370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 569 | Open in IMG/M |
3300001990|JGI24737J22298_10154181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas rhizophila | 678 | Open in IMG/M |
3300002075|JGI24738J21930_10004238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3534 | Open in IMG/M |
3300002568|C688J35102_120520081 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1140 | Open in IMG/M |
3300002568|C688J35102_120679734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1341 | Open in IMG/M |
3300002568|C688J35102_120767747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1525 | Open in IMG/M |
3300002568|C688J35102_120940046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2650 | Open in IMG/M |
3300002568|C688J35102_120956243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3054 | Open in IMG/M |
3300002568|C688J35102_120986731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 6887 | Open in IMG/M |
3300003321|soilH1_10029077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1710 | Open in IMG/M |
3300003322|rootL2_10370569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1085 | Open in IMG/M |
3300003324|soilH2_10370300 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300003848|Ga0058694_1020190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1128 | Open in IMG/M |
3300004081|Ga0063454_100071553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1508 | Open in IMG/M |
3300004114|Ga0062593_100133930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1839 | Open in IMG/M |
3300004114|Ga0062593_103203077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 524 | Open in IMG/M |
3300004153|Ga0063455_101316296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 551 | Open in IMG/M |
3300004463|Ga0063356_101761442 | Not Available | 929 | Open in IMG/M |
3300004479|Ga0062595_100042701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1998 | Open in IMG/M |
3300004479|Ga0062595_100988189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 721 | Open in IMG/M |
3300004479|Ga0062595_101631248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 603 | Open in IMG/M |
3300004479|Ga0062595_101974511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli | 562 | Open in IMG/M |
3300004643|Ga0062591_100392621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1143 | Open in IMG/M |
3300005093|Ga0062594_100325359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1188 | Open in IMG/M |
3300005093|Ga0062594_100821079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → unclassified Sphingomonadaceae → Sphingomonadaceae bacterium | 863 | Open in IMG/M |
3300005093|Ga0062594_101510736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 689 | Open in IMG/M |
3300005093|Ga0062594_101827981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 641 | Open in IMG/M |
3300005093|Ga0062594_102160090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 601 | Open in IMG/M |
3300005104|Ga0066818_1023136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas turrisvirgatae | 529 | Open in IMG/M |
3300005148|Ga0066819_1008493 | Not Available | 701 | Open in IMG/M |
3300005175|Ga0066673_10390620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 812 | Open in IMG/M |
3300005176|Ga0066679_10959321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 535 | Open in IMG/M |
3300005181|Ga0066678_10725119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas crusticola | 661 | Open in IMG/M |
3300005184|Ga0066671_10189723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1228 | Open in IMG/M |
3300005184|Ga0066671_10257001 | Not Available | 1078 | Open in IMG/M |
3300005186|Ga0066676_10330777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli | 1015 | Open in IMG/M |
3300005186|Ga0066676_10753748 | Not Available | 662 | Open in IMG/M |
3300005258|Ga0074071_1056666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 737 | Open in IMG/M |
3300005327|Ga0070658_10049923 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3390 | Open in IMG/M |
3300005327|Ga0070658_10066771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2938 | Open in IMG/M |
3300005327|Ga0070658_10085342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2596 | Open in IMG/M |
3300005327|Ga0070658_10192260 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1720 | Open in IMG/M |
3300005327|Ga0070658_10226009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1584 | Open in IMG/M |
3300005327|Ga0070658_10481204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1071 | Open in IMG/M |
3300005327|Ga0070658_10550420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 998 | Open in IMG/M |
3300005327|Ga0070658_10563789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
3300005327|Ga0070658_10633849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 927 | Open in IMG/M |
3300005327|Ga0070658_10647842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
3300005327|Ga0070658_10787309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 826 | Open in IMG/M |
3300005327|Ga0070658_10817225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 810 | Open in IMG/M |
3300005327|Ga0070658_10927686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 757 | Open in IMG/M |
3300005327|Ga0070658_11259121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 643 | Open in IMG/M |
3300005327|Ga0070658_11696441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 547 | Open in IMG/M |
3300005327|Ga0070658_11878460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 517 | Open in IMG/M |
3300005327|Ga0070658_12003575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae | 500 | Open in IMG/M |
3300005329|Ga0070683_100372865 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300005329|Ga0070683_102327777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 514 | Open in IMG/M |
3300005331|Ga0070670_100042315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3916 | Open in IMG/M |
3300005331|Ga0070670_100067048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3080 | Open in IMG/M |
3300005332|Ga0066388_103129644 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005335|Ga0070666_10106320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1939 | Open in IMG/M |
3300005335|Ga0070666_10419412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
3300005335|Ga0070666_10705545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 740 | Open in IMG/M |
3300005336|Ga0070680_100020860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 5201 | Open in IMG/M |
3300005336|Ga0070680_100023245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 4942 | Open in IMG/M |
3300005336|Ga0070680_100183068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1765 | Open in IMG/M |
3300005336|Ga0070680_100493951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1047 | Open in IMG/M |
3300005336|Ga0070680_100533932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1005 | Open in IMG/M |
3300005336|Ga0070680_100922565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 754 | Open in IMG/M |
3300005337|Ga0070682_101033565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 684 | Open in IMG/M |
3300005339|Ga0070660_100067544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2785 | Open in IMG/M |
3300005339|Ga0070660_100126713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2040 | Open in IMG/M |
3300005339|Ga0070660_100167311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1774 | Open in IMG/M |
3300005339|Ga0070660_100225499 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300005339|Ga0070660_101090675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 676 | Open in IMG/M |
3300005339|Ga0070660_101576598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 559 | Open in IMG/M |
3300005339|Ga0070660_101843110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 515 | Open in IMG/M |
3300005344|Ga0070661_100965936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas yantingensis | 705 | Open in IMG/M |
3300005345|Ga0070692_10127223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1428 | Open in IMG/M |
3300005345|Ga0070692_11048034 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300005347|Ga0070668_100953578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 769 | Open in IMG/M |
3300005353|Ga0070669_101001074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 717 | Open in IMG/M |
3300005355|Ga0070671_100044971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 3669 | Open in IMG/M |
3300005355|Ga0070671_100200218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1693 | Open in IMG/M |
3300005355|Ga0070671_100417030 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300005355|Ga0070671_100583265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 966 | Open in IMG/M |
3300005356|Ga0070674_100763767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 832 | Open in IMG/M |
3300005365|Ga0070688_100828731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
3300005366|Ga0070659_100007501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 7926 | Open in IMG/M |
3300005366|Ga0070659_100752857 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005366|Ga0070659_101088189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 704 | Open in IMG/M |
3300005366|Ga0070659_101426562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 616 | Open in IMG/M |
3300005367|Ga0070667_100155638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2010 | Open in IMG/M |
3300005367|Ga0070667_100703195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 935 | Open in IMG/M |
3300005434|Ga0070709_10833949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 725 | Open in IMG/M |
3300005435|Ga0070714_100017575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 5795 | Open in IMG/M |
3300005435|Ga0070714_100090458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2681 | Open in IMG/M |
3300005435|Ga0070714_100090983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2673 | Open in IMG/M |
3300005435|Ga0070714_100203766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1811 | Open in IMG/M |
3300005435|Ga0070714_100242742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1663 | Open in IMG/M |
3300005435|Ga0070714_100288852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1526 | Open in IMG/M |
3300005435|Ga0070714_100291297 | Not Available | 1519 | Open in IMG/M |
3300005435|Ga0070714_100810338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 907 | Open in IMG/M |
3300005436|Ga0070713_100022608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4862 | Open in IMG/M |
3300005437|Ga0070710_10598320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 767 | Open in IMG/M |
3300005438|Ga0070701_11351626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas rhizophila | 511 | Open in IMG/M |
3300005451|Ga0066681_10933213 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 519 | Open in IMG/M |
3300005455|Ga0070663_100053743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2876 | Open in IMG/M |
3300005455|Ga0070663_100233398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1449 | Open in IMG/M |
3300005456|Ga0070678_102391081 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005457|Ga0070662_100462616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1054 | Open in IMG/M |
3300005457|Ga0070662_100788267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 807 | Open in IMG/M |
3300005458|Ga0070681_10597398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1018 | Open in IMG/M |
3300005459|Ga0068867_100790115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 845 | Open in IMG/M |
3300005459|Ga0068867_101191220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis → Asticcacaulis taihuensis | 699 | Open in IMG/M |
3300005529|Ga0070741_10313126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1468 | Open in IMG/M |
3300005530|Ga0070679_100139893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2401 | Open in IMG/M |
3300005530|Ga0070679_100662701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 986 | Open in IMG/M |
3300005530|Ga0070679_100681586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 970 | Open in IMG/M |
3300005530|Ga0070679_101583894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 602 | Open in IMG/M |
3300005532|Ga0070739_10008250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 10735 | Open in IMG/M |
3300005532|Ga0070739_10026690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4418 | Open in IMG/M |
3300005532|Ga0070739_10044774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2965 | Open in IMG/M |
3300005532|Ga0070739_10501185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 548 | Open in IMG/M |
3300005539|Ga0068853_100548101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1095 | Open in IMG/M |
3300005543|Ga0070672_101995184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas daechungensis | 522 | Open in IMG/M |
3300005547|Ga0070693_101273721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 567 | Open in IMG/M |
3300005548|Ga0070665_101538588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 673 | Open in IMG/M |
3300005548|Ga0070665_101581183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 664 | Open in IMG/M |
3300005548|Ga0070665_102493321 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005557|Ga0066704_10931691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 537 | Open in IMG/M |
3300005563|Ga0068855_100220336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2128 | Open in IMG/M |
3300005563|Ga0068855_100242118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2015 | Open in IMG/M |
3300005563|Ga0068855_101236080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas pruni | 775 | Open in IMG/M |
3300005563|Ga0068855_101289448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 756 | Open in IMG/M |
3300005563|Ga0068855_101407796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 718 | Open in IMG/M |
3300005563|Ga0068855_101999359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 585 | Open in IMG/M |
3300005563|Ga0068855_102259907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 545 | Open in IMG/M |
3300005563|Ga0068855_102606347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 501 | Open in IMG/M |
3300005564|Ga0070664_101787809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 583 | Open in IMG/M |
3300005564|Ga0070664_102078097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 539 | Open in IMG/M |
3300005566|Ga0066693_10284908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 658 | Open in IMG/M |
3300005568|Ga0066703_10801590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 538 | Open in IMG/M |
3300005575|Ga0066702_10741056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. CCBAU 051011 | 585 | Open in IMG/M |
3300005575|Ga0066702_10978721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 506 | Open in IMG/M |
3300005577|Ga0068857_101451268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas deserti | 668 | Open in IMG/M |
3300005578|Ga0068854_100044588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 3149 | Open in IMG/M |
3300005578|Ga0068854_100570399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 962 | Open in IMG/M |
3300005578|Ga0068854_100617262 | Not Available | 927 | Open in IMG/M |
3300005578|Ga0068854_101829684 | Not Available | 557 | Open in IMG/M |
3300005614|Ga0068856_100144818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2383 | Open in IMG/M |
3300005614|Ga0068856_100813208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Tsuneonella → Tsuneonella rigui | 954 | Open in IMG/M |
3300005614|Ga0068856_100882078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 913 | Open in IMG/M |
3300005614|Ga0068856_101117635 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300005614|Ga0068856_101529850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 681 | Open in IMG/M |
3300005614|Ga0068856_101833105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 618 | Open in IMG/M |
3300005614|Ga0068856_102155293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 567 | Open in IMG/M |
3300005616|Ga0068852_100019954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 5321 | Open in IMG/M |
3300005616|Ga0068852_100370620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas daechungensis | 1403 | Open in IMG/M |
3300005616|Ga0068852_100833800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 937 | Open in IMG/M |
3300005616|Ga0068852_102118573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 584 | Open in IMG/M |
3300005618|Ga0068864_100015515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 6334 | Open in IMG/M |
3300005618|Ga0068864_101333911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 718 | Open in IMG/M |
3300005764|Ga0066903_107679221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 555 | Open in IMG/M |
3300005834|Ga0068851_10022223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3087 | Open in IMG/M |
3300005842|Ga0068858_101058726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 796 | Open in IMG/M |
3300006028|Ga0070717_10040693 | All Organisms → cellular organisms → Bacteria | 3787 | Open in IMG/M |
3300006028|Ga0070717_10703189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 918 | Open in IMG/M |
3300006046|Ga0066652_101381532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 660 | Open in IMG/M |
3300006173|Ga0070716_100039893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2609 | Open in IMG/M |
3300006175|Ga0070712_100055670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2771 | Open in IMG/M |
3300006800|Ga0066660_10051298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2695 | Open in IMG/M |
3300006804|Ga0079221_10255049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas colocasiae | 999 | Open in IMG/M |
3300006804|Ga0079221_10281494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 964 | Open in IMG/M |
3300006804|Ga0079221_10947268 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300006804|Ga0079221_11743330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas pruni | 509 | Open in IMG/M |
3300006806|Ga0079220_11747534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 546 | Open in IMG/M |
3300006876|Ga0079217_10362681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
3300006953|Ga0074063_10120573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. HMWF008 | 700 | Open in IMG/M |
3300009012|Ga0066710_100663317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1588 | Open in IMG/M |
3300009093|Ga0105240_10895069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas pruni | 955 | Open in IMG/M |
3300009137|Ga0066709_100767972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1393 | Open in IMG/M |
3300009137|Ga0066709_100845521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1330 | Open in IMG/M |
3300009176|Ga0105242_12620435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 553 | Open in IMG/M |
3300009177|Ga0105248_10074795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3807 | Open in IMG/M |
3300009553|Ga0105249_13121008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 532 | Open in IMG/M |
3300010040|Ga0126308_10851156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 634 | Open in IMG/M |
3300010335|Ga0134063_10158127 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300010373|Ga0134128_10112991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3084 | Open in IMG/M |
3300010375|Ga0105239_10232699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2067 | Open in IMG/M |
3300010375|Ga0105239_11270827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 849 | Open in IMG/M |
3300010375|Ga0105239_12290286 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300010396|Ga0134126_10479911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1435 | Open in IMG/M |
3300010397|Ga0134124_12090633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola | 604 | Open in IMG/M |
3300010399|Ga0134127_12686437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 578 | Open in IMG/M |
3300010401|Ga0134121_11087555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 791 | Open in IMG/M |
3300011106|Ga0151489_1404597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1007 | Open in IMG/M |
3300012209|Ga0137379_10428882 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1231 | Open in IMG/M |
3300012210|Ga0137378_10243595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1674 | Open in IMG/M |
3300012212|Ga0150985_107100648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 738 | Open in IMG/M |
3300012212|Ga0150985_107150055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 607 | Open in IMG/M |
3300012212|Ga0150985_112639315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 876 | Open in IMG/M |
3300012353|Ga0137367_10287196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SM33 | 1179 | Open in IMG/M |
3300012469|Ga0150984_122246892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1131 | Open in IMG/M |
3300012923|Ga0137359_10241474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1612 | Open in IMG/M |
3300012955|Ga0164298_10168399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1250 | Open in IMG/M |
3300012955|Ga0164298_11093023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 596 | Open in IMG/M |
3300012957|Ga0164303_10463586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 801 | Open in IMG/M |
3300012958|Ga0164299_10382761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 897 | Open in IMG/M |
3300012958|Ga0164299_11128804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 588 | Open in IMG/M |
3300012958|Ga0164299_11646688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 507 | Open in IMG/M |
3300012960|Ga0164301_11589317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 542 | Open in IMG/M |
3300012961|Ga0164302_10589328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Kordiimonadales → Kordiimonadaceae → Kordiimonas → Kordiimonas pumila | 804 | Open in IMG/M |
3300012961|Ga0164302_10653324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 771 | Open in IMG/M |
3300012961|Ga0164302_11051742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 639 | Open in IMG/M |
3300012961|Ga0164302_11293598 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300012985|Ga0164308_12307122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 500 | Open in IMG/M |
3300012986|Ga0164304_10914277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 687 | Open in IMG/M |
3300012989|Ga0164305_10303976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1180 | Open in IMG/M |
3300012989|Ga0164305_10455561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas yantingensis | 995 | Open in IMG/M |
3300013100|Ga0157373_10253579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1245 | Open in IMG/M |
3300013100|Ga0157373_10369164 | Not Available | 1025 | Open in IMG/M |
3300013100|Ga0157373_11091910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 598 | Open in IMG/M |
3300013100|Ga0157373_11370294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 537 | Open in IMG/M |
3300013100|Ga0157373_11511414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 513 | Open in IMG/M |
3300013100|Ga0157373_11568183 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300013102|Ga0157371_10014908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5849 | Open in IMG/M |
3300013102|Ga0157371_10173019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1543 | Open in IMG/M |
3300013102|Ga0157371_10200459 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
3300013102|Ga0157371_10404263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 999 | Open in IMG/M |
3300013102|Ga0157371_10913601 | Not Available | 666 | Open in IMG/M |
3300013102|Ga0157371_11016549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 633 | Open in IMG/M |
3300013104|Ga0157370_10324146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1421 | Open in IMG/M |
3300013104|Ga0157370_10811980 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300013104|Ga0157370_10993374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomicrobium | 760 | Open in IMG/M |
3300013104|Ga0157370_11427808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 623 | Open in IMG/M |
3300013104|Ga0157370_12104778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 506 | Open in IMG/M |
3300013105|Ga0157369_10052921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4390 | Open in IMG/M |
3300013105|Ga0157369_10279434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1739 | Open in IMG/M |
3300013105|Ga0157369_10401868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1421 | Open in IMG/M |
3300013297|Ga0157378_12491708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 569 | Open in IMG/M |
3300013306|Ga0163162_11594547 | Not Available | 744 | Open in IMG/M |
3300013307|Ga0157372_11382436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 812 | Open in IMG/M |
3300013307|Ga0157372_12356220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 611 | Open in IMG/M |
3300014325|Ga0163163_13285571 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300014745|Ga0157377_10691994 | Not Available | 739 | Open in IMG/M |
3300015371|Ga0132258_10286406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 4046 | Open in IMG/M |
3300015371|Ga0132258_11548448 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300015372|Ga0132256_102572032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
3300015373|Ga0132257_103612809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 563 | Open in IMG/M |
3300015374|Ga0132255_101471768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1030 | Open in IMG/M |
3300017937|Ga0187809_10192949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 720 | Open in IMG/M |
3300018429|Ga0190272_10250637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE158 | 1329 | Open in IMG/M |
3300018433|Ga0066667_10325412 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300018468|Ga0066662_10412125 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300018468|Ga0066662_10443362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 1159 | Open in IMG/M |
3300018468|Ga0066662_10649714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 997 | Open in IMG/M |
3300018468|Ga0066662_11311887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 742 | Open in IMG/M |
3300018468|Ga0066662_11761342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 648 | Open in IMG/M |
3300018468|Ga0066662_12539812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 540 | Open in IMG/M |
3300018482|Ga0066669_12436119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 502 | Open in IMG/M |
3300018920|Ga0190273_11932313 | Not Available | 543 | Open in IMG/M |
3300020069|Ga0197907_10270380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Caenibius → unclassified Caenibius → Caenibius sp. WL | 901 | Open in IMG/M |
3300020070|Ga0206356_10512938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1573 | Open in IMG/M |
3300020070|Ga0206356_10958874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 705 | Open in IMG/M |
3300020081|Ga0206354_10052822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 851 | Open in IMG/M |
3300020081|Ga0206354_10447288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 910 | Open in IMG/M |
3300020081|Ga0206354_11311700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 765 | Open in IMG/M |
3300020082|Ga0206353_10880460 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
3300021445|Ga0182009_10468244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 660 | Open in IMG/M |
3300021445|Ga0182009_10699155 | Not Available | 549 | Open in IMG/M |
3300025315|Ga0207697_10125935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1105 | Open in IMG/M |
3300025315|Ga0207697_10279765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 739 | Open in IMG/M |
3300025321|Ga0207656_10023967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2463 | Open in IMG/M |
3300025321|Ga0207656_10117368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1236 | Open in IMG/M |
3300025321|Ga0207656_10156080 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300025321|Ga0207656_10177756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas daechungensis | 1020 | Open in IMG/M |
3300025893|Ga0207682_10405881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 644 | Open in IMG/M |
3300025899|Ga0207642_10384961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 836 | Open in IMG/M |
3300025899|Ga0207642_10489269 | Not Available | 751 | Open in IMG/M |
3300025904|Ga0207647_10009232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 7014 | Open in IMG/M |
3300025904|Ga0207647_10014619 | All Organisms → cellular organisms → Bacteria | 5407 | Open in IMG/M |
3300025904|Ga0207647_10037824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 3057 | Open in IMG/M |
3300025904|Ga0207647_10111034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1621 | Open in IMG/M |
3300025904|Ga0207647_10226819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas aliaeris | 1076 | Open in IMG/M |
3300025909|Ga0207705_10007291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 8131 | Open in IMG/M |
3300025909|Ga0207705_10065464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2627 | Open in IMG/M |
3300025909|Ga0207705_10108782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2046 | Open in IMG/M |
3300025909|Ga0207705_10152842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1730 | Open in IMG/M |
3300025909|Ga0207705_10400021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1062 | Open in IMG/M |
3300025909|Ga0207705_10597403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 858 | Open in IMG/M |
3300025909|Ga0207705_10605105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 852 | Open in IMG/M |
3300025909|Ga0207705_10881530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 693 | Open in IMG/M |
3300025909|Ga0207705_11191515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 584 | Open in IMG/M |
3300025909|Ga0207705_11539179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 503 | Open in IMG/M |
3300025911|Ga0207654_10083706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1927 | Open in IMG/M |
3300025912|Ga0207707_11334932 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300025915|Ga0207693_11400878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 519 | Open in IMG/M |
3300025916|Ga0207663_11668414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 513 | Open in IMG/M |
3300025917|Ga0207660_10078604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2418 | Open in IMG/M |
3300025917|Ga0207660_10125660 | All Organisms → cellular organisms → Bacteria | 1947 | Open in IMG/M |
3300025917|Ga0207660_10147011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1807 | Open in IMG/M |
3300025917|Ga0207660_10657602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 854 | Open in IMG/M |
3300025919|Ga0207657_10070885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2953 | Open in IMG/M |
3300025919|Ga0207657_10080614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2736 | Open in IMG/M |
3300025919|Ga0207657_10087881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2599 | Open in IMG/M |
3300025919|Ga0207657_10095518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2473 | Open in IMG/M |
3300025919|Ga0207657_10176197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1730 | Open in IMG/M |
3300025919|Ga0207657_10219497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1524 | Open in IMG/M |
3300025919|Ga0207657_11071788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 616 | Open in IMG/M |
3300025920|Ga0207649_10181444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1474 | Open in IMG/M |
3300025920|Ga0207649_10411121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1014 | Open in IMG/M |
3300025920|Ga0207649_10723466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 773 | Open in IMG/M |
3300025923|Ga0207681_11570381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 551 | Open in IMG/M |
3300025928|Ga0207700_10208354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. SE220 | 1651 | Open in IMG/M |
3300025928|Ga0207700_11215668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 672 | Open in IMG/M |
3300025929|Ga0207664_10017734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 5227 | Open in IMG/M |
3300025929|Ga0207664_10309412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1392 | Open in IMG/M |
3300025930|Ga0207701_10435864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1126 | Open in IMG/M |
3300025931|Ga0207644_10003332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 10365 | Open in IMG/M |
3300025931|Ga0207644_10120577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1996 | Open in IMG/M |
3300025931|Ga0207644_10155385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1773 | Open in IMG/M |
3300025931|Ga0207644_10465815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1039 | Open in IMG/M |
3300025932|Ga0207690_10137497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1796 | Open in IMG/M |
3300025932|Ga0207690_10298657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1259 | Open in IMG/M |
3300025932|Ga0207690_10601975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 897 | Open in IMG/M |
3300025932|Ga0207690_10955038 | Not Available | 712 | Open in IMG/M |
3300025932|Ga0207690_11585886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 547 | Open in IMG/M |
3300025933|Ga0207706_10278607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1459 | Open in IMG/M |
3300025933|Ga0207706_10672825 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300025934|Ga0207686_11223894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 615 | Open in IMG/M |
3300025937|Ga0207669_10410471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1063 | Open in IMG/M |
3300025944|Ga0207661_10527927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1080 | Open in IMG/M |
3300025949|Ga0207667_10044041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4732 | Open in IMG/M |
3300025949|Ga0207667_10083643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3304 | Open in IMG/M |
3300025949|Ga0207667_10326333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1567 | Open in IMG/M |
3300025949|Ga0207667_11257612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 718 | Open in IMG/M |
3300025972|Ga0207668_10526852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1020 | Open in IMG/M |
3300025981|Ga0207640_10147220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1725 | Open in IMG/M |
3300025981|Ga0207640_11703388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 569 | Open in IMG/M |
3300025981|Ga0207640_12031489 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Spirosomaceae → Telluribacter → Telluribacter humicola | 521 | Open in IMG/M |
3300026023|Ga0207677_10025042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3717 | Open in IMG/M |
3300026041|Ga0207639_10148920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1958 | Open in IMG/M |
3300026041|Ga0207639_11884160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 559 | Open in IMG/M |
3300026067|Ga0207678_10033638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 4465 | Open in IMG/M |
3300026078|Ga0207702_10073925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2940 | Open in IMG/M |
3300026078|Ga0207702_10095257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2615 | Open in IMG/M |
3300026078|Ga0207702_10425049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1285 | Open in IMG/M |
3300026078|Ga0207702_10565618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1113 | Open in IMG/M |
3300026078|Ga0207702_10721543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 983 | Open in IMG/M |
3300026078|Ga0207702_10975101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 841 | Open in IMG/M |
3300026078|Ga0207702_11017916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 822 | Open in IMG/M |
3300026078|Ga0207702_11335107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 711 | Open in IMG/M |
3300026078|Ga0207702_11568052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 652 | Open in IMG/M |
3300026078|Ga0207702_12337314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 522 | Open in IMG/M |
3300026088|Ga0207641_10007922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 8811 | Open in IMG/M |
3300026088|Ga0207641_10944764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 857 | Open in IMG/M |
3300026089|Ga0207648_11279451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
3300026095|Ga0207676_10282971 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
3300026118|Ga0207675_101979261 | Not Available | 600 | Open in IMG/M |
3300026142|Ga0207698_10000751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 18819 | Open in IMG/M |
3300026142|Ga0207698_10274385 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
3300026142|Ga0207698_11108877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 804 | Open in IMG/M |
3300026142|Ga0207698_11147279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 790 | Open in IMG/M |
3300027750|Ga0209461_10017163 | Not Available | 1281 | Open in IMG/M |
3300027766|Ga0209796_10006142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3965 | Open in IMG/M |
3300027766|Ga0209796_10037524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1455 | Open in IMG/M |
3300027766|Ga0209796_10044417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1334 | Open in IMG/M |
3300027766|Ga0209796_10050812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1248 | Open in IMG/M |
3300027766|Ga0209796_10057637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1172 | Open in IMG/M |
3300027766|Ga0209796_10107733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 860 | Open in IMG/M |
3300027766|Ga0209796_10136490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → Phenylobacterium soli | 766 | Open in IMG/M |
3300027766|Ga0209796_10162547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 703 | Open in IMG/M |
3300027773|Ga0209810_1026442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3573 | Open in IMG/M |
3300027773|Ga0209810_1034010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2947 | Open in IMG/M |
3300027773|Ga0209810_1042274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2498 | Open in IMG/M |
3300028379|Ga0268266_11067736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 781 | Open in IMG/M |
3300028379|Ga0268266_11161194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 747 | Open in IMG/M |
3300028380|Ga0268265_11622286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 652 | Open in IMG/M |
3300028381|Ga0268264_12484136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 523 | Open in IMG/M |
3300030496|Ga0268240_10028365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1109 | Open in IMG/M |
3300030511|Ga0268241_10050201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
3300030511|Ga0268241_10126249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 611 | Open in IMG/M |
3300031548|Ga0307408_100231848 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300031548|Ga0307408_100660781 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 935 | Open in IMG/M |
3300031548|Ga0307408_101611653 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 616 | Open in IMG/M |
3300031938|Ga0308175_100022346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 5078 | Open in IMG/M |
3300031938|Ga0308175_100028597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4572 | Open in IMG/M |
3300031938|Ga0308175_100049749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3617 | Open in IMG/M |
3300031938|Ga0308175_100074704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3033 | Open in IMG/M |
3300031938|Ga0308175_100672868 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300031938|Ga0308175_100684501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1112 | Open in IMG/M |
3300031938|Ga0308175_101276680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas yantingensis | 817 | Open in IMG/M |
3300031938|Ga0308175_101693548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 708 | Open in IMG/M |
3300031938|Ga0308175_102101594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 633 | Open in IMG/M |
3300031938|Ga0308175_102491400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 579 | Open in IMG/M |
3300031938|Ga0308175_102707830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 555 | Open in IMG/M |
3300031939|Ga0308174_10001278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 11582 | Open in IMG/M |
3300031939|Ga0308174_10133056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1830 | Open in IMG/M |
3300031939|Ga0308174_10407927 | Not Available | 1096 | Open in IMG/M |
3300031939|Ga0308174_10497254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 997 | Open in IMG/M |
3300031996|Ga0308176_10212479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1828 | Open in IMG/M |
3300031996|Ga0308176_10656704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1084 | Open in IMG/M |
3300031996|Ga0308176_10924036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 917 | Open in IMG/M |
3300031996|Ga0308176_11534248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli | 710 | Open in IMG/M |
3300031996|Ga0308176_12125899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 600 | Open in IMG/M |
3300031996|Ga0308176_12190172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 590 | Open in IMG/M |
3300032074|Ga0308173_10447837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1146 | Open in IMG/M |
3300032074|Ga0308173_10552886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1037 | Open in IMG/M |
3300032074|Ga0308173_11460006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 642 | Open in IMG/M |
3300032074|Ga0308173_12043811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas daechungensis | 540 | Open in IMG/M |
3300032074|Ga0308173_12236101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 516 | Open in IMG/M |
3300033412|Ga0310810_10356958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1534 | Open in IMG/M |
3300033412|Ga0310810_11452802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 516 | Open in IMG/M |
3300033475|Ga0310811_11054366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 699 | Open in IMG/M |
3300034175|Ga0334939_0011803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3178 | Open in IMG/M |
3300034268|Ga0372943_0022210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3392 | Open in IMG/M |
3300034268|Ga0372943_0070737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1995 | Open in IMG/M |
3300034818|Ga0373950_0121531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 578 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 14.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 14.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.66% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.07% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.49% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.26% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.26% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.26% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.58% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.13% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.13% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.13% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.81% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.45% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.45% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.23% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.23% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.23% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.23% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.23% |
Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.23% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.23% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.23% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.23% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.23% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.23% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.23% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.23% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.23% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.23% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.91% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Host-Associated | Open in IMG/M |
3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003322 | Sugarcane root Sample L2 | Host-Associated | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003848 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005104 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC | Environmental | Open in IMG/M |
3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005258 | Microbial communities on the surface of bentonite enhanced biochar | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026944 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K2-12 (SPAdes) | Environmental | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300034175 | Biocrust microbial communities from Mojave Desert, California, United States - 35SMC | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_03030880 | 2199352024 | Soil | MKPYIIGAICVWFICGIAGAALLGQQRIDAATIAGGPITLWNGLNKPVDG |
deeps_01161120 | 2199352024 | Soil | MKPFILVAIAVWFVCGIAGAALLGEQRVDVPTIAGGPITLWSGLNEPVDK |
INPhiseqgaiiFebDRAFT_1006119582 | 3300000364 | Soil | MKPYIIGAIILWFVCGIVGAWLLGEQRVDIRTIAGGPITLFNGLNKPVD* |
INPhiseqgaiiFebDRAFT_1017447072 | 3300000364 | Soil | MKPYIIGAIIIWFVCGIAGAVLLGQQRVDIPTIAGGPITLWNGLNKPVND* |
INPhiseqgaiiFebDRAFT_1057347373 | 3300000364 | Soil | MKPYILGAICVWFTLGIVGAAMLGQQRVDVATIAGGPITFWHGLNKPVD* |
JGI1027J12803_1006582513 | 3300000955 | Soil | GAAMKPYILGAICVWFTLGIVGAAMLGQQRVDVATIAGGPITFWHGLNKPVD* |
JGI24741J21665_10583701 | 3300001915 | Corn Rhizosphere | MKPYILGAICVWFVCGIIGAVMLGQQRVDIPTIAGGPIAXWNGFNKPVN* |
JGI24737J22298_101541811 | 3300001990 | Corn Rhizosphere | MKPYILGAIIIWFLCGFTGAVLLGQQRVDIPTISGGPIALWNG |
JGI24743J22301_100682051 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVDIPTIVGGPI |
JGI24738J21930_100042381 | 3300002075 | Corn Rhizosphere | MKPYILGAIIVWFLCGFGGAVLLRQQRLDVPTIVGGPFSLWNGL |
C688J35102_1205200812 | 3300002568 | Soil | MKPYILGAIIIWFVCGIAGAVLLGQQRVDVPTIAGGPVSLWSGLNKPVDK* |
C688J35102_1206797343 | 3300002568 | Soil | MKPYIIGTICLWFICGITGAVLLGQQRVDIPTIAGGPIALWDGLNKPVN* |
C688J35102_1207677472 | 3300002568 | Soil | MKPYILGAIIVWFVCGIAGAVLLGQQRVDVPTIIGGPITLWHGLNKPVD* |
C688J35102_1209400462 | 3300002568 | Soil | MKPYIIGAICVWFICGITGAVLLGQDRVDIPTIAGGPIALWNGLNKPVD* |
C688J35102_1209562431 | 3300002568 | Soil | MKPYIFTAIAVWFICGITGAALLGQDHVDIPTTAGGPIALWNGLNAPVD* |
C688J35102_1209867319 | 3300002568 | Soil | MKPYILGAIIVWFVCGIAGAVLLGQKRVDIPTIIGGPITLWHGLNKPVD* |
soilH1_100290772 | 3300003321 | Sugarcane Root And Bulk Soil | MKPYILGAIIVWFVCGFAGAILLGQQRVDIPTIAGGPIALWNGLNKPVDN* |
rootL2_103705692 | 3300003322 | Sugarcane Root And Bulk Soil | MKPYILGAICVWFICGITGAALLGQQRVDIPTIAGGPIALWNGLNKPVDN* |
soilH2_103703002 | 3300003324 | Sugarcane Root And Bulk Soil | SSGEAAMKPYILGAIIVWFVFGIAGAVMLGQQRVDIPTIAGGPIAFWNGLNKPVN* |
Ga0058694_10201903 | 3300003848 | Agave | MKPYILGAICVWFLCGFAGAYLLGQQRVDIPTISGGPIALWNGLNAPPNN* |
Ga0063454_1000715533 | 3300004081 | Soil | MKPYILGVIIVWFVCGIAGAALLGQQRVDIPTIAGGPIALWNGLNKPVD* |
Ga0062593_1001339303 | 3300004114 | Soil | MKPYILGAIIVWFLCGFGGAVLLRQQRLDVPTIVGGPFSLWNGLNSPVTD* |
Ga0062593_1032030772 | 3300004114 | Soil | MKPYIIGAICIWFVCGIVGAALLGQQRIDIPTIAGGPITLWHGLNKPVDD* |
Ga0063455_1013162962 | 3300004153 | Soil | MKPYILGAICVWFVCGIVGAAMLHQQRLDIRTIAGGPITLWHGFNKPAGE* |
Ga0063356_1017614421 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKPYILGAIILWFLFGIAGAVLLGQQRVHIPTIAGGPITFWKGLNEPVD* |
Ga0062595_1000427013 | 3300004479 | Soil | MKPYILGAICIWFVCGVVGAALLGQQRVDIPTIAGGPIALWNGLNKPIDS* |
Ga0062595_1009881891 | 3300004479 | Soil | MKPYILGAIVIWFVCGFVGAALLGQQRVDIPTIAGGPIALWNGLN |
Ga0062595_1016312481 | 3300004479 | Soil | MKPYILGAICVWLVCGIAGAWLLEQQRVDLPTIAGGPFTLWSGLNKPLE* |
Ga0062595_1019745112 | 3300004479 | Soil | MKPYILGAICIWFVCGVVGAALLGQQRVEIPTIAGGPIALWNGLNKPIDS* |
Ga0062591_1003926212 | 3300004643 | Soil | MKPYILGAIIVWFVCGIAGAVLLGQQRVDIPTISGGPIALWNGLNKTVN* |
Ga0062594_1003253592 | 3300005093 | Soil | MKPYIIGAIIIWFACGFTGAALQHQQRVDIPTISGGPIALWNGLNKPVD* |
Ga0062594_1008210791 | 3300005093 | Soil | MKPYIIGAIIVWFLCGFTGAVLLGQQRLDIPTISGGPIALWNGLNKPVD* |
Ga0062594_1015107361 | 3300005093 | Soil | MKPYILGAIIIWFAFGIAGAVLLGQQRVDIPTIAGGPIAFWNGLNAPVN* |
Ga0062594_1018279812 | 3300005093 | Soil | MKPYILGAIIIWFLCGFTGAVLLGQQRVDIPTISGGPIALWNGLNKPVN* |
Ga0062594_1021600902 | 3300005093 | Soil | MKPYILGAIIIWFVCGFVGAALLGQQRIDIPTIAGGPIALWNGFNKPVN* |
Ga0066818_10231361 | 3300005104 | Soil | MKPYIIGAIIVWFGCGFTGAALQHQQRIDIPTIAGGPIALWNGLNEPVD* |
Ga0066819_10084932 | 3300005148 | Soil | MKPYILGAICMWFISGIVGAALLGQQRVDIPTIAGGPITFWHGLNKPVDN* |
Ga0066673_103906201 | 3300005175 | Soil | MKPYILGAICIWFISGFAGAVLLGQQRLDIPTIAGGPIALWNGLNKPVE* |
Ga0066679_109593212 | 3300005176 | Soil | CVWFICGIAGAVLLGQQRVDIPTIAGGPITLWNGFNKPVDN* |
Ga0066678_107251192 | 3300005181 | Soil | SGAMKPYILIAICVWFICGIVGAVMLGQQRLDIPTIAGGPITLWNGLNQPVDD* |
Ga0066671_101897232 | 3300005184 | Soil | MKPYILGAICVWFICGIAGAALLGQRRVDIRTIAGGPIALWNGLNKPVDG* |
Ga0066671_102570013 | 3300005184 | Soil | MKPYILGAISIWFVCGVVGAALLGQQRVDIPTIAGGPIALWNGLNKPIDS* |
Ga0066676_103307773 | 3300005186 | Soil | MKPYIFLAIGVWFTCGIVGAVMLGQQRIDIATIAGGPIALWNGFNQPVDK* |
Ga0066676_107537481 | 3300005186 | Soil | WLAGSGWRSAMKPYILGAIIVWFLCGFAGAVLLGQQRIDIPTICGGPIALWNGLNKPVDN |
Ga0074071_10566661 | 3300005258 | Soil | MKPYIIGAICVWLLLGVLGAVMLGQQRVDIGTIVRGPLAFWDGLNKPVDS* |
Ga0070658_100499233 | 3300005327 | Corn Rhizosphere | MKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVNN* |
Ga0070658_100667713 | 3300005327 | Corn Rhizosphere | MKPYIIGAICVWFICGITGAVMLGQKHVDVPTIAGGPIALWNGLNKPVND* |
Ga0070658_100853422 | 3300005327 | Corn Rhizosphere | MKPYIIGAICVWFVCGIVGAAMLGQQRVDVRTISGGPITLWNGLNQPVDK* |
Ga0070658_101922602 | 3300005327 | Corn Rhizosphere | MKPYILGAICVWFICGLAGAVLLGQHRVDVLTIAGGPITLWNGINKPVDQ* |
Ga0070658_102260092 | 3300005327 | Corn Rhizosphere | MKPYIIGAICVWLLFGLVGAVLLGQQRVDIGTIVRGPLAFWDGLNKPVDS* |
Ga0070658_104812042 | 3300005327 | Corn Rhizosphere | MKPYILGAICVWFICGIAGAALLGQQRVDIPTIAGGPITLWNGLNKPVDE* |
Ga0070658_105504202 | 3300005327 | Corn Rhizosphere | MKPYILGAICVWFVCGIIGAVMLGQQRVDIPTIAGGPIALWNGFNKPVN* |
Ga0070658_105637892 | 3300005327 | Corn Rhizosphere | MKPYILGAIIVWFTCGIVGAVMLGQSRVDVPTIVGGPITLWNGLNNPTYG* |
Ga0070658_106338492 | 3300005327 | Corn Rhizosphere | MKPYILGAICVWFICGIAGAALLGQDRLDIPTIAGGPIALWNGLNKPVD* |
Ga0070658_106478422 | 3300005327 | Corn Rhizosphere | MKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGPIALWNGFNKPVNG* |
Ga0070658_107873091 | 3300005327 | Corn Rhizosphere | MKPYILGAICVWFISGLAGTWLLGEQRLDVPKICGGPITLWNGFNVPVD* |
Ga0070658_108172252 | 3300005327 | Corn Rhizosphere | MKPYIIGAIIVWFLCGIAGAVLLGQTRVDIPTIAGGPIALWNGLNARPNG* |
Ga0070658_109276862 | 3300005327 | Corn Rhizosphere | MKPYILGAICVWVLSGIVGAVLLGQQRVDIPTIAGGPITLWSGLNKPVDD* |
Ga0070658_112591211 | 3300005327 | Corn Rhizosphere | MKPYILGAICVWFISGLAGTWLLGEQHLDVAKVCGGPITLWNGFNAPPN* |
Ga0070658_116964412 | 3300005327 | Corn Rhizosphere | GESGKEAAMKPYILGAMCVWLMLGVVGAVMLGQQRVDIRTIVRGPLAFWDGLNKPVGS* |
Ga0070658_118784601 | 3300005327 | Corn Rhizosphere | MKPYIIGAICVWFVCGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDS* |
Ga0070658_120035751 | 3300005327 | Corn Rhizosphere | MRYVIAVICVWLLFGVVGAILLGQQHVDFATIVRGPMAFWDGLNKPVD* |
Ga0070683_1003728652 | 3300005329 | Corn Rhizosphere | MKPYIIGAICVWFVSGIAGAVMLGQQRADIPTICGGPIALWNGLNKP |
Ga0070683_1023277771 | 3300005329 | Corn Rhizosphere | MKPYIIGAICVWFMSGIAGAVLLGQQRVDIPTICGGPIALWNGLNAPVDS* |
Ga0070670_1000423156 | 3300005331 | Switchgrass Rhizosphere | MKPYIIGAICVWFVCGIVGAVLLGHQSVDIPTIAGGPMTLWNGLNKPVDD* |
Ga0070670_1000670483 | 3300005331 | Switchgrass Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVDIPTIAGGPITLWHGLNKPVDG* |
Ga0066388_1031296442 | 3300005332 | Tropical Forest Soil | MKPYVVGAMILWLASGFVGAWLEGQQRVDIATIASGPIAFWSGLNKPVN* |
Ga0070666_101063203 | 3300005335 | Switchgrass Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVDIPTIVGGPITLWHGLNKPVD |
Ga0070666_104194121 | 3300005335 | Switchgrass Rhizosphere | MKPYILGAICVWFVCGIVGAVMLGQQRVHIPTIAGGPITLWEGFNQPVNG* |
Ga0070666_107055452 | 3300005335 | Switchgrass Rhizosphere | MKPYIYGAIIIWFVMGIAGAALLGRHKLDVPTIAGGPITLWNGLNRPVDS* |
Ga0070680_1000208608 | 3300005336 | Corn Rhizosphere | MKPYILGAICVWFVSGLAGTWMLGEQHIDIPKICGGPITLWNGFNAPPSD* |
Ga0070680_1000232456 | 3300005336 | Corn Rhizosphere | VRPYIIGAIIMWLLAGVAGAVLLGQQRVDIVTIAGGPVALWNGFNKPVDS* |
Ga0070680_1001830682 | 3300005336 | Corn Rhizosphere | MKPYILGAICVWFVSGLAGTWLLGEHHVDIPKICGGPITLWNGFNAPVD* |
Ga0070680_1004939512 | 3300005336 | Corn Rhizosphere | MKPYIIGAICVWLLLGVLGAVMLGQQRVDIGTIVRGPLAFWDGLNKPVDD* |
Ga0070680_1005339322 | 3300005336 | Corn Rhizosphere | MKPYIIGAICVWFVCGIVGAAMLGQQRVDVRTISGGPITLWNGLNAPVDK* |
Ga0070680_1009225651 | 3300005336 | Corn Rhizosphere | AMKPYIIGAICVWFVCGIVGAAMLGQQRVDVRTISGGPITLWNGLNQPVDK* |
Ga0070682_1010335652 | 3300005337 | Corn Rhizosphere | AICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVNN* |
Ga0070660_1000675443 | 3300005339 | Corn Rhizosphere | MKPYILGAIIVWFVCGIAGAVLLGQQRVDIPTISGGPIALWNGLNKPVN* |
Ga0070660_1001267131 | 3300005339 | Corn Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRVHIPTIAGGPITLWHGPVDG* |
Ga0070660_1001673113 | 3300005339 | Corn Rhizosphere | VMKPYIIGAICIWFVCGIVGAALLGQQRIDIPTIAGGPITLWHGLNKPVDD* |
Ga0070660_1002254992 | 3300005339 | Corn Rhizosphere | MKPYILGAIIVWFVCGIAGAVLLGQQRVDIPTICGGPISLWNGLNRPVGN* |
Ga0070660_1010906751 | 3300005339 | Corn Rhizosphere | MKPYILGAIIVWFLCGCAGAVLLGQQRVDVPTIAGGPIALWNGLNKPVD* |
Ga0070660_1015765981 | 3300005339 | Corn Rhizosphere | MKPYILGAICVWFVCGIAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVDN* |
Ga0070660_1018431102 | 3300005339 | Corn Rhizosphere | YIIGAIIVWLVCGVVGAVLLGQQRVDIPTIAGGPIALWNGLNKPVN* |
Ga0070661_1009659362 | 3300005344 | Corn Rhizosphere | VWFLCGCAGAVLLGQQRVDVPTIAGGPIALWNGLNKPVN* |
Ga0070692_101272232 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYIIGAICVWFVSGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVES* |
Ga0070692_110480341 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYVLGAIIIWFLCGFTGAVLLGQQRVDIPTISGGPIALWNGLNKPVN* |
Ga0070668_1009535782 | 3300005347 | Switchgrass Rhizosphere | MKPYIYGAIIIWFVMGIAGAALLGQHKLDVPTIAGGPITLWNGLNRPVDS* |
Ga0070669_1010010741 | 3300005353 | Switchgrass Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRVDIPTIAGGPITLWHGLNKPVDG* |
Ga0070671_1000449712 | 3300005355 | Switchgrass Rhizosphere | MKPYILGAICVFFVGAAMLHQQRLDIRTIAGGPITLWHGFNEPVDP* |
Ga0070671_1002002181 | 3300005355 | Switchgrass Rhizosphere | MKPYIIGAICVWFVCGIVGAVLLDQQSVDIPTIAGGPMTLWNGLNKPVDD* |
Ga0070671_1004170302 | 3300005355 | Switchgrass Rhizosphere | MKPYILGAICVWFTFGIVGAVLLGQQSVDIGTIAGGPMTLWNGLNKPVDH* |
Ga0070671_1005832651 | 3300005355 | Switchgrass Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVDIPTIVGGPITLWHGLNKPVDG* |
Ga0070674_1007637672 | 3300005356 | Miscanthus Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRIDIPTIAGGPITLWHGLNKPVD* |
Ga0070688_1008287311 | 3300005365 | Switchgrass Rhizosphere | ESQEGSAMKPYILGAICIWFVCGVVGAALLGQQRVDIPTIAGGPIALWNGLNKPIDS* |
Ga0070659_1000075019 | 3300005366 | Corn Rhizosphere | MKPYVLGAIIVWFLCGCAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVD* |
Ga0070659_1007528572 | 3300005366 | Corn Rhizosphere | VAGLGWGGVMKPYILGAIIVWFVCGIAGAVLLGQQRVDIPTICGGPISLWNGLNRPVGN* |
Ga0070659_1010881892 | 3300005366 | Corn Rhizosphere | MKPYIIGAICVWFVCGITGAVMLGQQRVDVPTISGGPISLWKGLNKPLDK* |
Ga0070659_1014265622 | 3300005366 | Corn Rhizosphere | MKPYILGAICVWFICGIVGAVLLGQQSVDIPTIAGGPMTLWHGFNKPVDQ* |
Ga0070667_1001556381 | 3300005367 | Switchgrass Rhizosphere | MKPYILGAICVWFLSGIAGAVMLGQQRFDIPTIAGGPITFWNGLNKPVDN* |
Ga0070667_1007031952 | 3300005367 | Switchgrass Rhizosphere | MKPYILGAICVFFVGAAMLHQQRLDIRTIAGGPITLWHGFNEPV |
Ga0070709_108339491 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EGAMKPYILGAISVWFICGIVGAAMLGEQTVDIPTIAGGPITLWNGFNRPADN* |
Ga0070714_1000175756 | 3300005435 | Agricultural Soil | MKPYILGAIIVWFICGIAGAGLLGQQRFDIPTIAGGPIALWNGLNRPVD* |
Ga0070714_1000904582 | 3300005435 | Agricultural Soil | MKPYIIGAICVWFICGITGAVLLGQQRVDVATIAGGPITLWNGFNKPTNNNN* |
Ga0070714_1000909832 | 3300005435 | Agricultural Soil | MKPYIIGAICIWLIAGVIGAAMLGQQRIDVASICGGPITLWNGFNKPVNN* |
Ga0070714_1002037662 | 3300005435 | Agricultural Soil | MKPYIIGAICVWFICGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDS* |
Ga0070714_1002427422 | 3300005435 | Agricultural Soil | MKPYIIGAICVWFVSGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDS* |
Ga0070714_1002888522 | 3300005435 | Agricultural Soil | MKPYILGAICVWFLLGIAGAVMMGQQRVDIPTIAGGPVAFWNGLNQPVGG* |
Ga0070714_1002912972 | 3300005435 | Agricultural Soil | MKPYILGAICVWFACGIIGSVMLGEQRVDVPKIIGGPITLWQGFNKPVS* |
Ga0070714_1008103382 | 3300005435 | Agricultural Soil | MKPYIIGAICVWFVTGLAGTWMLGEQRLDIPKICGGPMTLWNGFNAPP |
Ga0070713_1000226084 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAICVWFICGIVGAAMLGEQTVDIPTIAGGPITLWNGFNRPADN* |
Ga0070710_105983201 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPFIIGAICVWFICGIAGAALLGQQRLDIPTIAGGPIALWNGLNKPVNE* |
Ga0070701_113516261 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAIIIWFLCGFTGAVLLGQQRVDIPTTSGGPIALWNGLNKPVN* |
Ga0066681_109332131 | 3300005451 | Soil | MKPYILGAIIVWFVCGIVGAWMLGQQRVDIPTIVGGPITLWHGLNK |
Ga0070663_1000537434 | 3300005455 | Corn Rhizosphere | MKPYILGAICVWFVCGIIGAVMLGQQRVDIPTIAGGPIALWNGFN |
Ga0070663_1002333982 | 3300005455 | Corn Rhizosphere | MKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVND* |
Ga0070678_1023910812 | 3300005456 | Miscanthus Rhizosphere | PYILGAIIIWFLCGFTGAVLLGQQRVDIPTISGGPIALWNGLNKPVN* |
Ga0070662_1004626162 | 3300005457 | Corn Rhizosphere | MKPYIIGAIIVWFGCGFTGAALQHQQRVDIPTIAGGPIALWNGLNEPVD* |
Ga0070662_1007882672 | 3300005457 | Corn Rhizosphere | IIGAIIVWLVCGVVGAVLLGQQRVDIPTIAGGPIALWNGLNKPVN* |
Ga0070681_105973982 | 3300005458 | Corn Rhizosphere | PYILGAIIIWFAFGIAGAVLLGQQRVDIPTIAGGPIAFWNGLNAPVN* |
Ga0068867_1007901152 | 3300005459 | Miscanthus Rhizosphere | QEGSAMKPYILGAICIWFVCGVVGAALLGQQRVDIPTIAGGPIALWNGLNKPIDS* |
Ga0068867_1011912202 | 3300005459 | Miscanthus Rhizosphere | WEGIPMKPYIIGAIIVWFGCGFTGAALQHQQRIDIPTIAGGPIALWNGLNEPVD* |
Ga0070741_103131262 | 3300005529 | Surface Soil | MKPYILGAICVWFICGIVGAAMLGQQRVDIPTIAGGPIALWNGFNKPTDN* |
Ga0070679_1001398931 | 3300005530 | Corn Rhizosphere | GAICVWFISGLAGTWLLGEQHLDVAKVCGGPITLWNGFNAPPN* |
Ga0070679_1006627012 | 3300005530 | Corn Rhizosphere | MKPYIIGAICVWFICGITGAVMLGQKHVDVPTIAGGPIALWNGLNKPVNN* |
Ga0070679_1006815862 | 3300005530 | Corn Rhizosphere | IGAICVWFVCGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDS* |
Ga0070679_1015838942 | 3300005530 | Corn Rhizosphere | GAIIVWLVCGVVGAVLLGQQRVDIPTIAGGPIALWNGLNKPVN* |
Ga0070739_100082507 | 3300005532 | Surface Soil | MKPYIIGAICVWFISGIVGAVMLGQQRVDIPTIAGGPITFWNGLNKPVDQ* |
Ga0070739_100266903 | 3300005532 | Surface Soil | MKPYILGAICVWFISGVAGAVMLGQQRLDVPTIIGGPMTFWNGLNNPVDR* |
Ga0070739_100447742 | 3300005532 | Surface Soil | VKPYILGAICVWFICGIVGSMMLGEQRVDIPTIAGGPIALWNGFNQPVN* |
Ga0070739_105011852 | 3300005532 | Surface Soil | MKPYIIGAICVWFLSGIAGAILLGQQRVDIPTICGGPIALWNGLNAPVDH* |
Ga0068853_1005481012 | 3300005539 | Corn Rhizosphere | MKPYIIGAICVWFLSGIAGAVLLGQQRVDIPTICGGPIALWNGLNAPVDS* |
Ga0070672_1019951841 | 3300005543 | Miscanthus Rhizosphere | VMKPYILGAICVWLVCGIAGAWLLEQQRVDLPTIAGGPFTLWSGLNKPLE* |
Ga0070693_1012737211 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYIIGAIIVWFLCGFTGAVLLGQQRLDIPTLSGGPIALWNGLNKPVD* |
Ga0070665_1015385882 | 3300005548 | Switchgrass Rhizosphere | MSSEAVMKPYILGAICVWLVCGIAGAWLLEQQRVDLPTIAGGPFTLWSGLNKPLE* |
Ga0070665_1015811832 | 3300005548 | Switchgrass Rhizosphere | MKPYIYGAIIIWFVMGIAGAALLGQHKLDVPTIAGGPITLWHGLNKPVGA* |
Ga0070665_1024933211 | 3300005548 | Switchgrass Rhizosphere | DHGRSALEMKPYILGAIIIWFLCGFTGAVLLGQQRVDIPTISGGPIALWNGLNKPVN* |
Ga0066704_109316911 | 3300005557 | Soil | MKPYILVAISVWFVCGIVGAVLLGQQRFDIPTIAGGPITLWNGLNAPVND* |
Ga0068855_1002203363 | 3300005563 | Corn Rhizosphere | MKPYILGAICLWFICGIVGAVMLGQQRIDIPTIAGGPIALWNGFNKPTN* |
Ga0068855_1002421183 | 3300005563 | Corn Rhizosphere | MKPYVLGAICVWFICGIAGAALLGQQRVDIPTIAGGPIALWNGLNRPLDS* |
Ga0068855_1009683132 | 3300005563 | Corn Rhizosphere | MKPYILGAICVWFVCGIIGAVMLGQQRVDIPTIAGGPIA |
Ga0068855_1012360802 | 3300005563 | Corn Rhizosphere | MKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVN |
Ga0068855_1012894482 | 3300005563 | Corn Rhizosphere | CVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVNN* |
Ga0068855_1014077961 | 3300005563 | Corn Rhizosphere | MKPYILGAICVWFISGIAGAALLGQDRLDIPTIAGGPIALWNGLNKPVD* |
Ga0068855_1019993591 | 3300005563 | Corn Rhizosphere | MKPYILGAICVWFACGIIGAVMLGQQRVDVPTIAGGPIALWNGFNKPVN* |
Ga0068855_1022599071 | 3300005563 | Corn Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRVDIPTIVGGPITLWHGL |
Ga0068855_1026063471 | 3300005563 | Corn Rhizosphere | CVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVNG* |
Ga0070664_1017878091 | 3300005564 | Corn Rhizosphere | MKPYILGAICVWFICGIAGAVMLGQQHVDVPTIAGGPITFWNGLNKPVDH* |
Ga0070664_1020780972 | 3300005564 | Corn Rhizosphere | MKPYIIGAICVWFVSGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDG* |
Ga0066693_102849081 | 3300005566 | Soil | MKPYILVAIGVWFICGIVGAVLLGQQRFDIPTIAGGPIALWNGLNVPVND* |
Ga0066703_108015901 | 3300005568 | Soil | MKPYIIGAICVWFICGIAGAALLGRQTVDIPTIAGGPIALWNGLNKPVNN* |
Ga0066702_107410561 | 3300005575 | Soil | MKPYILGAICVWFICGIAGAALLGRQTVDIPTIAGGPISLWNGLNKPVNN* |
Ga0066702_109787212 | 3300005575 | Soil | YIIGAICVWFICGVVGGVLLGQRHVDIPTIAGGPIALWNGLNQPVEG* |
Ga0068857_1014512682 | 3300005577 | Corn Rhizosphere | MKPYIIGAICVWFVSGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDS |
Ga0068854_1000445885 | 3300005578 | Corn Rhizosphere | MKPYILGAIIVWFLCGCAGAVLLGQQRVDVPTIAGGPIALWNGLNKPVN* |
Ga0068854_1005703993 | 3300005578 | Corn Rhizosphere | IIVWLVCGVVGAVLLGQQRVDIPTIAGGPIALWNGLNKPVN* |
Ga0068854_1006172622 | 3300005578 | Corn Rhizosphere | MKPYIIGAIIVWLVCGVVGAVLLGQQRVDIPTIAGGPIALWN |
Ga0068854_1018296842 | 3300005578 | Corn Rhizosphere | MKPYILGAIIVWFTMGITGAALLGQQRLDIPTIAGGPIALWNGLN |
Ga0068856_1001448182 | 3300005614 | Corn Rhizosphere | MKPYILGAIAVWFICGIVGAVMLGQSRVDVPTIVGGPISLWNGFNNPNYG* |
Ga0068856_1008132081 | 3300005614 | Corn Rhizosphere | MKPYIIGAICIWLIAGVVGAAMLGQQRIDVASICGGPITLWNGFNKPVNN* |
Ga0068856_1008820782 | 3300005614 | Corn Rhizosphere | MKPYIIGAICVWFLCGIAGAVMLGQQRIDIPTICGGPIALWNGLNKPVDS* |
Ga0068856_1011176351 | 3300005614 | Corn Rhizosphere | MKPYIIGAICVWFVCGITGAVLLGQQRVDVGTICGGPITLWNGFNKPVNN* |
Ga0068856_1015298502 | 3300005614 | Corn Rhizosphere | MKPYIIGAICTWFICGIVGAAMLGQQRVDISTIAGGPITLWNGFNKPVDN* |
Ga0068856_1018331051 | 3300005614 | Corn Rhizosphere | MKPYILGAICVWFVSGLAGTWLLGEQRLDVPKICGGPITLWNGFNAPVD* |
Ga0068856_1021552932 | 3300005614 | Corn Rhizosphere | MKPYILGAIIVWFTCGIVGAVMLGQSRVDVPTIVGGPISLWNGLNNPTYG* |
Ga0068852_1000199545 | 3300005616 | Corn Rhizosphere | MKLYIIGAICVWFMSGIAGAVLLGQQRVDIPTICGGPIALWNGLNAPVDN* |
Ga0068852_1003706202 | 3300005616 | Corn Rhizosphere | MKPYILGAISIWFALGIAGAVLLGQQRVDIPTIAGGPIAFW |
Ga0068852_1006151491 | 3300005616 | Corn Rhizosphere | MRLFILGAIVVWFLFGIAGAVLLGQQSVDVRTIASG |
Ga0068852_1008338001 | 3300005616 | Corn Rhizosphere | PYILGAICVWFISGLAGTWLLGEQRLDVPKICGGPITLWNGFNVPVD* |
Ga0068852_1021185731 | 3300005616 | Corn Rhizosphere | MKPYILGAIIVWFTMGITGAALLGQQRLDIPTIAGGPIALWNGLNRDP* |
Ga0068864_1000155156 | 3300005618 | Switchgrass Rhizosphere | MKPYILGAICVWFVCGIVGAVLLGQQSVDIPTIAGGPMTLWKGFNKPVGD* |
Ga0068864_1013339112 | 3300005618 | Switchgrass Rhizosphere | AMKPYILGAIIVWFVCGIVGAWMLGQQRVDIPTIAGGPITLWHGLNKPVDG* |
Ga0068861_1022537701 | 3300005719 | Switchgrass Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVHIPTIAGGPI |
Ga0066903_1076792211 | 3300005764 | Tropical Forest Soil | MKPYIIGAMILWLVCGFVGAWLEGQQRVDIATIASGPIAFWNGLNEPVD* |
Ga0068851_100222235 | 3300005834 | Corn Rhizosphere | MKPYIIGAIIVWLVCGVVGAVLLGQQRVDIPTIAGGPIALWNGLNKPVN* |
Ga0068858_1010587262 | 3300005842 | Switchgrass Rhizosphere | EGTAMKPYILGAIIVWFVCGIVGAWMLGQQRVDIPTIVGGPITLWHGLNKPVDG* |
Ga0070717_100406931 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAISVWFICGIVGAAMLGEQTVDIPTIAGGPITLWNGFNRPADN* |
Ga0070717_107031892 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAICVWFICGITGAVMLGQQRVDVPTIAGGPITLWNGLNKPVDD* |
Ga0066652_1013815322 | 3300006046 | Soil | MKPYILGAIFVWFLSGIAGAVMLGQQRVDIPTIAGGPITFWSGLNKPVDN* |
Ga0070716_1000398934 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAISVWFICGIVGAAMLGEQTVDIPTIAGGPITLWNGFNRP |
Ga0070712_1000556702 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYIIGAIILWFVCGIAGAWLLGQQRVDIPTIAGGPITLFNGLNKPVDH* |
Ga0068871_1016925351 | 3300006358 | Miscanthus Rhizosphere | MKPYILGAIIIWFLCGFTGAVLLGQQRVDIPTISGGPI |
Ga0066660_100512984 | 3300006800 | Soil | MKPYILGAICVWFVCGFAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVN* |
Ga0079221_102550492 | 3300006804 | Agricultural Soil | MKPYILGAIIIWFGFGIAGAILLGQQRVDIPTISGGPIAFWNGLNAPVN* |
Ga0079221_102814942 | 3300006804 | Agricultural Soil | MKPYIIGAICVWFTSGIVGAALLGQQRVDVPTIAGGPIALWNGLNKPVN* |
Ga0079221_109472681 | 3300006804 | Agricultural Soil | GRAAMKPYILGAIIIWFGFGIAGAVLLGQQRVDIPTIAGGPIAFWNGLNAPVN* |
Ga0079221_117433301 | 3300006804 | Agricultural Soil | MKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGPIALWNGFNK |
Ga0079220_117475341 | 3300006806 | Agricultural Soil | MKPYILGAIIIWFAFGIAGAILLGQQRVDIPTIAGGPIAFWNGLNAPVN* |
Ga0079217_103626812 | 3300006876 | Agricultural Soil | MKPYIIGAIIVWFLCGITGAVMLGQKGVHIPTIAGGPMTLWKGFNKPVS* |
Ga0074063_101205732 | 3300006953 | Soil | MKPYILGAICMWFISGIVGAALLGEQRVDIPTIAGGPITFWHGLNKPVDN* |
Ga0066710_1006633173 | 3300009012 | Grasslands Soil | MKPYILVAICVWFISGIAGAVLLGQQRVDIPTIAGGPMTLWNGLNTPVGK |
Ga0105240_108950691 | 3300009093 | Corn Rhizosphere | MKPYIPGAICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVNG* |
Ga0066709_1007679721 | 3300009137 | Grasslands Soil | VWFVCGIVGAVLLGQQRFDIPTIAGGPITLWNGLNEPVNN* |
Ga0066709_1008455213 | 3300009137 | Grasslands Soil | AICVWFISGIAGAVLLGQQRVDIPTIAGGPMTLWNGLNTPVDK* |
Ga0105242_126204351 | 3300009176 | Miscanthus Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRVDIPTIAGGPITLWHGLNKPVD* |
Ga0105248_100747954 | 3300009177 | Switchgrass Rhizosphere | MIPYIIGAIIVWFGCGFTGAALQHQQRVDIPTIAGGPIALWNGLNEPVD* |
Ga0105249_131210082 | 3300009553 | Switchgrass Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRVHIPTIAGGPITLWHGLNRPVDG* |
Ga0126308_108511561 | 3300010040 | Serpentine Soil | MKPYILGAIIVWFVMGIAGAVLLGQQRADLPTIAGGPISLWSGLNKPVDN* |
Ga0134063_101581272 | 3300010335 | Grasslands Soil | MKPYILGAICVWFICGIAGAVLLGQQRVDIPTIAGGPITLWNGLNEPVDN* |
Ga0134128_101129912 | 3300010373 | Terrestrial Soil | VKPYILGAICVWFICGIVGAMLLGEQRVDIPTIAGGPIALWNGLNKPVD* |
Ga0105239_102326993 | 3300010375 | Corn Rhizosphere | MKPYILGAICVWFICGIAGATLLGQDRLDIPTIAGGPIALWNGLNKPVD* |
Ga0105239_112708271 | 3300010375 | Corn Rhizosphere | AICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGCNKPVNN* |
Ga0105239_122902862 | 3300010375 | Corn Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRVDIPTIVGGPITLWHGLNKPVDG* |
Ga0134126_104799112 | 3300010396 | Terrestrial Soil | MKPYILGAICVWFICGIAGAALLGQDRLDIPTIAGGPIALWN |
Ga0134124_120906332 | 3300010397 | Terrestrial Soil | IIWFVCGFVGAALLGQQRIDIPTIAGGPIALWNGFNKPVN* |
Ga0134127_126864372 | 3300010399 | Terrestrial Soil | MKPYILGATPPPLVCGIIGAVMLGQQRVDIPTIAGGPIALWNGFNKPVN* |
Ga0134121_110875552 | 3300010401 | Terrestrial Soil | MKPYVLGAICVWFVCGIAGAILLGQQRVDVPTIVGGPISLWDGLNKPVN* |
Ga0151489_14045972 | 3300011106 | Soil | YILGAICMWFISGIVGAALLGEQRVDIPTIAGGPITFWHGLNKPVDN* |
Ga0137379_104288821 | 3300012209 | Vadose Zone Soil | MKPYILVAISVWFVCGIVGAVMLGQQRLDIPTIAGGPITLWNGLNAPVSD* |
Ga0137378_102435952 | 3300012210 | Vadose Zone Soil | MKPYILVTISVWFVCGIVGAVLLGQQRFDIPTIAGGPITLWNGLNTPVNN* |
Ga0150985_1071006481 | 3300012212 | Avena Fatua Rhizosphere | MKPYIIGAICVWFVCGIVGAVMLGQQHVDIPTIAGGPITLWHGLNKPVDE* |
Ga0150985_1071500552 | 3300012212 | Avena Fatua Rhizosphere | MKPYILGAICVWFTFGIVGAVLLGQQSVDIRTIAGGPMTLWNGLNKPVDH* |
Ga0150985_1126393152 | 3300012212 | Avena Fatua Rhizosphere | MKPYILGAIIVWFLCGFAGAVLLGQQRIDIPTICGGPIALWNGLNKPVDN* |
Ga0137367_102871961 | 3300012353 | Vadose Zone Soil | AMKPYILVAISVWFVCGIVGAVLLGQQRLDIPTIAGGPITLWNGLNAPVND* |
Ga0150984_1147267911 | 3300012469 | Avena Fatua Rhizosphere | MKPYILGAIVVWFVCGIAGAVLLGQQRVDVGTIAGG |
Ga0150984_1222468921 | 3300012469 | Avena Fatua Rhizosphere | TVRARRAAMKPYILGAIIIWFVCGIAGAVLLCQQRVDVPTIAGGPVSLWSGLNKPVDK* |
Ga0137359_102414743 | 3300012923 | Vadose Zone Soil | MKPYILGAICVWFICGIAGAMLLGQRRLDIPTIAGGPITLWDGLNKPVGN* |
Ga0164298_101683992 | 3300012955 | Soil | MKPYILGAIIIWFLCGIIGAVLLGQQRVDIPTIAGGPMTLWKGLNKPVN* |
Ga0164298_110930232 | 3300012955 | Soil | MKPYILGAIIIWFVCGIVGAMLLHQDRLDIPTLAGGQITLWKGFNQPGDG* |
Ga0164303_104635861 | 3300012957 | Soil | MKPYILGAICVWFTCGIVGAAMLGQQRVQIPTIAGGPIALWNGFNKP |
Ga0164299_103827611 | 3300012958 | Soil | MKPYILGAIIIWFVCGIVGAMLLHQDRVDMPTIAGGPITLWKGFNQPVDG* |
Ga0164299_111288041 | 3300012958 | Soil | IIVWFGCGFTGAALQHQQRIDIPTIAGGPIALWNGLNEPVD* |
Ga0164299_116466881 | 3300012958 | Soil | MKPYIIGAIIVWFVCGIAGAFLLGEQHVDIPTIAGGPIALWNGLNRPVN* |
Ga0164301_115893172 | 3300012960 | Soil | MKPDIITDIGVWFICGIAGAALLGQQRVDVATIAGGPIALWNGLNAPVD* |
Ga0164302_105893282 | 3300012961 | Soil | MKPYILGAIIIWFLCGIIGAVLLGQQRVDVPTIAGGPISLWKGLNKPVN* |
Ga0164302_106533241 | 3300012961 | Soil | MKPYVLGAIIVWFLCGCAGAVLLGQQRVDVPTIAGGPIALWNGLNKPVN* |
Ga0164302_110517422 | 3300012961 | Soil | MKPYILGAICIWFTCGIVGAALLGQQRVHIPTIAGGPIALWNGLNKPVS* |
Ga0164302_112935982 | 3300012961 | Soil | MKPYVIGAIIVWVICGIVGAWMLGQQKLDIPTIAGGPFTLARGFSQPANQ* |
Ga0164308_123071221 | 3300012985 | Soil | MKPYILGAIIVWFLCGCAGAVLLGQQRVDVPTIAGGPIAL |
Ga0164304_109142772 | 3300012986 | Soil | MKPYIIGAIIVWFVCGIAGAFLLGEQRVDIPTIAGGPIALWNGLNRPVN* |
Ga0164305_103039762 | 3300012989 | Soil | MKPYILGAIIIWFVCGIVGAMLLHQDRLDIPTIAGGPITLWKGFNQPVDG* |
Ga0164305_104555611 | 3300012989 | Soil | PFRALIRVRSATMKPYVLGAIIVWFLCGCAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVD* |
Ga0157373_102535791 | 3300013100 | Corn Rhizosphere | MKPYILGAIIIWFVCGFVGAALLGQQRIDIPTIAGGPIALWNG |
Ga0157373_103691642 | 3300013100 | Corn Rhizosphere | MKPYILGGSRVRKISGIAGAVLLGQQRVDIPTIAGGPIALWHGLDKPVD* |
Ga0157373_110919102 | 3300013100 | Corn Rhizosphere | MKPYILGAIIVWFTCGVVGAVMLGQSRVDVPTIVGGPISLWNGFNNPTYG* |
Ga0157373_113702942 | 3300013100 | Corn Rhizosphere | GEAAMKPYIIGAICVWFVCGITGAVMLGQQRVDVPTISGGPISLWKGLNKPIDK* |
Ga0157373_115114142 | 3300013100 | Corn Rhizosphere | GRMKPYILGAICVWFVSGLAGTWMLGEQHIDIPKICGGPITLWNGFNAPPSD* |
Ga0157373_115681832 | 3300013100 | Corn Rhizosphere | YILGAICVWFISGIAGAVMLGQDRIDVPTICGGPIAFWHGLNKPVDD* |
Ga0157371_100149084 | 3300013102 | Corn Rhizosphere | MKPYIMGAICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVNN* |
Ga0157371_101730192 | 3300013102 | Corn Rhizosphere | MKPYIIGAICVWFVSGIAGAIMLGQQRVDIPTICGGPIALWNGLNKPVDS* |
Ga0157371_102004591 | 3300013102 | Corn Rhizosphere | RRREVRPYIIGAIIMWLLAGVAGAVLLGQQRVDIVTIAGGPVALWNGFNKPVDS* |
Ga0157371_104042632 | 3300013102 | Corn Rhizosphere | MKPYILGAICVWFVCGIIGAVMLGQQRVDIPTIAGGPIAWWNGFNKPVN* |
Ga0157371_109136012 | 3300013102 | Corn Rhizosphere | MKPYILGAICVWFVCGIGGAVLLHQQRVDIPTIAGGPMALWKGLNEPIGE* |
Ga0157371_110165492 | 3300013102 | Corn Rhizosphere | MKPYILGAICVWFVCGIVGAVLLGQQRVDIPTICGGPMTLWNGFNAPVDH* |
Ga0157370_103241462 | 3300013104 | Corn Rhizosphere | MKPYILGAICVWFICGIAGAALLGQDRLDIPTIAGGPIALWNGL |
Ga0157370_108119801 | 3300013104 | Corn Rhizosphere | VRPYIVGAIIMWLLAGVAGAVLLGQQRVDIVTIAGGPVALWNGFNKPVDS* |
Ga0157370_109933742 | 3300013104 | Corn Rhizosphere | MKPYILGAICLWFICGIVGAVMLGQQRIDIPTFAGGPIALWNGFNKPTN* |
Ga0157370_114278081 | 3300013104 | Corn Rhizosphere | GAICVWFVCGITGAVMLGQQRVDVPTISGGPISLWKGLNKPLDK* |
Ga0157370_119393582 | 3300013104 | Corn Rhizosphere | MKPYILGAIIVWFLCGCAGAVLLGQQRVDVPTIAGGPI |
Ga0157370_121047782 | 3300013104 | Corn Rhizosphere | GAICVWFVCGIIGAVMLGQQRVDIPTIAGGPIALWNGFNKPVN* |
Ga0157369_100529212 | 3300013105 | Corn Rhizosphere | MKPYILGAICVWFTCGIVGAAMLGQQRIDTATIAGGPITLWNGFNKPVGN* |
Ga0157369_102794342 | 3300013105 | Corn Rhizosphere | MKPYIIGAICVWFISGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDS* |
Ga0157369_104018682 | 3300013105 | Corn Rhizosphere | MAAMKPYIIGAICVWFMSGIAGAVLLGQQRVDIPTICGGPIALWNGLNAPVDS* |
Ga0157369_107319972 | 3300013105 | Corn Rhizosphere | MKPYILGAICVWFVCGIAGAVLLGQQRVDIPTIAGGPI |
Ga0157378_124917081 | 3300013297 | Miscanthus Rhizosphere | MKPYVLGAICVWFVCGIAGAILLGQQRVDVPTIAGGPISLWDGLNKPVN* |
Ga0163162_115945471 | 3300013306 | Switchgrass Rhizosphere | AMKPYIYGAIIIWFVMGIAGAALLGQHKLDVPTIAGGPITLWHGLNKPVDG* |
Ga0157372_113824361 | 3300013307 | Corn Rhizosphere | MKPYIIGAICVWFVSGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVAS* |
Ga0157372_123562201 | 3300013307 | Corn Rhizosphere | AIERESLAMKTYIIGAICVWLICGIVGAVLLGQQRVDVPTIASGPIALWKGFNKPVDE* |
Ga0163163_132855712 | 3300014325 | Switchgrass Rhizosphere | VWFVCGIVGAVLLGQQSVDIPTIAGGPMTLWKGFNKPVGD* |
Ga0157377_106919941 | 3300014745 | Miscanthus Rhizosphere | LGAIIIWFLCGFTGAVLLGQQRVDIPTISGGPIALWNGLNKPVN* |
Ga0132258_102864063 | 3300015371 | Arabidopsis Rhizosphere | MKPYILGAIVIWFVCGFVGAALLGQQRVDIPTIAGGPIALWNGLNKPID* |
Ga0132258_115484482 | 3300015371 | Arabidopsis Rhizosphere | MKPYIIGAICVWFVCGIVGAVLLDQQSVDIPTIAGGPMTLWKGFNKPVGD* |
Ga0132256_1025720321 | 3300015372 | Arabidopsis Rhizosphere | GIPMKPYIIGAIIIWFACGFTGAALQHQQRVNIPTIAGGPIALWNGLNRPVD* |
Ga0132257_1036128092 | 3300015373 | Arabidopsis Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVDIPTIVGGPITLWHGVNKPVDG* |
Ga0132255_1014717682 | 3300015374 | Arabidopsis Rhizosphere | MKPYILGAIIVWFLCGFAGAVLLGQQRVDIPTISGGPIALWNGLNRPVNN* |
Ga0187809_101929492 | 3300017937 | Freshwater Sediment | MKPFIIGAICVWFVCGIAGAALLGQQRIDIPTIAGGPIALWNGFNRPLDN |
Ga0190272_102506371 | 3300018429 | Soil | MKPYIIGAICVWFICGITGAVMLGQKGVHIPTIAGGPMTLWKGFNKPVN |
Ga0066667_103254122 | 3300018433 | Grasslands Soil | AISVWFVCGIVGAVLLGQQRFDIPTIAGGPITLWNGLNEPVNN |
Ga0066662_104121252 | 3300018468 | Grasslands Soil | MKPYILGAICVWFICGFAGAVLLGQQRVDVPTIAGGPIALWNGLNKPVN |
Ga0066662_104433622 | 3300018468 | Grasslands Soil | MKPYILGAICVWFVCGFAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVN |
Ga0066662_106497142 | 3300018468 | Grasslands Soil | MKPYIIGAICVWFICGIAGAVMLGQQRVDIPTIAGGPITLWNGLNKPVDH |
Ga0066662_113118872 | 3300018468 | Grasslands Soil | MKPYIIGAICVWFICGVVGGVLLGQRHVDIPTIAGGPIALWNGLNQPVEG |
Ga0066662_117613422 | 3300018468 | Grasslands Soil | MKPYILVAISVWFVCGIVGAVLLGQQRFDIPTIAGGPITLWNGLNEPVKD |
Ga0066662_125398122 | 3300018468 | Grasslands Soil | MKPYIITAICVWFVCGIAGAVLLGQQRVDVGTICGGPIALWAGLNEPVN |
Ga0066669_124361192 | 3300018482 | Grasslands Soil | MKPYILGAIIMWFLCGFAGAVLLGQQRVDVPTIAGGPIALWNGLNKPVD |
Ga0190273_119323132 | 3300018920 | Soil | FMKPYIIGAIIVWFLCGITGAVMLGQKGVHIPTIAGGPMTLWKGFNKPVN |
Ga0197907_102703802 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LAMKTYIIGAICVWLICGIVGAVLLGQQRVDVPTIASGPIALWKGFNKPVDE |
Ga0206356_105129383 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAICVWFISGLAGTWLLGEQHLDVAKVCGGPITLWNGFNAPPN |
Ga0206356_109588741 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAICVWFVCGIIGAVMLGQQRVEIPTIAGGPIALWNGFNKPVN |
Ga0206354_100528223 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | EAMKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGPIALWNGFNKPVNG |
Ga0206354_104472882 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAICVWFVCGIIGAVMLGQQRVDIPTIAGGPIALWNGFNKPVN |
Ga0206354_113117001 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYIIGAICVWFVCGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDS |
Ga0206353_108804602 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | YIIGAICVWLICGIVGAVLLGQQRVDVPTIASGPIALWKGFNKPVDE |
Ga0182009_104682442 | 3300021445 | Soil | MKPYILGAICVWFISGIAGAVLLGQQRVDVPTIAGGPIALWNGLNRPVDN |
Ga0182009_106991551 | 3300021445 | Soil | MKPYILGAICVWFICGIAGAVLLGQNRVDVPTIAGGPISLWNGLNKPVND |
Ga0207697_101259352 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAIIVWFLCGFGGAVLLRQQRLDVPTIVGGPFSLWNGLNSPVTD |
Ga0207697_102797651 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAICIWFVCGVVGAALLGQQRVDIPTIAGGPIALWNGLNKPIDS |
Ga0207656_100239672 | 3300025321 | Corn Rhizosphere | MKPYIIGAIIVWLVCGVVGAVLLGQQRVDIPTIAGGPIALWNGLNKPVN |
Ga0207656_101173683 | 3300025321 | Corn Rhizosphere | MKPYIIGAIIVWFLCGFTGAVLLGQQRLDIPTISGGPIALWNGLNKPVD |
Ga0207656_101560802 | 3300025321 | Corn Rhizosphere | MKPYILGAICVWFICGIAGAALLGQQRVDIPTIAGGPITLWNGLNKPVDE |
Ga0207656_101777562 | 3300025321 | Corn Rhizosphere | MSSEAVMKPYILGAICVWLVCGIAGAWLLEQQRVDLPTIAGGPFTLWSGLNKPLE |
Ga0207682_104058811 | 3300025893 | Miscanthus Rhizosphere | MKPYIIGAICIWFVCGIVGAALLGQQRIDIPTIAGGPITLWHGLNKPVDD |
Ga0207642_103849613 | 3300025899 | Miscanthus Rhizosphere | MKPYIIGAICIWFVCGIVGAALLGQQRIDIPTIAGGPITLWHGL |
Ga0207642_104892691 | 3300025899 | Miscanthus Rhizosphere | MKPYILGAIIIWFLCGFTGAVLLGQQRVDIPTISGGPIALWNGLNKPVN |
Ga0207647_100092322 | 3300025904 | Corn Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRVHIPTIAGGPITLWHGPVDG |
Ga0207647_100146195 | 3300025904 | Corn Rhizosphere | MKPYIIGAICVWLLLGVLGAVMLGQQRVDIGTIVRGPLAFWDGLNKPVDD |
Ga0207647_100378245 | 3300025904 | Corn Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVDIPTIAGGPITLWHG |
Ga0207647_101110341 | 3300025904 | Corn Rhizosphere | MKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVNN |
Ga0207647_102268192 | 3300025904 | Corn Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVDIPTIVGGPITLWHGLNKPVDG |
Ga0207645_107438621 | 3300025907 | Miscanthus Rhizosphere | MKPYIIGAICVWLLLGVLGAVMLGQQRVDIGTIVR |
Ga0207705_100072915 | 3300025909 | Corn Rhizosphere | MKPYILGAICVWLVCGIAGAWLLEQQRVDLPTIAGGPFTLWSGLNKPLE |
Ga0207705_100654643 | 3300025909 | Corn Rhizosphere | MKPYIIGAICVWFICGITGAVMLGQKHVDVPTIAGGPIALWNGLNKPVND |
Ga0207705_101087823 | 3300025909 | Corn Rhizosphere | MKPYIIGAICVWFVCGIVGAAMLGQQRVDVRTISGGPITLWNGLNQPVDK |
Ga0207705_101528422 | 3300025909 | Corn Rhizosphere | MKPYILGAICVWFICGLAGAVLLGQHRVDVLTIAGGPITLWNGINKPVNQ |
Ga0207705_104000211 | 3300025909 | Corn Rhizosphere | MKPYIIGAICVWFISGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDG |
Ga0207705_105974032 | 3300025909 | Corn Rhizosphere | MKPYILGAIIVWFTCGIVGAVMLGQSRVDVPTIVGGPITLWNGLNNPTYG |
Ga0207705_106051052 | 3300025909 | Corn Rhizosphere | MKPYIIGAICVWLLLGVLGAVMLGQQRVDIGTIVRGPLAFWDGLNKPVDS |
Ga0207705_108815302 | 3300025909 | Corn Rhizosphere | MKPYIIGAIIVWFLCGIAGAVLLGQTRVDIPTIAGGPIALWNGLNARPNG |
Ga0207705_111915152 | 3300025909 | Corn Rhizosphere | MKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGPIALWNGFNKPVNG |
Ga0207705_115391791 | 3300025909 | Corn Rhizosphere | MKPYIIGAICVWLLFGVVGAVLLGQQRVDIGTIARGPAAFWDGLNKPVDS |
Ga0207654_100837063 | 3300025911 | Corn Rhizosphere | MKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVND |
Ga0207707_113349321 | 3300025912 | Corn Rhizosphere | MKPYILGAICVWFICGIAGAALLGQDRLDIPTIAGGPIAL |
Ga0207693_114008781 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYIIGAIIVWFVCGIAGAALLGQQRVDIPTIAGGPIALWNGLNKPVGD |
Ga0207663_116684142 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAIIVWFICGIVGAALLGQQRVDIPTIAGGPIALWNGLNKPVN |
Ga0207660_100786044 | 3300025917 | Corn Rhizosphere | VRPYLIGAIIMWFLAGLAGAVLLGQQRVDIATIASGPVALWSGFNKPIDS |
Ga0207660_101256602 | 3300025917 | Corn Rhizosphere | VRPYIIGAIIMWLLAGVAGAVLLGQQRVDIVTIAGGPVALWNGFNKPVDS |
Ga0207660_101470114 | 3300025917 | Corn Rhizosphere | MKPYILGAICVWFVSGLAGTWMLGEQHIDIPKICGGPITLWNGFNAPPSD |
Ga0207660_106576021 | 3300025917 | Corn Rhizosphere | MKPYILGAICVWFVSGLAGTWLLGEHHVDIPKICGGPITLWNGFNAPVD |
Ga0207657_100708851 | 3300025919 | Corn Rhizosphere | MKPYILGAIIILFGFGIAGAVLLGQQRVDIPTIAGGPIAFWNGLNAPVN |
Ga0207657_100806143 | 3300025919 | Corn Rhizosphere | MKPYILGAICVWFVCGIAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVDN |
Ga0207657_100878813 | 3300025919 | Corn Rhizosphere | MKPYILGAIIVWFVCGIAGAVLLGQQRVDIPTISGGPIALWNGLNKPVN |
Ga0207657_100955182 | 3300025919 | Corn Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVHIPTIAGGPITLWHGPVDG |
Ga0207657_101761972 | 3300025919 | Corn Rhizosphere | MKPYILGAIIVWFLCGCAGAVLLGQQRVDVPTIAGGPIALWNGLNKPVD |
Ga0207657_102194972 | 3300025919 | Corn Rhizosphere | MKPYILGAIIVWFVCGIAGAVLLGQQRVDIPTICGGPISLWNGLNRPVGN |
Ga0207657_110717881 | 3300025919 | Corn Rhizosphere | SARVEREGAMKPYILGAICVWFVSGLAGTWLLGEHHVDIPKICGGPITLWNGFNAPVD |
Ga0207649_101814441 | 3300025920 | Corn Rhizosphere | IIWFAFGIAGAVLLGQQRVDIPTIAGGPIAFWNGLNAPVN |
Ga0207649_104111212 | 3300025920 | Corn Rhizosphere | MKPYVLGAIIVWFLCGCAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVD |
Ga0207649_105196411 | 3300025920 | Corn Rhizosphere | MKPYIIGAICVWFICGITGAVLLGQQRVDVATIAGGPIT |
Ga0207649_107234662 | 3300025920 | Corn Rhizosphere | SSRVSSREEAMKPYIIGAICVWFICGITGAVLLGQQRVDVATIAGGPITLWNGFNKPTNNNN |
Ga0207681_115703811 | 3300025923 | Switchgrass Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVDIPTIAGGPITLWHGLNKPVDG |
Ga0207700_102083542 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAICVWFICGIVGAAMLGEQTVDIPTIAGGPITLWNGFNRPADN |
Ga0207700_105919261 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAICVWFACGIIGSVMLGEQRVDVPKIIG |
Ga0207700_112156681 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYILGAIIVWFICGIAGAGLLGQQRFDIPTIAGGPIALWNGLNRPVD |
Ga0207664_100177344 | 3300025929 | Agricultural Soil | MKPYIIGAICIWLIAGVIGAAMLGQQRIDVASICGGPITLWNGFNKPVNN |
Ga0207664_103094122 | 3300025929 | Agricultural Soil | MKPYIIGAICVWFICGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDS |
Ga0207701_104358641 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPYIYGAIIIWFVMGIAGAALLGQHKLDVPTIAGGPITLWN |
Ga0207644_100033329 | 3300025931 | Switchgrass Rhizosphere | MKPYILGAICVFFVGAAMLHQQRLDIRTIAGGPITLWHGFNEPVDP |
Ga0207644_101205771 | 3300025931 | Switchgrass Rhizosphere | LGAIIIWFLCGFTGAVLLGQQRVDIPTISGGPIALWNGLNKPVN |
Ga0207644_101553851 | 3300025931 | Switchgrass Rhizosphere | MKPYIIGAIIVWFGCGFTGAALQHQQRVDIPTIAGGPIALWNGLNEPVD |
Ga0207644_104658152 | 3300025931 | Switchgrass Rhizosphere | MKPYILGAICVWFVCGIVGAAMLHQQRLDIRTIAGGPITLWHGFNKPAGE |
Ga0207690_101374971 | 3300025932 | Corn Rhizosphere | KPYILGAIIVWFVCGIAGAVLLGQQRVDIPTICGGPISLWNGLNRPVGN |
Ga0207690_102986572 | 3300025932 | Corn Rhizosphere | MKPYIIGAICVWFVSGIAGAIMLGQQRVDIPTICGGPIALWNGLNKPVDS |
Ga0207690_106019752 | 3300025932 | Corn Rhizosphere | YILGAICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVNN |
Ga0207690_109550382 | 3300025932 | Corn Rhizosphere | ILGAIIVWFVCGIAGAVLLGQQRVDIPTISGGPIALWNGLNKPVN |
Ga0207690_115858862 | 3300025932 | Corn Rhizosphere | MKPYILGAICVWFICGIAGAALLGQQRVDIPTIAGGPITL |
Ga0207706_102786073 | 3300025933 | Corn Rhizosphere | MKPYILGAIIVWFVCGIAGAVLLGQQRVDIPTISGGPIALWNGLNKTVN |
Ga0207706_106728251 | 3300025933 | Corn Rhizosphere | MKPYILGAICVWVLSGIVGAVLLGQQRVDIPTIAGGPITLWSGLNKPVDD |
Ga0207686_112238942 | 3300025934 | Miscanthus Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRVDIPTIAGGPITLWHGLNKPVD |
Ga0207669_104104712 | 3300025937 | Miscanthus Rhizosphere | MKPYILGAIIVWFVCGIVGAWMLGQQRIDIPTIAGGPITLWHGLNKPVD |
Ga0207711_114431061 | 3300025941 | Switchgrass Rhizosphere | MKPYIIGAICIWFVCGIVGAALLGQQRIDIPTIAGGPIT |
Ga0207661_105279272 | 3300025944 | Corn Rhizosphere | MKPYIIGAICVWFVSGIAGAVMLGQQRADIPTICGGPIALWNGLNKPVDS |
Ga0207667_100440414 | 3300025949 | Corn Rhizosphere | AICVWFICGIVGAVMLGQQRVDVATIAGGPISLWNGFNKPVNN |
Ga0207667_100836432 | 3300025949 | Corn Rhizosphere | VRPYIVGAIIMWLLAGVAGAVLLGQQRVDIVTIAGGPVALWNGFNKPVDS |
Ga0207667_103263333 | 3300025949 | Corn Rhizosphere | GAICVWFISGLAGTWLLGEQHLDVAKVCGGPITLWNGFNAPPN |
Ga0207667_112576122 | 3300025949 | Corn Rhizosphere | IIIWFVCGIVGAWMLGQQRVDIPTIAGGPITLWHGLNKPVDD |
Ga0207668_105268522 | 3300025972 | Switchgrass Rhizosphere | MKPYIYGAIIIWFVMGIAGAALLGQHKLDVPTIAGGPITLWNGLNRPVDS |
Ga0207640_101472203 | 3300025981 | Corn Rhizosphere | MKPYILGAICVWFICGIAGAALLGQQRVDIPTIAGGPITLWNGLNKP |
Ga0207640_117033881 | 3300025981 | Corn Rhizosphere | MKPYILGAIIVWFLCGCAGAVLLGQQRVDVPTIAGGPIALWNGLNKPVN |
Ga0207640_120314891 | 3300025981 | Corn Rhizosphere | MKPYILGAICVWFICGIAGAVLLGQQRVDIATISGGPITLWTGLNKPVD |
Ga0207677_100250426 | 3300026023 | Miscanthus Rhizosphere | MRAFILGAIVVWFLFGIAGAILLGQQRIEVRTIASGPIAFWHGLDKPGQQMTSLGRAGT |
Ga0207639_101489203 | 3300026041 | Corn Rhizosphere | CVWFVCGIIGAVMLGQQRVDIPTIAGGPIALWNGFNKPVN |
Ga0207639_118841601 | 3300026041 | Corn Rhizosphere | MKPYIIGAICVWFLSGIAGAVLLGQQRVDIPTICGGPIALWNGLNAPVDS |
Ga0207678_100336382 | 3300026067 | Corn Rhizosphere | MKPYIIGAIIVWFLCGFTGAVLLGQQRLDIPTISGGPIALWNGLNKPVN |
Ga0207702_100739251 | 3300026078 | Corn Rhizosphere | MKPYIIGAICVWFLCGIAGAVMLGQQRIDIPTICGGPIALWNGLNKPVDS |
Ga0207702_100952572 | 3300026078 | Corn Rhizosphere | MKPYILGAIAVWFICGIVGAVMLGQSRVDVPTIVGGPISLWNGFNNPNYG |
Ga0207702_104250492 | 3300026078 | Corn Rhizosphere | AICVWFVSGIAGAVMLGQQRVDIPTICGGPIALWNGLNKPVDS |
Ga0207702_105656182 | 3300026078 | Corn Rhizosphere | DRMKPYILGAICVWFISGLAGTWLLGEQHLDVAKVCGGPITLWNGFNAPPN |
Ga0207702_107215432 | 3300026078 | Corn Rhizosphere | MKPYILGAICVWFVCGIVGSVMLGEQRVDVPKIVGGPITLWTGFNQPVGN |
Ga0207702_109751011 | 3300026078 | Corn Rhizosphere | MKPYIIGAICVWFLSGIAGAVLLGQQRVDIPTICGGPIALWNGLNAPVDN |
Ga0207702_110179161 | 3300026078 | Corn Rhizosphere | MKPYIIGAICVWFVCGITGAVLLGQQRVDVGTICGGPITLWNGFNKPVNN |
Ga0207702_113351072 | 3300026078 | Corn Rhizosphere | MKPYIIGAICIWLIAGIVGAAMLGQQRIDVATICGGPISLWNGFNKPVNN |
Ga0207702_115680521 | 3300026078 | Corn Rhizosphere | MKPYIIGAICTWFICGIVGAAMLGQQRVDISTIAGGPITLWNGFNKPVDN |
Ga0207702_123373141 | 3300026078 | Corn Rhizosphere | MKPYILGAICVWFISGLAGTWLLGEQHLDVAKVCGGPITLWNGFNAP |
Ga0207641_100079226 | 3300026088 | Switchgrass Rhizosphere | MKPYILGAICVWFVCGIVGAVLLGQQSVDIPTIAGGPMTLWKGFNKPVGD |
Ga0207641_109447642 | 3300026088 | Switchgrass Rhizosphere | MKPYILGAICLWFGCGFVGAAMLRQQRLDIRTIAGGPITLWHGFNEPVDP |
Ga0207648_112794512 | 3300026089 | Miscanthus Rhizosphere | QEGSAMKPYILGAICIWFVCGVVGAALLGQQRVDIPTIAGGPIALWNGLNKPIDS |
Ga0207676_102829714 | 3300026095 | Switchgrass Rhizosphere | ICVWFVCGIVGAVLLDQQSVDIPTIAGGPMTLWNGLNKPVDD |
Ga0207675_1019792612 | 3300026118 | Switchgrass Rhizosphere | AMKPYILGAIIVWFVCGIVGAWMLGQQRVDIPTIVGGPITLWHGLNKPVDG |
Ga0207698_100007518 | 3300026142 | Corn Rhizosphere | MKLYIIGAICVWFMSGIAGAVLLGQQRVDIPTICGGPIALWNGLNAPVDN |
Ga0207698_102743853 | 3300026142 | Corn Rhizosphere | RPYIIGAIIMWLLAGVAGAVLLGQQRVDIVTIAGGPVALWNGFNKPVDS |
Ga0207698_111088771 | 3300026142 | Corn Rhizosphere | VRPYIVGAIIMWLLAGVAGAVLLGQQRVDIVTIAGGPVALWNGFNKP |
Ga0207698_111472791 | 3300026142 | Corn Rhizosphere | SGREAAMKPYILGAIIIWFAFGIAGAVLLGQQRVDIPTIAGGPIAFWNGLNAPVN |
Ga0207570_10141921 | 3300026944 | Soil | MKPYIIGAIIVWLVCGVVGAVLLGQQRVDIPTIAGGPIA |
Ga0209461_100171631 | 3300027750 | Agave | MKPYIIGAICVWLVCGLAGAVLLGQQRIDIPTIAGGPIALWNGFNKPVND |
Ga0209796_100061423 | 3300027766 | Agave | MKPYIIGAICVWFLFGIAGAVLLGQQRVDVATICGGPIAFWNGLNAPVD |
Ga0209796_100375241 | 3300027766 | Agave | MKPYILGAICVWFACGFAGAYLLGQQRVDIPTICGGPMTLWNGFNAPVDH |
Ga0209796_100444172 | 3300027766 | Agave | MKPYILGAICVWFISGFAGAFLLGQDRVDVPTICGGPISFWHGLNKPVDD |
Ga0209796_100508122 | 3300027766 | Agave | MKPYILGAICVWFACGFAGAYLLGQQRVDIPTICGGPMTLWNGLNKPLDS |
Ga0209796_100576371 | 3300027766 | Agave | MKSYIIGAICVWLLSGVAGAVMLGQQRLDVRTICGGPMTFWAGLNRPADQ |
Ga0209796_101077332 | 3300027766 | Agave | MKPYILGAIIVWFACGIVGAVMLGQQRVDVPTISGGPMTLWAGFNEPVQH |
Ga0209796_101364902 | 3300027766 | Agave | MKPYILGAIIVWFVCGIAGAVLLGQQRVDVPTIVGGPITLWNGFNKPVNG |
Ga0209796_101625472 | 3300027766 | Agave | MKPYILGAICVWFLFGIAGAILLGQQRVDVPTLCGGPISFWNGLNKPVDQ |
Ga0209796_103097582 | 3300027766 | Agave | MKPYILGAICVWFLCGFAGAYLLGQQRVDIPTISGGP |
Ga0209810_10264423 | 3300027773 | Surface Soil | MKPYIIGAICVWFISGIVGAVMLGQQRVDIPTIAGGPITFWNGLNKPVDQ |
Ga0209810_10340103 | 3300027773 | Surface Soil | MKPYILGAICVWFISGVAGAVMLGQQRLDVPTIIGGPMTFWNGLNNPVDR |
Ga0209810_10422744 | 3300027773 | Surface Soil | VKPYILGAICVWFICGIVGSMMLGEQRVDIPTIAGGPIALWNGFNQPVN |
Ga0268266_110677362 | 3300028379 | Switchgrass Rhizosphere | AMKPYIYGAISIWFVMGIAGAALLGQHKVDVSTIAGGPITLWHGLNKPVGA |
Ga0268266_111611941 | 3300028379 | Switchgrass Rhizosphere | MKPYIIGAIIVWFLCGIAGAVLLGQTRVDVPTIAGGPIALWNGLNARPNG |
Ga0268266_116617992 | 3300028379 | Switchgrass Rhizosphere | MKRHILGAIALWFLFGIAGAVLLGQQRVDLPTLAKG |
Ga0268265_116222861 | 3300028380 | Switchgrass Rhizosphere | LESQEGSAMKPYILGAICIWFVCGVVGAALLGQQRVDIPTIAGGPIALWNGLNKPIDS |
Ga0268264_124841362 | 3300028381 | Switchgrass Rhizosphere | MKPYILGAIIIWFVCGIVGAWMLGQQRVDIPTIAGGPITLWHGLNKPVDD |
Ga0268240_100283652 | 3300030496 | Soil | MKPYILGAICVWFICGITGAVLLGQQRVDIPTIAGGPIALWNGLNKPVDG |
Ga0268241_100502011 | 3300030511 | Soil | MKPYILGAIIVWFTMGITGAALLGQQRVDIPTIAGGPIALWNGLNEPVN |
Ga0268241_101262491 | 3300030511 | Soil | ILGAIIVWFICGIVGAVLLGQQRVDVPTIIGGPVSLWKGLNQPVDS |
Ga0307408_1002318482 | 3300031548 | Rhizosphere | MKPYILGTIILWFLFGIAGAVLLGQQRVHIPTIAGGPITFWKGLNEPVD |
Ga0307408_1006607812 | 3300031548 | Rhizosphere | MKPYILGAIILWFLFGIAGAVLLGQQRVHIPTIAGGPITFWKGLNEPVD |
Ga0307408_1016116531 | 3300031548 | Rhizosphere | IILWFLFGIAGAVLLGQQRVHIPTIAGGPITFWKGLNEPVD |
Ga0308175_1000223463 | 3300031938 | Soil | MKPYILGAIIIWFAFGIAGAVLLGQQRVDIPTISAGPIAFWNGLNQPVN |
Ga0308175_1000285974 | 3300031938 | Soil | MKPYIIGAICVWFLMGIVGAVLLGQQRVDVPTIVGGPMTLWNGLNKPVDHEAS |
Ga0308175_1000497492 | 3300031938 | Soil | MKPYIIGAIIVWFVCGIVGAWMLGQQKLDIPTIAGGPFTLARGFSQPANQ |
Ga0308175_1000747042 | 3300031938 | Soil | MKPYIIGAICVWFVCGIVGAAMLGQQSVDVRTISGGPITLWNGLNKPVD |
Ga0308175_1006728681 | 3300031938 | Soil | VKPYILGAICIWFLAGAAGAVLLGQQRVDLPTIAAGPISLWNGFDKPVEG |
Ga0308175_1006845012 | 3300031938 | Soil | MKPYILGAICVWFVSGLAGTWLLGEQHLDVAKICGGPITLWNGFNAPPNG |
Ga0308175_1012766801 | 3300031938 | Soil | VRSATMKPYILGAIIVWFLCGCAGAVLLGQQRVDVPTIAGGPIALWNGLNKPVN |
Ga0308175_1016935482 | 3300031938 | Soil | MKPYILGAIIIWFVCGIVGAALLHQDRFDIPTIAGGPITLWKGFNKPVD |
Ga0308175_1021015942 | 3300031938 | Soil | MKPYILGAIIVWFACGFAGAALLGQQRINIPTIAGGPIALWNGLNKPLDE |
Ga0308175_1024914001 | 3300031938 | Soil | MKPYILGAIIVWFIMGIAGAVLLGQQRVDIPTISGGPIALWNGLNKPVS |
Ga0308175_1027078302 | 3300031938 | Soil | MKPYIIGAICVWFICGIVGAAMLGQQRVDVRTIAGGPITFWNGLNKPVDK |
Ga0308174_100012782 | 3300031939 | Soil | MKPYIIGAICVWFLMGIVGAVLLGQQRVDVPTIIGGPMTLWNGLNKPLDHEAS |
Ga0308174_101330563 | 3300031939 | Soil | MKPYIIGAICVWFACGIVGAVMLGQQRVDVPTLIGGPITLANGFEKPVD |
Ga0308174_104079272 | 3300031939 | Soil | MKPYILGAIIVWFVCGIIGAVMLGQQRIDIATIAGGPLTLWNGFNKPVS |
Ga0308174_104972542 | 3300031939 | Soil | MKPYILGAIIVWFVCGVTGAVLLGQQHVDVSTIAGGPISLWNGLNAPVDS |
Ga0308174_117865341 | 3300031939 | Soil | MKPYILGAIIVWFLCGCAGAVLLGQQRVDVPTIAGGP |
Ga0308176_102124792 | 3300031996 | Soil | MKPYIIGAICVWFICGITGAVLLGQQRVDVATIAGGPITLWNGFNKPTNNNN |
Ga0308176_106567042 | 3300031996 | Soil | KPYILGAICVWFVSGLAGTWLLGEQHLDVAKICGGPITLWNGFNAPPNG |
Ga0308176_108980832 | 3300031996 | Soil | MKPYILGAICVWFICGIVGAVMLGQQRVDVATIAGGP |
Ga0308176_109240361 | 3300031996 | Soil | MKPYILGAICVWFACGITGAVMLGQQRVDVPTILGGPITL |
Ga0308176_115342482 | 3300031996 | Soil | MKPYIILAICIWFICGITGAALLGQQGVDVATIAGGPIALWNGLNQPVD |
Ga0308176_121258991 | 3300031996 | Soil | MKPYILGAICVWFVSGLAGTWLLGEQHLDVAKICGGPITLWNGFNAPPN |
Ga0308176_121901722 | 3300031996 | Soil | MKPYILGAIIVWFVMGIAGAVLLGQQRVDIPTISGGPIALWNGLNKPVN |
Ga0308173_104478372 | 3300032074 | Soil | MKPYILGAIIVWFLCGCAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVN |
Ga0308173_105528861 | 3300032074 | Soil | MKPYILGAICVWFVSGLAGTWLLGEQRLDVPKICGGPITLWNGFNAPVD |
Ga0308173_114600062 | 3300032074 | Soil | ICVWFICGIAGAALLGQDRLDIPTIAGGPIALWNGLNKPVD |
Ga0308173_120438112 | 3300032074 | Soil | MKPYILGAICVWFVCGIVGSVMLGEQRVDVPKIVGGPITLWT |
Ga0308173_122361011 | 3300032074 | Soil | PLCLPSTVRGGAMKPYILGAIAIWFVSGIVGAWMLGQQRVDIPTIAGGPITFWNGLNRPVDH |
Ga0310810_103569583 | 3300033412 | Soil | MKPYIIGAIIVWLVCGVVGAVLLGQQRVDIPTIAGGPIALWNGLNKPV |
Ga0310810_114528022 | 3300033412 | Soil | MKPYIIGAICVWFVCGITGAVMLGQQRVDVPTISGGPISLWKGLNKPLDK |
Ga0310811_110543662 | 3300033475 | Soil | ILGAIIIWFAFGIAGAVLLGQQRVDIPTIAGGPIAFWNGLNAPVN |
Ga0334939_0011803_2936_3088 | 3300034175 | Biocrust | MKPYIIGAICVWFICGITGAVMLGQKGVHIPTIAGGPMTLWKSFNKPIDK |
Ga0372943_0022210_882_1034 | 3300034268 | Soil | MKPYILGAICIWFVCGFAGAVLLGQQRVDIPTIAGGPIALWNGLNKPVDN |
Ga0372943_0070737_1790_1942 | 3300034268 | Soil | MKPYIIGAICAWFICGVAGAVLLGQKHVDIPTIARGPIALWNGLNKPVNE |
Ga0373950_0121531_398_550 | 3300034818 | Rhizosphere Soil | MKPYILGAIIIWFVCGIVGAMLLHQDRLDIPTIAGGPITLWKGFNQPVDG |
⦗Top⦘ |