Metagenome / Metatranscriptome Family F004317

Basic Information
Family ID	F004317
Family Type	Metagenome / Metatranscriptome
Number of Sequences	443
Average Sequence Length	42 residues
Representative Sequence	KVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Number of Associated Samples	143
Number of Associated Scaffolds	440

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	2.48 %
% of genes near scaffold ends (potentially truncated)	98.42 %
% of genes from short scaffolds (< 2000 bps)	100.00 %
Associated GOLD sequencing projects	139
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.41

Most Common Taxonomy
Group	Unclassified (99.097 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (58.013 % of family members)
Environment Ontology (ENVO)	Unclassified (87.585 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (85.102 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.85% β-sheet: 0.00% Coil/Unstructured: 59.15%
Feature Viewer

Powered by Feature Viewer

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
All Organisms	root	All Organisms	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
cellular organisms	root	All Organisms → cellular organisms	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.45 %
Chloridoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae	0.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.45 %
Eragrostideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae	0.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.45 %
Eragrostidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae	0.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.45 %
Eragrostis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis	0.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.45 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.45 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.23 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.10 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.45 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.23 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004479\|Ga0062595_102662024	Not Available	503	Open in IMG/M
3300005330\|Ga0070690_100874189	Not Available	701	Open in IMG/M
3300005335\|Ga0070666_11104696	Not Available	589	Open in IMG/M
3300005355\|Ga0070671_100586879	Not Available	962	Open in IMG/M
3300005355\|Ga0070671_101536178	Not Available	589	Open in IMG/M
3300005365\|Ga0070688_101807913	Not Available	501	Open in IMG/M
3300005440\|Ga0070705_101875676	Not Available	510	Open in IMG/M
3300005445\|Ga0070708_101846602	Not Available	560	Open in IMG/M
3300005445\|Ga0070708_102222455	Not Available	506	Open in IMG/M
3300005618\|Ga0068864_101374360	Not Available	708	Open in IMG/M
3300005618\|Ga0068864_101675363	Not Available	640	Open in IMG/M
3300005618\|Ga0068864_102491646	Not Available	523	Open in IMG/M
3300005618\|Ga0068864_102509720	Not Available	521	Open in IMG/M
3300005618\|Ga0068864_102519450	Not Available	520	Open in IMG/M
3300005719\|Ga0068861_101554853	Not Available	650	Open in IMG/M
3300005841\|Ga0068863_100982720	Not Available	846	Open in IMG/M
3300005841\|Ga0068863_101770358	Not Available	627	Open in IMG/M
3300005841\|Ga0068863_102132609	Not Available	570	Open in IMG/M
3300005841\|Ga0068863_102474424	Not Available	528	Open in IMG/M
3300005841\|Ga0068863_102636919	Not Available	511	Open in IMG/M
3300005841\|Ga0068863_102717464	Not Available	503	Open in IMG/M
3300005842\|Ga0068858_101808938	Not Available	603	Open in IMG/M
3300005842\|Ga0068858_101936590	Not Available	582	Open in IMG/M
3300005843\|Ga0068860_101652294	Not Available	662	Open in IMG/M
3300005843\|Ga0068860_102283675	Not Available	561	Open in IMG/M
3300005843\|Ga0068860_102291689	Not Available	560	Open in IMG/M
3300005843\|Ga0068860_102550707	Not Available	530	Open in IMG/M
3300009092\|Ga0105250_10398962	Not Available	610	Open in IMG/M
3300009092\|Ga0105250_10463981	Not Available	570	Open in IMG/M
3300009177\|Ga0105248_12653076	Not Available	571	Open in IMG/M
3300009974\|Ga0105039_114257	Not Available	591	Open in IMG/M
3300009975\|Ga0105129_103556	Not Available	836	Open in IMG/M
3300009980\|Ga0105135_108761	Not Available	744	Open in IMG/M
3300009989\|Ga0105131_136025	Not Available	541	Open in IMG/M
3300009989\|Ga0105131_136784	Not Available	538	Open in IMG/M
3300009992\|Ga0105120_1051294	Not Available	523	Open in IMG/M
3300009994\|Ga0105126_1032241	Not Available	620	Open in IMG/M
3300009995\|Ga0105139_1064756	Not Available	669	Open in IMG/M
3300009995\|Ga0105139_1083499	Not Available	604	Open in IMG/M
3300009995\|Ga0105139_1107837	Not Available	538	Open in IMG/M
3300009995\|Ga0105139_1117102	Not Available	516	Open in IMG/M
3300010371\|Ga0134125_11763790	Not Available	673	Open in IMG/M
3300010371\|Ga0134125_12171167	Not Available	604	Open in IMG/M
3300010371\|Ga0134125_12386246	Not Available	575	Open in IMG/M
3300010371\|Ga0134125_12747790	Not Available	535	Open in IMG/M
3300010371\|Ga0134125_12822288	Not Available	528	Open in IMG/M
3300010373\|Ga0134128_12793848	Not Available	538	Open in IMG/M
3300010396\|Ga0134126_11493136	Not Available	745	Open in IMG/M
3300010399\|Ga0134127_11742607	Not Available	698	Open in IMG/M
3300010399\|Ga0134127_12298865	Not Available	618	Open in IMG/M
3300010399\|Ga0134127_12321505	Not Available	616	Open in IMG/M
3300010399\|Ga0134127_12429468	Not Available	604	Open in IMG/M
3300010399\|Ga0134127_12729071	Not Available	574	Open in IMG/M
3300010401\|Ga0134121_11894234	Not Available	625	Open in IMG/M
3300010403\|Ga0134123_12185105	Not Available	615	Open in IMG/M
3300010403\|Ga0134123_13400982	Not Available	514	Open in IMG/M
3300014325\|Ga0163163_12907612	Not Available	534	Open in IMG/M
3300014325\|Ga0163163_13269305	Not Available	505	Open in IMG/M
3300014968\|Ga0157379_11936734	Not Available	581	Open in IMG/M
3300014968\|Ga0157379_12035539	Not Available	568	Open in IMG/M
3300014968\|Ga0157379_12295398	Not Available	537	Open in IMG/M
3300014968\|Ga0157379_12479314	Not Available	518	Open in IMG/M
3300015270\|Ga0182183_1068024	Not Available	562	Open in IMG/M
3300015278\|Ga0182099_1052823	Not Available	555	Open in IMG/M
3300015278\|Ga0182099_1059312	Not Available	537	Open in IMG/M
3300015278\|Ga0182099_1074421	Not Available	502	Open in IMG/M
3300015280\|Ga0182100_1059712	Not Available	603	Open in IMG/M
3300015280\|Ga0182100_1068910	Not Available	574	Open in IMG/M
3300015280\|Ga0182100_1099053	Not Available	501	Open in IMG/M
3300015284\|Ga0182101_1028362	Not Available	761	Open in IMG/M
3300015284\|Ga0182101_1034055	Not Available	720	Open in IMG/M
3300015284\|Ga0182101_1062857	Not Available	592	Open in IMG/M
3300015284\|Ga0182101_1073700	Not Available	561	Open in IMG/M
3300015284\|Ga0182101_1083505	Not Available	537	Open in IMG/M
3300015284\|Ga0182101_1088629	Not Available	525	Open in IMG/M
3300015284\|Ga0182101_1094292	Not Available	513	Open in IMG/M
3300015284\|Ga0182101_1094527	Not Available	513	Open in IMG/M
3300015290\|Ga0182105_1062580	Not Available	611	Open in IMG/M
3300015290\|Ga0182105_1080411	Not Available	561	Open in IMG/M
3300015290\|Ga0182105_1080981	Not Available	559	Open in IMG/M
3300015290\|Ga0182105_1088452	Not Available	542	Open in IMG/M
3300015290\|Ga0182105_1106224	Not Available	505	Open in IMG/M
3300015293\|Ga0182103_1056509	Not Available	616	Open in IMG/M
3300015297\|Ga0182104_1037091	Not Available	755	Open in IMG/M
3300015297\|Ga0182104_1066379	Not Available	624	Open in IMG/M
3300015299\|Ga0182107_1094453	Not Available	519	Open in IMG/M
3300015301\|Ga0182184_1038063	Not Available	700	Open in IMG/M
3300015301\|Ga0182184_1055089	Not Available	620	Open in IMG/M
3300015301\|Ga0182184_1073370	Not Available	563	Open in IMG/M
3300015301\|Ga0182184_1091280	Not Available	521	Open in IMG/M
3300015301\|Ga0182184_1101522	Not Available	502	Open in IMG/M
3300015306\|Ga0182180_1027767	Not Available	782	Open in IMG/M
3300015309\|Ga0182098_1045515	Not Available	718	Open in IMG/M
3300015309\|Ga0182098_1048132	Not Available	705	Open in IMG/M
3300015309\|Ga0182098_1084335	Not Available	585	Open in IMG/M
3300015310\|Ga0182162_1010799	Not Available	1133	Open in IMG/M
3300015310\|Ga0182162_1022355	Not Available	919	Open in IMG/M
3300015310\|Ga0182162_1036540	Not Available	787	Open in IMG/M
3300015310\|Ga0182162_1055839	Not Available	685	Open in IMG/M
3300015310\|Ga0182162_1071804	Not Available	627	Open in IMG/M
3300015310\|Ga0182162_1072841	Not Available	624	Open in IMG/M
3300015310\|Ga0182162_1088301	Not Available	582	Open in IMG/M
3300015310\|Ga0182162_1112923	Not Available	530	Open in IMG/M
3300015311\|Ga0182182_1040862	Not Available	737	Open in IMG/M
3300015311\|Ga0182182_1052310	Not Available	680	Open in IMG/M
3300015311\|Ga0182182_1063874	Not Available	636	Open in IMG/M
3300015311\|Ga0182182_1080580	Not Available	586	Open in IMG/M
3300015311\|Ga0182182_1094540	Not Available	553	Open in IMG/M
3300015312\|Ga0182168_1026770	Not Available	900	Open in IMG/M
3300015312\|Ga0182168_1039873	Not Available	792	Open in IMG/M
3300015312\|Ga0182168_1056390	Not Available	704	Open in IMG/M
3300015312\|Ga0182168_1074411	Not Available	637	Open in IMG/M
3300015313\|Ga0182164_1084099	Not Available	609	Open in IMG/M
3300015313\|Ga0182164_1119949	Not Available	531	Open in IMG/M
3300015315\|Ga0182120_1071499	Not Available	651	Open in IMG/M
3300015315\|Ga0182120_1117457	Not Available	538	Open in IMG/M
3300015316\|Ga0182121_1073509	Not Available	664	Open in IMG/M
3300015316\|Ga0182121_1093641	Not Available	604	Open in IMG/M
3300015316\|Ga0182121_1095731	Not Available	599	Open in IMG/M
3300015316\|Ga0182121_1115851	Not Available	554	Open in IMG/M
3300015316\|Ga0182121_1126094	Not Available	535	Open in IMG/M
3300015316\|Ga0182121_1128163	Not Available	531	Open in IMG/M
3300015316\|Ga0182121_1139274	Not Available	513	Open in IMG/M
3300015317\|Ga0182136_1073575	Not Available	645	Open in IMG/M
3300015317\|Ga0182136_1098343	Not Available	580	Open in IMG/M
3300015317\|Ga0182136_1117987	Not Available	540	Open in IMG/M
3300015317\|Ga0182136_1141753	Not Available	501	Open in IMG/M
3300015318\|Ga0182181_1081341	Not Available	570	Open in IMG/M
3300015318\|Ga0182181_1094249	Not Available	541	Open in IMG/M
3300015319\|Ga0182130_1111790	Not Available	544	Open in IMG/M
3300015320\|Ga0182165_1032853	Not Available	874	Open in IMG/M
3300015320\|Ga0182165_1144645	Not Available	506	Open in IMG/M
3300015324\|Ga0182134_1111956	Not Available	562	Open in IMG/M
3300015324\|Ga0182134_1121855	Not Available	544	Open in IMG/M
3300015324\|Ga0182134_1138326	Not Available	517	Open in IMG/M
3300015324\|Ga0182134_1142026	Not Available	511	Open in IMG/M
3300015324\|Ga0182134_1142026	Not Available	511	Open in IMG/M
3300015325\|Ga0182148_1024581	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	932	Open in IMG/M
3300015325\|Ga0182148_1083160	Not Available	624	Open in IMG/M
3300015325\|Ga0182148_1121389	Not Available	541	Open in IMG/M
3300015325\|Ga0182148_1137265	Not Available	515	Open in IMG/M
3300015326\|Ga0182166_1021691	Not Available	962	Open in IMG/M
3300015326\|Ga0182166_1090818	Not Available	602	Open in IMG/M
3300015326\|Ga0182166_1091599	Not Available	600	Open in IMG/M
3300015326\|Ga0182166_1114607	Not Available	552	Open in IMG/M
3300015327\|Ga0182114_1063132	Not Available	732	Open in IMG/M
3300015327\|Ga0182114_1085775	Not Available	652	Open in IMG/M
3300015327\|Ga0182114_1094949	Not Available	627	Open in IMG/M
3300015327\|Ga0182114_1100865	Not Available	612	Open in IMG/M
3300015327\|Ga0182114_1106921	Not Available	599	Open in IMG/M
3300015327\|Ga0182114_1124150	Not Available	563	Open in IMG/M
3300015328\|Ga0182153_1075647	Not Available	660	Open in IMG/M
3300015328\|Ga0182153_1143237	Not Available	516	Open in IMG/M
3300015329\|Ga0182135_1022557	Not Available	997	Open in IMG/M
3300015329\|Ga0182135_1109665	Not Available	578	Open in IMG/M
3300015329\|Ga0182135_1119774	Not Available	558	Open in IMG/M
3300015329\|Ga0182135_1150505	Not Available	509	Open in IMG/M
3300015330\|Ga0182152_1126056	Not Available	547	Open in IMG/M
3300015330\|Ga0182152_1150360	Not Available	508	Open in IMG/M
3300015331\|Ga0182131_1027760	Not Available	940	Open in IMG/M
3300015331\|Ga0182131_1088388	Not Available	632	Open in IMG/M
3300015331\|Ga0182131_1111231	Not Available	577	Open in IMG/M
3300015331\|Ga0182131_1142969	Not Available	521	Open in IMG/M
3300015332\|Ga0182117_1108858	Not Available	609	Open in IMG/M
3300015332\|Ga0182117_1119340	Not Available	586	Open in IMG/M
3300015332\|Ga0182117_1147340	Not Available	535	Open in IMG/M
3300015333\|Ga0182147_1103262	Not Available	618	Open in IMG/M
3300015333\|Ga0182147_1112180	Not Available	598	Open in IMG/M
3300015334\|Ga0182132_1120032	Not Available	582	Open in IMG/M
3300015334\|Ga0182132_1135451	Not Available	553	Open in IMG/M
3300015335\|Ga0182116_1078875	Not Available	712	Open in IMG/M
3300015335\|Ga0182116_1108609	Not Available	626	Open in IMG/M
3300015335\|Ga0182116_1172191	Not Available	511	Open in IMG/M
3300015336\|Ga0182150_1117259	Not Available	581	Open in IMG/M
3300015336\|Ga0182150_1156941	Not Available	515	Open in IMG/M
3300015337\|Ga0182151_1065422	Not Available	723	Open in IMG/M
3300015337\|Ga0182151_1070383	Not Available	704	Open in IMG/M
3300015337\|Ga0182151_1126885	Not Available	563	Open in IMG/M
3300015337\|Ga0182151_1139286	Not Available	541	Open in IMG/M
3300015337\|Ga0182151_1155259	Not Available	517	Open in IMG/M
3300015337\|Ga0182151_1156978	Not Available	515	Open in IMG/M
3300015338\|Ga0182137_1120116	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	599	Open in IMG/M
3300015338\|Ga0182137_1131482	Not Available	576	Open in IMG/M
3300015338\|Ga0182137_1165337	Not Available	520	Open in IMG/M
3300015338\|Ga0182137_1169376	Not Available	515	Open in IMG/M
3300015338\|Ga0182137_1175673	Not Available	506	Open in IMG/M
3300015339\|Ga0182149_1032780	Not Available	950	Open in IMG/M
3300015339\|Ga0182149_1096064	Not Available	644	Open in IMG/M
3300015339\|Ga0182149_1110940	Not Available	608	Open in IMG/M
3300015339\|Ga0182149_1118127	Not Available	592	Open in IMG/M
3300015339\|Ga0182149_1141135	Not Available	550	Open in IMG/M
3300015339\|Ga0182149_1152444	Not Available	532	Open in IMG/M
3300015339\|Ga0182149_1153567	Not Available	530	Open in IMG/M
3300015339\|Ga0182149_1163483	Not Available	516	Open in IMG/M
3300015340\|Ga0182133_1051039	Not Available	858	Open in IMG/M
3300015340\|Ga0182133_1124336	Not Available	608	Open in IMG/M
3300015340\|Ga0182133_1158858	Not Available	547	Open in IMG/M
3300015340\|Ga0182133_1187503	Not Available	507	Open in IMG/M
3300015348\|Ga0182115_1146600	Not Available	755	Open in IMG/M
3300015348\|Ga0182115_1206575	Not Available	629	Open in IMG/M
3300015348\|Ga0182115_1246237	Not Available	569	Open in IMG/M
3300015348\|Ga0182115_1290312	Not Available	517	Open in IMG/M
3300015348\|Ga0182115_1300701	Not Available	506	Open in IMG/M
3300015348\|Ga0182115_1305933	Not Available	501	Open in IMG/M
3300015349\|Ga0182185_1113808	Not Available	786	Open in IMG/M
3300015349\|Ga0182185_1167273	Not Available	659	Open in IMG/M
3300015349\|Ga0182185_1182444	Not Available	632	Open in IMG/M
3300015349\|Ga0182185_1208109	Not Available	592	Open in IMG/M
3300015349\|Ga0182185_1213752	Not Available	584	Open in IMG/M
3300015349\|Ga0182185_1254907	Not Available	535	Open in IMG/M
3300015349\|Ga0182185_1280199	Not Available	509	Open in IMG/M
3300015350\|Ga0182163_1080440	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	967	Open in IMG/M
3300015350\|Ga0182163_1170472	Not Available	679	Open in IMG/M
3300015350\|Ga0182163_1188411	Not Available	646	Open in IMG/M
3300015350\|Ga0182163_1234068	Not Available	576	Open in IMG/M
3300015350\|Ga0182163_1242711	Not Available	565	Open in IMG/M
3300015350\|Ga0182163_1243720	Not Available	563	Open in IMG/M
3300015350\|Ga0182163_1258146	Not Available	546	Open in IMG/M
3300015350\|Ga0182163_1267845	Not Available	535	Open in IMG/M
3300015350\|Ga0182163_1279556	Not Available	523	Open in IMG/M
3300015352\|Ga0182169_1142624	Not Available	779	Open in IMG/M
3300015352\|Ga0182169_1153298	Not Available	752	Open in IMG/M
3300015352\|Ga0182169_1182076	Not Available	687	Open in IMG/M
3300015352\|Ga0182169_1196905	Not Available	659	Open in IMG/M
3300015352\|Ga0182169_1251791	Not Available	574	Open in IMG/M
3300015352\|Ga0182169_1261056	Not Available	562	Open in IMG/M
3300015352\|Ga0182169_1278203	Not Available	542	Open in IMG/M
3300015353\|Ga0182179_1135182	Not Available	761	Open in IMG/M
3300015353\|Ga0182179_1214704	Not Available	615	Open in IMG/M
3300015353\|Ga0182179_1215412	Not Available	614	Open in IMG/M
3300015353\|Ga0182179_1215974	Not Available	613	Open in IMG/M
3300015353\|Ga0182179_1222724	Not Available	604	Open in IMG/M
3300015353\|Ga0182179_1240945	Not Available	582	Open in IMG/M
3300015353\|Ga0182179_1255723	Not Available	565	Open in IMG/M
3300015353\|Ga0182179_1262990	Not Available	558	Open in IMG/M
3300015353\|Ga0182179_1270408	Not Available	550	Open in IMG/M
3300015353\|Ga0182179_1271706	Not Available	549	Open in IMG/M
3300015353\|Ga0182179_1279261	Not Available	541	Open in IMG/M
3300015353\|Ga0182179_1281661	Not Available	539	Open in IMG/M
3300015353\|Ga0182179_1313227	Not Available	511	Open in IMG/M
3300015353\|Ga0182179_1321877	Not Available	504	Open in IMG/M
3300015353\|Ga0182179_1321980	Not Available	504	Open in IMG/M
3300015353\|Ga0182179_1322898	Not Available	504	Open in IMG/M
3300015354\|Ga0182167_1180791	Not Available	775	Open in IMG/M
3300015354\|Ga0182167_1235562	Not Available	663	Open in IMG/M
3300015354\|Ga0182167_1300916	Not Available	569	Open in IMG/M
3300015354\|Ga0182167_1330953	Not Available	535	Open in IMG/M
3300015354\|Ga0182167_1332440	Not Available	534	Open in IMG/M
3300017408\|Ga0182197_1131425	Not Available	531	Open in IMG/M
3300017412\|Ga0182199_1079042	Not Available	726	Open in IMG/M
3300017412\|Ga0182199_1108590	Not Available	645	Open in IMG/M
3300017412\|Ga0182199_1166159	Not Available	547	Open in IMG/M
3300017412\|Ga0182199_1180183	Not Available	529	Open in IMG/M
3300017414\|Ga0182195_1061612	Not Available	824	Open in IMG/M
3300017414\|Ga0182195_1113914	Not Available	658	Open in IMG/M
3300017414\|Ga0182195_1140874	Not Available	605	Open in IMG/M
3300017414\|Ga0182195_1149211	Not Available	592	Open in IMG/M
3300017414\|Ga0182195_1152196	Not Available	587	Open in IMG/M
3300017414\|Ga0182195_1179142	Not Available	549	Open in IMG/M
3300017414\|Ga0182195_1182452	Not Available	545	Open in IMG/M
3300017414\|Ga0182195_1199515	Not Available	525	Open in IMG/M
3300017414\|Ga0182195_1202877	Not Available	522	Open in IMG/M
3300017414\|Ga0182195_1203053	Not Available	521	Open in IMG/M
3300017414\|Ga0182195_1223788	Not Available	500	Open in IMG/M
3300017421\|Ga0182213_1098090	Not Available	812	Open in IMG/M
3300017422\|Ga0182201_1112299	Not Available	550	Open in IMG/M
3300017432\|Ga0182196_1089001	Not Available	612	Open in IMG/M
3300017432\|Ga0182196_1100385	Not Available	587	Open in IMG/M
3300017432\|Ga0182196_1151533	Not Available	508	Open in IMG/M
3300017432\|Ga0182196_1157519	Not Available	501	Open in IMG/M
3300017435\|Ga0182194_1059224	Not Available	717	Open in IMG/M
3300017435\|Ga0182194_1107970	Not Available	576	Open in IMG/M
3300017435\|Ga0182194_1135715	Not Available	528	Open in IMG/M
3300017435\|Ga0182194_1145752	Not Available	514	Open in IMG/M
3300017439\|Ga0182200_1061223	Not Available	709	Open in IMG/M
3300017439\|Ga0182200_1077700	Not Available	654	Open in IMG/M
3300017439\|Ga0182200_1097077	Not Available	606	Open in IMG/M
3300017439\|Ga0182200_1097587	Not Available	605	Open in IMG/M
3300017439\|Ga0182200_1111207	Not Available	578	Open in IMG/M
3300017439\|Ga0182200_1125660	Not Available	553	Open in IMG/M
3300017439\|Ga0182200_1128069	Not Available	550	Open in IMG/M
3300017440\|Ga0182214_1075571	Not Available	698	Open in IMG/M
3300017440\|Ga0182214_1083881	Not Available	667	Open in IMG/M
3300017440\|Ga0182214_1140069	Not Available	533	Open in IMG/M
3300017445\|Ga0182198_1053963	Not Available	824	Open in IMG/M
3300017445\|Ga0182198_1156906	Not Available	557	Open in IMG/M
3300017445\|Ga0182198_1164269	Not Available	547	Open in IMG/M
3300017445\|Ga0182198_1166287	Not Available	545	Open in IMG/M
3300017691\|Ga0182212_1118058	Not Available	600	Open in IMG/M
3300017691\|Ga0182212_1140335	Not Available	549	Open in IMG/M
3300017692\|Ga0182210_1147755	Not Available	522	Open in IMG/M
3300017693\|Ga0182216_1113614	Not Available	660	Open in IMG/M
3300017693\|Ga0182216_1143947	Not Available	601	Open in IMG/M
3300017693\|Ga0182216_1150794	Not Available	590	Open in IMG/M
3300017693\|Ga0182216_1173580	Not Available	558	Open in IMG/M
3300017693\|Ga0182216_1174589	Not Available	556	Open in IMG/M
3300017693\|Ga0182216_1185924	Not Available	542	Open in IMG/M
3300017693\|Ga0182216_1187888	Not Available	540	Open in IMG/M
3300017693\|Ga0182216_1210558	Not Available	515	Open in IMG/M
3300017694\|Ga0182211_1155074	Not Available	545	Open in IMG/M
3300020023\|Ga0182178_1005269	Not Available	830	Open in IMG/M
3300020023\|Ga0182178_1008154	Not Available	714	Open in IMG/M
3300020023\|Ga0182178_1012048	Not Available	626	Open in IMG/M
3300020023\|Ga0182178_1013634	Not Available	601	Open in IMG/M
3300020023\|Ga0182178_1016472	Not Available	564	Open in IMG/M
3300020023\|Ga0182178_1017361	Not Available	554	Open in IMG/M
3300020023\|Ga0182178_1019543	Not Available	532	Open in IMG/M
3300020023\|Ga0182178_1021954	Not Available	512	Open in IMG/M
3300020223\|Ga0182118_100981	Not Available	1101	Open in IMG/M
3300022465\|Ga0213505_122764	Not Available	500	Open in IMG/M
3300026035\|Ga0207703_11207332	Not Available	727	Open in IMG/M
3300026088\|Ga0207641_12081031	Not Available	568	Open in IMG/M
3300026095\|Ga0207676_12231170	Not Available	545	Open in IMG/M
3300026118\|Ga0207675_101087331	Not Available	819	Open in IMG/M
3300026740\|Ga0207439_103418	Not Available	551	Open in IMG/M
3300028049\|Ga0268322_1009454	Not Available	879	Open in IMG/M
3300028049\|Ga0268322_1014967	Not Available	772	Open in IMG/M
3300028049\|Ga0268322_1026928	Not Available	647	Open in IMG/M
3300028049\|Ga0268322_1037642	Not Available	580	Open in IMG/M
3300028050\|Ga0268328_1009501	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	978	Open in IMG/M
3300028050\|Ga0268328_1047251	Not Available	587	Open in IMG/M
3300028050\|Ga0268328_1054164	Not Available	559	Open in IMG/M
3300028050\|Ga0268328_1054511	Not Available	557	Open in IMG/M
3300028050\|Ga0268328_1065058	Not Available	521	Open in IMG/M
3300028051\|Ga0268344_1007544	Not Available	731	Open in IMG/M
3300028051\|Ga0268344_1007550	Not Available	731	Open in IMG/M
3300028051\|Ga0268344_1011761	Not Available	643	Open in IMG/M
3300028051\|Ga0268344_1019254	Not Available	555	Open in IMG/M
3300028051\|Ga0268344_1020085	Not Available	548	Open in IMG/M
3300028051\|Ga0268344_1026140	Not Available	505	Open in IMG/M
3300028052\|Ga0268300_1005299	Not Available	742	Open in IMG/M
3300028052\|Ga0268300_1010692	Not Available	529	Open in IMG/M
3300028052\|Ga0268300_1011533	Not Available	512	Open in IMG/M
3300028052\|Ga0268300_1012074	Not Available	503	Open in IMG/M
3300028053\|Ga0268346_1004691	Not Available	978	Open in IMG/M
3300028055\|Ga0268338_1010435	Not Available	783	Open in IMG/M
3300028056\|Ga0268330_1011076	Not Available	901	Open in IMG/M
3300028056\|Ga0268330_1017499	Not Available	780	Open in IMG/M
3300028056\|Ga0268330_1020668	Not Available	740	Open in IMG/M
3300028056\|Ga0268330_1022255	Not Available	723	Open in IMG/M
3300028056\|Ga0268330_1028046	Not Available	669	Open in IMG/M
3300028056\|Ga0268330_1040439	Not Available	590	Open in IMG/M
3300028056\|Ga0268330_1040636	Not Available	589	Open in IMG/M
3300028056\|Ga0268330_1048733	Not Available	551	Open in IMG/M
3300028056\|Ga0268330_1049437	Not Available	548	Open in IMG/M
3300028057\|Ga0268352_1026189	Not Available	632	Open in IMG/M
3300028058\|Ga0268332_1013725	Not Available	905	Open in IMG/M
3300028058\|Ga0268332_1038158	Not Available	657	Open in IMG/M
3300028058\|Ga0268332_1078928	Not Available	503	Open in IMG/M
3300028061\|Ga0268314_1031324	Not Available	613	Open in IMG/M
3300028062\|Ga0268342_1026594	Not Available	601	Open in IMG/M
3300028062\|Ga0268342_1026612	Not Available	601	Open in IMG/M
3300028062\|Ga0268342_1029078	Not Available	584	Open in IMG/M
3300028062\|Ga0268342_1030631	Not Available	574	Open in IMG/M
3300028062\|Ga0268342_1033058	Not Available	559	Open in IMG/M
3300028064\|Ga0268340_1009581	Not Available	1033	Open in IMG/M
3300028064\|Ga0268340_1056578	Not Available	590	Open in IMG/M
3300028064\|Ga0268340_1074782	Not Available	531	Open in IMG/M
3300028064\|Ga0268340_1076250	Not Available	527	Open in IMG/M
3300028141\|Ga0268326_1008867	Not Available	580	Open in IMG/M
3300028142\|Ga0268347_1005036	Not Available	892	Open in IMG/M
3300028142\|Ga0268347_1006553	Not Available	828	Open in IMG/M
3300028142\|Ga0268347_1006553	Not Available	828	Open in IMG/M
3300028142\|Ga0268347_1014038	Not Available	666	Open in IMG/M
3300028142\|Ga0268347_1014043	Not Available	666	Open in IMG/M
3300028142\|Ga0268347_1017341	Not Available	624	Open in IMG/M
3300028142\|Ga0268347_1026181	Not Available	551	Open in IMG/M
3300028142\|Ga0268347_1031317	Not Available	520	Open in IMG/M
3300028142\|Ga0268347_1031671	Not Available	518	Open in IMG/M
3300028142\|Ga0268347_1032916	Not Available	512	Open in IMG/M
3300028143\|Ga0268348_1010102	Not Available	676	Open in IMG/M
3300028143\|Ga0268348_1014024	Not Available	610	Open in IMG/M
3300028143\|Ga0268348_1019279	Not Available	554	Open in IMG/M
3300028143\|Ga0268348_1026071	Not Available	504	Open in IMG/M
3300028149\|Ga0268353_116441	Not Available	548	Open in IMG/M
3300028150\|Ga0268343_1010764	Not Available	620	Open in IMG/M
3300028150\|Ga0268343_1014639	Not Available	559	Open in IMG/M
3300028151\|Ga0268308_1002569	Not Available	1135	Open in IMG/M
3300028151\|Ga0268308_1002774	Not Available	1106	Open in IMG/M
3300028151\|Ga0268308_1006437	Not Available	851	Open in IMG/M
3300028151\|Ga0268308_1007724	Not Available	805	Open in IMG/M
3300028151\|Ga0268308_1012850	Not Available	686	Open in IMG/M
3300028151\|Ga0268308_1016929	Not Available	629	Open in IMG/M
3300028151\|Ga0268308_1017686	Not Available	620	Open in IMG/M
3300028151\|Ga0268308_1022347	Not Available	576	Open in IMG/M
3300028151\|Ga0268308_1031413	Not Available	515	Open in IMG/M
3300028153\|Ga0268320_1019712	Not Available	574	Open in IMG/M
3300028153\|Ga0268320_1020747	Not Available	565	Open in IMG/M
3300028153\|Ga0268320_1025552	Not Available	530	Open in IMG/M
3300028154\|Ga0268341_1006732	Not Available	804	Open in IMG/M
3300028154\|Ga0268341_1012440	Not Available	671	Open in IMG/M
3300028154\|Ga0268341_1019117	Not Available	591	Open in IMG/M
3300028154\|Ga0268341_1022641	Not Available	561	Open in IMG/M
3300028248\|Ga0268312_1001387	Not Available	1305	Open in IMG/M
3300028248\|Ga0268312_1009868	Not Available	763	Open in IMG/M
3300028248\|Ga0268312_1027916	Not Available	558	Open in IMG/M
3300028248\|Ga0268312_1037628	Not Available	505	Open in IMG/M
3300028251\|Ga0268324_1008065	Not Available	717	Open in IMG/M
3300028253\|Ga0268316_1023856	Not Available	510	Open in IMG/M
3300028256\|Ga0268304_1011702	Not Available	552	Open in IMG/M
3300028262\|Ga0268310_1001774	Not Available	1444	Open in IMG/M
3300028262\|Ga0268310_1015324	Not Available	753	Open in IMG/M
3300028262\|Ga0268310_1034705	Not Available	579	Open in IMG/M
3300028262\|Ga0268310_1039282	Not Available	555	Open in IMG/M
3300028262\|Ga0268310_1039685	Not Available	553	Open in IMG/M
3300028262\|Ga0268310_1044864	Not Available	530	Open in IMG/M
3300028262\|Ga0268310_1046587	Not Available	523	Open in IMG/M
3300028464\|Ga0268302_104953	Not Available	609	Open in IMG/M
3300028464\|Ga0268302_109231	Not Available	502	Open in IMG/M
3300028466\|Ga0268321_110538	Not Available	518	Open in IMG/M
3300028468\|Ga0268317_1011667	Not Available	523	Open in IMG/M
3300028469\|Ga0268337_1016251	Not Available	535	Open in IMG/M
3300028471\|Ga0268323_1015756	Not Available	558	Open in IMG/M
3300028472\|Ga0268315_1005857	Not Available	800	Open in IMG/M
3300028472\|Ga0268315_1012774	Not Available	640	Open in IMG/M
3300028473\|Ga0268319_1002770	Not Available	953	Open in IMG/M
3300028473\|Ga0268319_1017294	Not Available	560	Open in IMG/M
3300028473\|Ga0268319_1022318	Not Available	517	Open in IMG/M
3300028474\|Ga0268331_1021330	Not Available	551	Open in IMG/M
3300028475\|Ga0268327_1017544	Not Available	577	Open in IMG/M
3300028476\|Ga0268329_1006681	Not Available	773	Open in IMG/M
3300028523\|Ga0268313_1006801	Not Available	687	Open in IMG/M
3300028523\|Ga0268313_1010329	Not Available	615	Open in IMG/M
3300028525\|Ga0268305_110088	Not Available	536	Open in IMG/M
3300028526\|Ga0268339_1010807	Not Available	611	Open in IMG/M
3300028526\|Ga0268339_1011654	Not Available	598	Open in IMG/M
3300028526\|Ga0268339_1017691	Not Available	530	Open in IMG/M
3300028526\|Ga0268339_1018955	Not Available	520	Open in IMG/M
3300028527\|Ga0268335_1010674	Not Available	596	Open in IMG/M
3300028529\|Ga0268311_1010899	Not Available	687	Open in IMG/M
3300028529\|Ga0268311_1014449	Not Available	632	Open in IMG/M
3300028529\|Ga0268311_1018449	Not Available	586	Open in IMG/M
3300028529\|Ga0268311_1019561	Not Available	575	Open in IMG/M
3300032465\|Ga0214493_1153608	Not Available	532	Open in IMG/M
3300032466\|Ga0214503_1201105	Not Available	620	Open in IMG/M
3300032502\|Ga0214490_1148057	Not Available	530	Open in IMG/M
3300032502\|Ga0214490_1161271	Not Available	504	Open in IMG/M
3300032502\|Ga0214490_1161271	Not Available	504	Open in IMG/M
3300032591\|Ga0214484_1101284	Not Available	592	Open in IMG/M
3300032697\|Ga0214499_1286168	Not Available	506	Open in IMG/M
3300032699\|Ga0214494_1099383	Not Available	544	Open in IMG/M
3300032811\|Ga0314718_1020457	Not Available	804	Open in IMG/M
3300032913\|Ga0314739_1074016	Not Available	633	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	95.03%
Environmental	Environmental	4.97%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	95.03%
Terrestrial	Environmental → Terrestrial	4.97%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	85.10%
Soil	Environmental → Terrestrial → Soil	4.97%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.97%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.26%
Unclassified	Host-Associated → Plants → Unclassified	2.26%
Roots	Host-Associated → Plants → Roots	0.45%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	84.88%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.97%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.84%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	2.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.58%
Loam	Environmental → Terrestrial → Soil → Loam	1.13%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.68%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.45%
Leaf	Host-Associated → Plants → Phyllosphere → Leaf	0.23%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	84.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.97%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.39%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	2.26%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.58%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.68%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.45%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.45%
Endophytes	Host-Associated → Plants → Phyllosphere → Leaf → Endophytes	0.23%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	58.01%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	26.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.97%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.39%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	2.26%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.90%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.45%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.45%
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	0.23%
Switchgrass Associated	Host-Associated → Plants → Phyllosphere → Leaf → Endophytes → Switchgrass Associated	0.23%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009974	Switchgrass associated microbial communities from Austin, Texas, USA - LS_119 metaG	Host-Associated	Open in IMG/M
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300020223	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG	Host-Associated	Open in IMG/M
3300022465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026740	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A1w-12 (SPAdes)	Environmental	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028052	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028055	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028057	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028149	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028150	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028251	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028464	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028466	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028468	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028469	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028471	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028523	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028525	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028526	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028527	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032591	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032699	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032811	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032913	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0062595_1026620241	3300004479	Soil	CMGKVFVALWPCLSPYRDMRQMNLSYMVLLDMRNMFGQKFLSFIGG*
Ga0070690_1008741891	3300005330	Switchgrass Rhizosphere	KVFGDLRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGS*
Ga0070666_111046961	3300005335	Switchgrass Rhizosphere	CTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGKKFLSFIRG*
Ga0070671_1005868791	3300005355	Switchgrass Rhizosphere	LNCTGKVFGALRPCLSPYRDERQMNLCYMVLLDMCNMFGEKFLNFISG*
Ga0070671_1015361781	3300005355	Switchgrass Rhizosphere	KVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0070688_1018079131	3300005365	Switchgrass Rhizosphere	LNCTGKVFGDLRPCLSPYRDERQMNLSYVVLLDMWNVFWQKFLSFIGG*
Ga0070705_1018756761	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	VFRALRPCLSPYRDERQMNLSYMVLLDIRNMFGQKFLSFIGG*
Ga0070708_1018466021	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	FGALRPCLSPYRDERQINLSHMVLLDMWNMFGQKFLSFIGG*
Ga0070708_1022224551	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	GKVFGALRPCLSPYRDERQMNLSYMVLLDMRNMFGQKFLSFNRG*
Ga0068864_1013743602	3300005618	Switchgrass Rhizosphere	LSPYRDEHQINLSYMVLLDMWIMFGPKFLSFIIG*
Ga0068864_1016753631	3300005618	Switchgrass Rhizosphere	MGKVFEALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0068864_1024916461	3300005618	Switchgrass Rhizosphere	NCTGKVFGALRPYLSPYRDERQMNLSYMVLLDTWNMFGQKFLSFIGG*
Ga0068864_1025097201	3300005618	Switchgrass Rhizosphere	MGKVFGALKPCLSPYRDERQMNLSYMVLLDMWNMFEQKFLSF
Ga0068864_1025194502	3300005618	Switchgrass Rhizosphere	KVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFVRG*
Ga0068861_1015548532	3300005719	Switchgrass Rhizosphere	ALRPCLSPYRDEHQMNLSYMVLLDMWNMFGLNFLSFIGG*
Ga0068863_1009827201	3300005841	Switchgrass Rhizosphere	LRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0068863_1017703581	3300005841	Switchgrass Rhizosphere	CMGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFSQKFLNFIGG*
Ga0068863_1021326091	3300005841	Switchgrass Rhizosphere	LSPYTDERQMNLSYMVLLDMWNMFGEKFLNFIVG*
Ga0068863_1024744241	3300005841	Switchgrass Rhizosphere	VFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIKG*
Ga0068863_1026369191	3300005841	Switchgrass Rhizosphere	GKVFGTLRPCLSPYRDEHQMNLSYMVLLDMWNMFG*
Ga0068863_1027174641	3300005841	Switchgrass Rhizosphere	PLNCTGKVFGALRPCLSPYRDELQMNLSYMVLLYMWNMFGQKFLSFIGG*
Ga0068858_1018089382	3300005842	Switchgrass Rhizosphere	GDLRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0068858_1019365901	3300005842	Switchgrass Rhizosphere	CLSPYRDECQMNLSYVVLLDMWNMFGQKFLSFIGG*
Ga0068860_1016522941	3300005843	Switchgrass Rhizosphere	SLNCTGKVFGALRPCLSPYRDERQMNLYYMVLLDMWNMFGKNFLIFIGG*
Ga0068860_1022836751	3300005843	Switchgrass Rhizosphere	NCTGKVFGALRPCLSPYRDERQMNLSYMVLLNMWNMFGQKFLSFIGG*
Ga0068860_1022916891	3300005843	Switchgrass Rhizosphere	NCTGKVFGALRPCLSPYRDERQMILSYIVLLDMWNMLGQKFLSFIGG*
Ga0068860_1025507071	3300005843	Switchgrass Rhizosphere	LNCTGKVFGALRPCLSPYRDERQMILSYMVLLDMWNMFGQKFISFIGG*
Ga0105250_103989621	3300009092	Switchgrass Rhizosphere	LDHVAGVIPLNFTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMF
Ga0105250_104639811	3300009092	Switchgrass Rhizosphere	KVFRALKPYLSPYKDEHQMNLSYIFLLYMWNMFGQKFLSFIGG*
Ga0105248_126530761	3300009177	Switchgrass Rhizosphere	LNCTGKVFGALRPCLSPYRDERQMNLSYMVLVDTWNMFGQKFLSFIGG*
Ga0105039_1142571	3300009974	Switchgrass Associated	VIALNYTGKVFGALSPYLSPYRDERQINLSYMVLLDMWNMFG*
Ga0105129_1035561	3300009975	Switchgrass Associated	LSPYRDERQMNLFYIVPLDMWNMFGQKLLSFIGG*
Ga0105135_1087611	3300009980	Switchgrass Associated	KVFGALRPFLSPYRDERQMNLSYMVLLAMWNMFGQKFLSFIGG*
Ga0105131_1360251	3300009989	Switchgrass Associated	RPCLLPYRDERQMNLSYMVLLDMWNMFGQKFLSFSGG*
Ga0105131_1367842	3300009989	Switchgrass Associated	GKVFGALRPCLSPYRDERQVNISYMVLLDMWNMFGKKFLSFIGG*
Ga0105120_10512941	3300009992	Switchgrass Associated	TGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFHSFIGG*
Ga0105126_10322411	3300009994	Switchgrass Associated	NCTGKVFGALRPCLSPYRDERLMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0105139_10647561	3300009995	Switchgrass Associated	PCLSSYRDERQMNLSYVVLLDMWNMFGQKFLSFIGG*
Ga0105139_10834991	3300009995	Switchgrass Associated	PCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGA*
Ga0105139_11078371	3300009995	Switchgrass Associated	KVFGALRPCQSPYRDERQMNLSYMVLLDMWNIFGQKFLSFIGG*
Ga0105139_11171021	3300009995	Switchgrass Associated	GKVFGAVRPCLSPYRDERQMNLTYVVLQDMWNMFGKKFLIFIGG*
Ga0134125_117637901	3300010371	Terrestrial Soil	CLSPYRDERQMNLFYMVLLDMWNKFGLKLRSFIVG*
Ga0134125_121711671	3300010371	Terrestrial Soil	LYHELLPLNCMGKVFGALRPCLTPYRDERQMNISYMVLLDMWNNFGKKFHSFIGG*
Ga0134125_123862461	3300010371	Terrestrial Soil	MGKVFGALRPCLSPYRDECQMNLSYVVFLDMWNMF
Ga0134125_127477901	3300010371	Terrestrial Soil	MGKVFGALRPCLSPYRDEYQMNLSYKVLLDMWNMFGEKFLSFIGG*
Ga0134125_128222881	3300010371	Terrestrial Soil	TGKVFGALRPCLLPYRDERQMNLSYIVLLDMWNMFGQKFLSFIEG*
Ga0134128_127938481	3300010373	Terrestrial Soil	VIAFKLHRKVFGALRPCLSPYRDERQMNLSYMVLLDIWNMFGQKFLSFIRG*
Ga0134126_114931361	3300010396	Terrestrial Soil	CLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIRA*
Ga0134127_117426071	3300010399	Terrestrial Soil	LRPCLSTYRDECQLNLSYIVLPDMWSMFGLKFLSFIEG*
Ga0134127_122988651	3300010399	Terrestrial Soil	CTRKVFGALRPCLSPYRDEGQMNLSYMVLLYMWNMFGQKFLSLIGG*
Ga0134127_123215051	3300010399	Terrestrial Soil	MGKIFRALRHGLSPYRDEHQMNLSYMLLLDTWNLFGQKFLGFIGG*
Ga0134127_124294681	3300010399	Terrestrial Soil	LHGECNRALRHYLSPYRDERQMNLFYMGLLDMWNMFGQKFLSFIGG*
Ga0134127_127290711	3300010399	Terrestrial Soil	AFKQHREGIRALRPCLSPYREERQVDLSYMVLLDMWNIFGQKSLSFIGG*
Ga0134121_118942341	3300010401	Terrestrial Soil	ALRPCLSPYRDEDQMNLSYMVLQDMWNMFGQKFLSFIGS*
Ga0134123_121851051	3300010403	Terrestrial Soil	KVFGALRPCLSPYRDERQMNHSYMVLLDMWNMFGQKFLSFIGG*
Ga0134123_134009821	3300010403	Terrestrial Soil	LNCTGKVFGALRPCLSPYRDERQMNLSYMVLPNMWNMFGQKFPSFIGG*
Ga0163163_129076121	3300014325	Switchgrass Rhizosphere	ELQPLNCTGNVFGSLRPCLSPYRDEGQMNLSYVVLLDIWNMFGQKFLSFIGG*
Ga0163163_132693051	3300014325	Switchgrass Rhizosphere	ALRPYLSPYRDERQMILSYMVLLDMWNMFGQKFLSFIGG*
Ga0157379_119367341	3300014968	Switchgrass Rhizosphere	LNCTGKVFGALRPCLSPYRDESQMNLSYTVLLDMWNMIGQKFLSFIGG*
Ga0157379_120355391	3300014968	Switchgrass Rhizosphere	MGMVFRALRPCLSPYRDECQMNLSYMVLLDMWNMIGQKFLS
Ga0157379_122953981	3300014968	Switchgrass Rhizosphere	NCAGKVFSALRHCLSPYRDERQMNLSYMVLLAMWNMFGKKFLRFIRG*
Ga0157379_124793141	3300014968	Switchgrass Rhizosphere	TEKVFGALRTCLSPYKDERQMNLSYMVLLYMWNMLGEKFLTFIGG*
Ga0182183_10680241	3300015270	Switchgrass Phyllosphere	MGKVFGALRPCLSPYRDERQMSLSYMVLLDMWNMFGQKFLSFI
Ga0182099_10528231	3300015278	Switchgrass Phyllosphere	MGKVFGALRPSLSPYRDEYQMNLSCVVLLDMWNMFSLKFLS
Ga0182099_10593121	3300015278	Switchgrass Phyllosphere	LSPYRDERQMNLSYLLLLDMWNMSAQKFLNFIGG*
Ga0182099_10744211	3300015278	Switchgrass Phyllosphere	GKVFGALRPCLSPYKDELQMNLSYMVHLDMWNMFGQKLLSFIRG*
Ga0182100_10597121	3300015280	Switchgrass Phyllosphere	PCLSPYRDERQMNLSYMVLLDTWNMFGQKFLSFI*
Ga0182100_10689101	3300015280	Switchgrass Phyllosphere	LLLYRDEHQMNPSYMVLLDMWNMFGQKFLSFIGG*
Ga0182100_10990531	3300015280	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDERQMNLSYMVLLDMCNMFGKKFLSFIGG*
Ga0182101_10283621	3300015284	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDECQMNLSYMVLLDMWNMFGQKFLSFIGA*
Ga0182101_10340551	3300015284	Switchgrass Phyllosphere	LNYTWKVFGALRPCISPYQDESQMNLSYMVLLDMWNMFGQKFLSLIGG*
Ga0182101_10628571	3300015284	Switchgrass Phyllosphere	CLSPYRDERQMILSYIVLLDMWNMFGQKFLSFIGG*
Ga0182101_10737002	3300015284	Switchgrass Phyllosphere	PCLSPYRDERQMNLSYMVLLDMWNMLGQKFLSFISG*
Ga0182101_10835051	3300015284	Switchgrass Phyllosphere	CTGKVFGALRPCLSPYRVEGQMNLSYMVLLDMWNMFGQKFLSFIKG*
Ga0182101_10886291	3300015284	Switchgrass Phyllosphere	RPCLSPYRDEHQKNLSYVVLLDMWNMFGQKLLSFIGG*
Ga0182101_10942921	3300015284	Switchgrass Phyllosphere	MGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQK
Ga0182101_10945272	3300015284	Switchgrass Phyllosphere	GMVFGALRPCLSPYREERQMNLSYVLLLDMWNMFGQKFLSFIGG*
Ga0182105_10625801	3300015290	Switchgrass Phyllosphere	FGALRPCLSPYRDESQMNLSYMVLLDMWNMFGKKFLSFIGG*
Ga0182105_10804111	3300015290	Switchgrass Phyllosphere	GALRPYLSPYKDECQMNLSYKVLLDMWNMFGQKFLSFIVG*
Ga0182105_10809811	3300015290	Switchgrass Phyllosphere	HCLSPYRDERQMILSYIVLLDMWNMFGQKFLSFIGG*
Ga0182105_10884521	3300015290	Switchgrass Phyllosphere	VFGALRPYLSPYRDERQINLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182105_11062242	3300015290	Switchgrass Phyllosphere	CLSPYRDERQMYLSNMVLLDMWNMFGQKFLSFIGG*
Ga0182103_10565091	3300015293	Switchgrass Phyllosphere	TGKVFGALRPCLSPYRDERQMNISYMVLLDMWNMFGQKFLSFIGG*
Ga0182104_10370911	3300015297	Switchgrass Phyllosphere	ALRPCLSPYRDERQMNLSYMFPLDMWSMFGQKFLSFIGG*
Ga0182104_10663791	3300015297	Switchgrass Phyllosphere	MPLNCTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFG
Ga0182107_10944531	3300015299	Miscanthus Phyllosphere	YKLHGKVFGALRPCLLPYRDERQMNLSYMVLLDMWSMFGQKFLSFIGG*
Ga0182184_10380631	3300015301	Switchgrass Phyllosphere	MGKVFEALRHCLSPYRVERQMNLSYIVLLDMWNMIGQKFLSFIGG*
Ga0182184_10550891	3300015301	Switchgrass Phyllosphere	ELYPLNCTGKVFGDLRPCLSPYRDERQMNLSYMVLLDMWNMFG*
Ga0182184_10733701	3300015301	Switchgrass Phyllosphere	KVFGDLRPCLSPYRDERQMNLSYMGLLDMWNMFGQKFLSFIGG*
Ga0182184_10912801	3300015301	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDERQMNLSYMVLLDTWNMFGQKFLSFIGG*
Ga0182184_11015221	3300015301	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDELQMNLYYMVLLDMWNMFGQKFLCFIEG*
Ga0182180_10277671	3300015306	Switchgrass Phyllosphere	VFGALRTCLSPYRDERQMSLSYMVLLDMWNMSGQKFLSFIGC*
Ga0182098_10455151	3300015309	Switchgrass Phyllosphere	LRPCLSAYRDERQMNLSYMVLLDMWNMFGLNFLSFVGG*
Ga0182098_10481321	3300015309	Switchgrass Phyllosphere	RPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182098_10843351	3300015309	Switchgrass Phyllosphere	NVFGALRPCLSPYRDERQMILSYMVLLDMWNMFGQKFISFIGG*
Ga0182162_10107992	3300015310	Switchgrass Phyllosphere	GKVFMALRPCLSPYRDERQMNLSYMVLLEMQNMFGQKFLSFIGG*
Ga0182162_10223551	3300015310	Switchgrass Phyllosphere	MGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFSQKFLNFIGG*
Ga0182162_10365401	3300015310	Switchgrass Phyllosphere	TEKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFEQKFLSFIGG*
Ga0182162_10558392	3300015310	Switchgrass Phyllosphere	GKVFGALRPCLSTYRVESRMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182162_10718041	3300015310	Switchgrass Phyllosphere	CTGKVFGALRPCLSPYRDERQMNLFYMVLLDMWNMFGLKFLSFIGG*
Ga0182162_10728411	3300015310	Switchgrass Phyllosphere	PRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182162_10883011	3300015310	Switchgrass Phyllosphere	ALRPCLSPYRDERQMNLSYVVLQDMWNMFGKKFLSFIGG*
Ga0182162_11129231	3300015310	Switchgrass Phyllosphere	MVFGALRPCLSPYRDERQINLSYMVLLDMWNMFGQK
Ga0182182_10408621	3300015311	Switchgrass Phyllosphere	GALRPCLSPYRDERQMILSYMVLLDMWNMFGQKFISFIGG*
Ga0182182_10523101	3300015311	Switchgrass Phyllosphere	KVFGALRPCLSPYRDEHQMNLSYMVLLDMWNMFGQKFLNFIGG*
Ga0182182_10638742	3300015311	Switchgrass Phyllosphere	FEALRPCLSPYRDEGQMNLSYVVLLDMWNMFGQKFLSFIGG*
Ga0182182_10805801	3300015311	Switchgrass Phyllosphere	NCTGKVFGALRTCLSPYRDECQMNLSYMVLLDMWNMLGVKFLSFIGG*
Ga0182182_10945401	3300015311	Switchgrass Phyllosphere	CLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182168_10267701	3300015312	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDERQMNLSYMVLLDTWNMFGQKFLCFIGG*
Ga0182168_10398731	3300015312	Switchgrass Phyllosphere	CTGKVFGALRPCLSPYRDERQMNLSYVVLLDMWNMFGQKFLSFIGG*
Ga0182168_10563901	3300015312	Switchgrass Phyllosphere	FGALRPCLSPYRDERQMILSYMVLLDMWNMFGQKFISFIGG*
Ga0182168_10744111	3300015312	Switchgrass Phyllosphere	CTRKVFGALRPCLSPYREARQMNISYMVLLDMWNMFGQKFLSFIEG*
Ga0182164_10840991	3300015313	Switchgrass Phyllosphere	LNCMGKVFGALRPCLSPYRDEHQMNLSYMVLLDMWNMFGQKFLSFIGD*
Ga0182164_11199491	3300015313	Switchgrass Phyllosphere	RPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFVRG*
Ga0182120_10714991	3300015315	Switchgrass Phyllosphere	KVFGALRPCLSPYRDERQMNLSYMVLLDIWNMFGQKFLSFIGG*
Ga0182120_11174571	3300015315	Switchgrass Phyllosphere	PCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIRG*
Ga0182121_10735091	3300015316	Switchgrass Phyllosphere	CLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIRG*
Ga0182121_10936411	3300015316	Switchgrass Phyllosphere	GKVFGALRPFLSPYMDESQMNLSYIILLDVWNMFGQKFLSFIGG*
Ga0182121_10957311	3300015316	Switchgrass Phyllosphere	LRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFVRG*
Ga0182121_11158511	3300015316	Switchgrass Phyllosphere	CTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFG*
Ga0182121_11260941	3300015316	Switchgrass Phyllosphere	PCLSPYRDERQLNLSYIVLLDMWNMFGQKFLSVIGG*
Ga0182121_11281631	3300015316	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYREERQMNLSYMVLLDMWNMFVQKFLIFIGG*
Ga0182121_11392741	3300015316	Switchgrass Phyllosphere	KVFGALRPCLSPYRDERQMILSYMVLLDMWNMFG*
Ga0182136_10735751	3300015317	Switchgrass Phyllosphere	LSPYRDEGQMKLSSKVLLDVWNMFVQKSLSFIGG*
Ga0182136_10983431	3300015317	Switchgrass Phyllosphere	GKVFRALRPCLSPYRDECQMNLSYMVLLDMSNMFGQKFLNFIGG*
Ga0182136_11179871	3300015317	Switchgrass Phyllosphere	LNCTGKVFGALRPCLSPYRDERKMNLSYMVLLDMWNMIGQKFLSFIGD*
Ga0182136_11417531	3300015317	Switchgrass Phyllosphere	ALRPSLATYRDMRQIDLSYMVLLDMWNMFGQKILSFIGG*
Ga0182181_10813411	3300015318	Switchgrass Phyllosphere	LAPYRDERQMNLSYMVLLDMWNMFGQNFLSFIGG*
Ga0182181_10942491	3300015318	Switchgrass Phyllosphere	RKVFGALRPCLSPYRDDCQMNLSYMVLLDMWNMFGQKFLSFVGG*
Ga0182130_11117901	3300015319	Switchgrass Phyllosphere	GKVFGALRHCLSPYRDELQMNLSYMVLLDMWNRFVQKFLSFIGG*
Ga0182165_10328531	3300015320	Switchgrass Phyllosphere	TGKVFGALRPCLSPYRDEHQMNPSYMVLLDMWNMFG*
Ga0182165_11446451	3300015320	Switchgrass Phyllosphere	LSPYRDERQINLSYMVLLDMWNMFGQKLLSFIGG*
Ga0182134_11119561	3300015324	Switchgrass Phyllosphere	CTGKVFGALRPCLSPYKDERQMILSYVVLLDMWNMFGQKFLSFIGG*
Ga0182134_11218551	3300015324	Switchgrass Phyllosphere	NCTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFG*
Ga0182134_11383261	3300015324	Switchgrass Phyllosphere	CLSPYRDERQMNLSYMVLLGMWNMFGQKILSFIGG*
Ga0182134_11420261	3300015324	Switchgrass Phyllosphere	QLLPLNCTGKVFGVLRTCLSPYRDERQMNLSYMVLLDMWNMLGEKFLSFIGG*
Ga0182134_11420262	3300015324	Switchgrass Phyllosphere	MGKVFGALKPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFI
Ga0182148_10245811	3300015325	Switchgrass Phyllosphere	MNCTGKVFRALRPCLSPYRDERQMNLSYMVLLDMWNMF
Ga0182148_10831601	3300015325	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDERQINLSYMVLLDMWNLFGQKFLSFIGG*
Ga0182148_11213891	3300015325	Switchgrass Phyllosphere	KVFGALRPCLSPYRDECQMILSYMVLLDMWNMFGQKFLCFIGG*
Ga0182148_11372651	3300015325	Switchgrass Phyllosphere	KVFGALRPYLSPYRDERQMNLSYMVLLDMRNMFGQKFLSFNRG*
Ga0182166_10216913	3300015326	Switchgrass Phyllosphere	KVFGALRPCLSPYRDEHQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182166_10908181	3300015326	Switchgrass Phyllosphere	VFGALRPCLSPYRDERQMNVSYMVLLDMWHMLGQKFLSFIGG*
Ga0182166_10915991	3300015326	Switchgrass Phyllosphere	LSPYRDERQMNHSYMVLLDMWNMFGQKFLSFIGG*
Ga0182166_11146071	3300015326	Switchgrass Phyllosphere	PLNFSGKVFGALRPCLSPYRDEHQMNLSYMVLLDMWNMFGQKFLYFIGG*
Ga0182114_10631321	3300015327	Switchgrass Phyllosphere	LNCTGKVFGALRPCLSSYRDVRRINISYIFLLDMWNMFGQKFLSFIGG*
Ga0182114_10857751	3300015327	Switchgrass Phyllosphere	PCLSPYRDERQMNLSYIVLLDMWNMFGQKFPSFIGG*
Ga0182114_10949491	3300015327	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWDMFGQKFLSFIGG*
Ga0182114_11008651	3300015327	Switchgrass Phyllosphere	MGKVFGALRPCLSSYWDERQINLSYMVLLDMWNMLGQKFLSFI
Ga0182114_11069212	3300015327	Switchgrass Phyllosphere	GALRPCLSPYRDERQMILSYIVLLDMWNMFGQKFLSFIGG*
Ga0182114_11241501	3300015327	Switchgrass Phyllosphere	CLSPYRDERQMNLSYMVLLDMWNMLGEKFLSFIGG*
Ga0182153_10756471	3300015328	Switchgrass Phyllosphere	NCTGKVFMARRPCLSPYRDGRQTDLFYMVLLDVWNMFGQKSLSFIGG*
Ga0182153_11432371	3300015328	Switchgrass Phyllosphere	MGKVFGALRPYLSPYRDVHQMNLFYMVLRDMWNMFGQKFISFIGGE
Ga0182135_10225571	3300015329	Switchgrass Phyllosphere	NCTGKVFGALRPCLSPYMDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182135_11096651	3300015329	Switchgrass Phyllosphere	LNYTGKVFGALRPCLSPYRDERQMNLSYMVILDTWNMFGQKFLSFIRG*
Ga0182135_11197741	3300015329	Switchgrass Phyllosphere	ALKCSAKVFGALRPCLSPYRDERQMNLSYMVLLEMWNMFGQKFLSFIGG*
Ga0182135_11505051	3300015329	Switchgrass Phyllosphere	LSPYRDERQMNLFYMVLLDMWNMIGQKFLNFIGG*
Ga0182152_11260562	3300015330	Switchgrass Phyllosphere	TGKVFGALRPYLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIKG*
Ga0182152_11503601	3300015330	Switchgrass Phyllosphere	CTGKAFGALRPCLSPYRDERQMNLSYVVLLDMWNMFVQKFLSFIGG*
Ga0182131_10277602	3300015331	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDERQINLSYMVLLDMWNMFAQNFLSFIGG*
Ga0182131_10883881	3300015331	Switchgrass Phyllosphere	GKVFGALRHCLSPYRDEHQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182131_11112311	3300015331	Switchgrass Phyllosphere	LRPCLTPYRDERQMNLSYMVLLDMWNMFGKKFHSFIGG*
Ga0182131_11429691	3300015331	Switchgrass Phyllosphere	KVFGALRPCLSPYRDERHMNLSYMVLLDMWNMFGQKFLCFIGG*
Ga0182117_11088581	3300015332	Switchgrass Phyllosphere	YPLNCTGKVFGAIRPCLSPYRDERQMNLYYMVLLDMWNMFGQKFLSFNGG*
Ga0182117_11193401	3300015332	Switchgrass Phyllosphere	PLRPCQSPYRDERQMNFSYMVLLDMQNMFGQKFLSFIGG*
Ga0182117_11473401	3300015332	Switchgrass Phyllosphere	TGKVFGALRPCLSPYRDEHQMNLSYMVLLDLWNMFGHKFLSFIGG*
Ga0182147_11032621	3300015333	Switchgrass Phyllosphere	GALRPCLSTDIDERKMNLSYMTLLDMWNMFGQKFRSLIGG*
Ga0182147_11121801	3300015333	Switchgrass Phyllosphere	TGKVFEALRPCLSPYRDEHQMNLSYMVLLDIWSMFGQEFISFIGG*
Ga0182132_11200321	3300015334	Switchgrass Phyllosphere	MGMVFRALRPCLSPYRDECQMNLSYKVLLDMWNLFGEKF
Ga0182132_11354511	3300015334	Switchgrass Phyllosphere	MVRTIIFSKNAGKVFGALRPCLSPYRDERQMNLSYLVLLDIWNMFGQKFLNFIGG*
Ga0182116_10788751	3300015335	Switchgrass Phyllosphere	PCLSPYRDERQMSLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182116_11086091	3300015335	Switchgrass Phyllosphere	KVFGALSPCLSPYRDERLMNLSYMVLLDMWNMFGQKFLRFIGG*
Ga0182116_11721911	3300015335	Switchgrass Phyllosphere	PLNCTEKAFGALRPCLSPYRDEHQMNLSYMVLLDMWNMIGQNFLSFIGG*
Ga0182150_11172591	3300015336	Switchgrass Phyllosphere	CTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLRFIGG*
Ga0182150_11569411	3300015336	Switchgrass Phyllosphere	NCMGKVFGPLRPCLSPYRDEHQTNLSYMDLLDTWNMFGKKFLSFIGG*
Ga0182151_10654221	3300015337	Switchgrass Phyllosphere	ALRPCLSPYRDELQMNLSYMVLLDIWNMFGQKFLSFIRG*
Ga0182151_10703832	3300015337	Switchgrass Phyllosphere	LNCTGEVFGALRPCLLPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182151_11268851	3300015337	Switchgrass Phyllosphere	GALRPCLSPYRDERQINLSYMVLLDMWNMFGQKFLIFIGG*
Ga0182151_11392861	3300015337	Switchgrass Phyllosphere	GALRPYLSPYRDERQMNLSYMVLLDMWNMFGQNFLSFIGG*
Ga0182151_11552591	3300015337	Switchgrass Phyllosphere	LSPYRDERQMNLSYMVLLDMWNMFGEKFISFIGG*
Ga0182151_11569781	3300015337	Switchgrass Phyllosphere	MRTVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGPKFLSFIGG
Ga0182137_11201161	3300015338	Switchgrass Phyllosphere	MGKVFGALRPCLSPYRDELQMNLSYMVLLDMWNMFGQ
Ga0182137_11314821	3300015338	Switchgrass Phyllosphere	VFEALRPCLSPYRDERQMNLSYMVLLDMCNMFGKKFLGFIGG*
Ga0182137_11653371	3300015338	Switchgrass Phyllosphere	CLTPYRDEHQMNISYMVLLDMWNMIGQKFLNFIGG*
Ga0182137_11693761	3300015338	Switchgrass Phyllosphere	RLCLSPYSDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182137_11756731	3300015338	Switchgrass Phyllosphere	FTGKVFGALRPCLSPYRDERQINLSYMILLDMWNMFGQKFHSFIGG*
Ga0182149_10327801	3300015339	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDERQMNLSYMVLLDTWNMFGQKILSFIGG*
Ga0182149_10960641	3300015339	Switchgrass Phyllosphere	LRPSLSPYRIECQMNLSYMVLLDMWNMFEEKFLSFIGG*
Ga0182149_11109401	3300015339	Switchgrass Phyllosphere	CTGKVFGALRPCLSPYRDERQMNLSYMVVIDMWNMFGQKFLSFIKG*
Ga0182149_11181271	3300015339	Switchgrass Phyllosphere	ALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLYLIGG*
Ga0182149_11411351	3300015339	Switchgrass Phyllosphere	RPCLSPYRDERQINLSYMVLLDMWNMFGLNFLSFVGG*
Ga0182149_11524441	3300015339	Switchgrass Phyllosphere	RKVFGALRPSLAPYRDERQMNLSYMVLLDMWNMFGKIFLSFMGG*
Ga0182149_11535671	3300015339	Switchgrass Phyllosphere	HELYPLNCTGKIFEALRPCLSPYRDEHQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182149_11634831	3300015339	Switchgrass Phyllosphere	MGKVFGALRPYLSPYRDERQMNLSYMVLLGMWNMFGQNFLSF
Ga0182133_10510391	3300015340	Switchgrass Phyllosphere	LRNCLSPYRDERQMNLSYMVLLDMWNMFAQKFLSFIGG*
Ga0182133_11243361	3300015340	Switchgrass Phyllosphere	MSKVLRALRPCLSPYRDERQMNLSYMVLLDMWNMLGQKF
Ga0182133_11588581	3300015340	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYWDERQINLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182133_11875031	3300015340	Switchgrass Phyllosphere	TGKVFRALRPSLSPYRIECQMNLSYMVLLDMWNMFEQKFLSFIVG*
Ga0182115_11466001	3300015348	Switchgrass Phyllosphere	KVFGALTPRLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIRA*
Ga0182115_12065751	3300015348	Switchgrass Phyllosphere	KVFGALRPCLSPYMDERQMNLSYMVLLDMWNIFGQKFLSFIRG*
Ga0182115_12462371	3300015348	Switchgrass Phyllosphere	TGKVFGALRTCLSPYKDECQMNLSYMVLLDMWKMLGEKFLSFIGG*
Ga0182115_12903121	3300015348	Switchgrass Phyllosphere	IPLNCTGKVFGVLRPCLSPYRDERQMNLSYMVLLDMGNMFGQKFLSFIGG*
Ga0182115_13007011	3300015348	Switchgrass Phyllosphere	FKLHGECNRALRHYLSPYRDERQMNLFYMGLLDMWNMFGQKFLSFIGG*
Ga0182115_13059331	3300015348	Switchgrass Phyllosphere	LKCTGKVFGALRPCLSPYRDERQMNLSYVVLLDMWNMFGQNFLSFIGG*
Ga0182185_11138081	3300015349	Switchgrass Phyllosphere	KVFGPLRPCLSPYRDERQMNLSYMVLLDKWNMFG*
Ga0182185_11672731	3300015349	Switchgrass Phyllosphere	HELYPLNCTGKIFGDLRPCLSPYRDERQMNLSYTVLLDMWNMFGQKFLSFIGG*
Ga0182185_11824441	3300015349	Switchgrass Phyllosphere	CTGKVFGALRPCLSPYRVERQMNLSYMVLLDMWNMSGQKFLYFIGG*
Ga0182185_12081091	3300015349	Switchgrass Phyllosphere	ALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKILSFIGA*
Ga0182185_12137521	3300015349	Switchgrass Phyllosphere	NCTGKVFEALRPCLSPYRDERLMNLSYVVLLDMWNMFGLKFLSFIGG*
Ga0182185_12549071	3300015349	Switchgrass Phyllosphere	FGDLRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182185_12801991	3300015349	Switchgrass Phyllosphere	TGKVFGVLRPCLSPYRDERQMNLSYMVLLDMGNMFGQKFLSFIGG*
Ga0182163_10804401	3300015350	Switchgrass Phyllosphere	TGKVFGALRPCLSPYMDERQMNLSYMVLLDKWNMFGQKFLSFIVG*
Ga0182163_11704721	3300015350	Switchgrass Phyllosphere	LNCTGKVFGALRPCLSPYRDERQMNLSYMVLLDIWNMFGQKFLSFIGG*
Ga0182163_11884111	3300015350	Switchgrass Phyllosphere	PLNCTGKEFGALRPCLSPYRDELQMNLSYMVLLDMWNMFGQKFLSFIGG*
Ga0182163_12340682	3300015350	Switchgrass Phyllosphere	MRKVFEALRPCLSPYRDERQMNLSYVVLLDMWNMFGQKFLGFIGG*
Ga0182163_12427111	3300015350	Switchgrass Phyllosphere	NCTRKVFGALRPCLSPYRDEGQMNLSYMVLLYMWNMFGQKFLSFIVG*
Ga0182163_12437201	3300015350	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDERQMILSNMVLLDMWNMFGQKFLYFIGG*
Ga0182163_12581461	3300015350	Switchgrass Phyllosphere	RPRLSPYRDERQMSHSYMVLLDMWNMFAQKFLSFIGG*
Ga0182163_12678451	3300015350	Switchgrass Phyllosphere	MGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSF
Ga0182163_12795561	3300015350	Switchgrass Phyllosphere	LSPYRDERQMNLSYMVLLDTWNMFGQKFLNFIGG*
Ga0182169_11426241	3300015352	Switchgrass Phyllosphere	MSKVLRALRPCLSPYRDERQMNLSYMVLLDMWNMF
Ga0182169_11532981	3300015352	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDEHQMNLFYMVLLDMRNMFGQKFLSFIKG*
Ga0182169_11820761	3300015352	Switchgrass Phyllosphere	MNCTGKVFRALRPCLSPYRDELQVDVSYLILLDVWNMFGQKSLSFIGG*
Ga0182169_11969051	3300015352	Switchgrass Phyllosphere	TGKVFGALRPCLSPYRDERQMNLSYVVLLDMWNMFGQKFLSFIGG*
Ga0182169_12517911	3300015352	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDERQMNISYMVLLDMWNMFGRKFLSFIEG*
Ga0182169_12610561	3300015352	Switchgrass Phyllosphere	PCLSPYRDERQMNLFYMVLLDMWNMFGQKFLSFIGG*
Ga0182169_12782031	3300015352	Switchgrass Phyllosphere	CTGKVFGALRPYLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIKG*
Ga0182179_11351821	3300015353	Switchgrass Phyllosphere	LSHYRDERQMNLSYMVLLDMWNMIWQKFLSFIRS*
Ga0182179_12147041	3300015353	Switchgrass Phyllosphere	NCTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGEKFLSIIGG*
Ga0182179_12154121	3300015353	Switchgrass Phyllosphere	ALRPYLSPYRDERQMNLSYMVLLDMWNIFGQKFLSFIGG*
Ga0182179_12159741	3300015353	Switchgrass Phyllosphere	LRPCLSPYRDERQMNLSYVVLLDMWNMFGQKFLIFIGG*
Ga0182179_12227241	3300015353	Switchgrass Phyllosphere	GALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIRG*
Ga0182179_12409451	3300015353	Switchgrass Phyllosphere	CTGKVFGALRPCLSPYRDERQMNLSYMVLLDIWNMFGQKFLSFIGG*
Ga0182179_12557231	3300015353	Switchgrass Phyllosphere	MGKVFGALRTCLSPYRDERHMNLSYMVLLDMWNIFVEKFLSFIGR*
Ga0182179_12629901	3300015353	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDERQMILSYIVLLDMWNMIGQKFLSFIGG*
Ga0182179_12704081	3300015353	Switchgrass Phyllosphere	VIPLNCTGKVFGALRTCLSPYRDERQMNLSNMVLLDMWNMFGRKFLSFIGG*
Ga0182179_12717061	3300015353	Switchgrass Phyllosphere	GKVFGALRPYLSPYRDERQMNLSYMVLLDMWNMFEQKFLSFIGG*
Ga0182179_12792611	3300015353	Switchgrass Phyllosphere	PCLSPYMDERQINRSYMVLLDMWNMFGQKFLSFIGG*
Ga0182179_12816611	3300015353	Switchgrass Phyllosphere	ALRPCLSPYRDERQMNLSYMVLLDMWNMFEQKFLSFIGG*
Ga0182179_13132271	3300015353	Switchgrass Phyllosphere	KVFGALRPYLSPYRDVRQMILSYIVILNMWNLFGQKFLSFIGG*
Ga0182179_13218771	3300015353	Switchgrass Phyllosphere	YLSPYRDEHQMNLSYMVLLDMWNMLGQKFLSFIGC*
Ga0182179_13219801	3300015353	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDEHQMNPSYMVLLDMWNMFGLKFLSFIGG*
Ga0182179_13228981	3300015353	Switchgrass Phyllosphere	GKVFRALRPCLSPYRDERQMNLSYMVLVDMWNMFVQKFLSFIGG*
Ga0182167_11807912	3300015354	Switchgrass Phyllosphere	MGKVFGALRPSLSPYRDEHQMNLSYIVLLDMWNMFGEKFLSFIGG*
Ga0182167_12355621	3300015354	Switchgrass Phyllosphere	KVFAALRPCLSPYRDERQMNLSYMVLLNMWNMFEQKFLSFIGG*
Ga0182167_13009161	3300015354	Switchgrass Phyllosphere	NCTGKVFGALRPCLSPYRDECQMNLSYMVLLDMWNMFGKKFLRFIGG*
Ga0182167_13309531	3300015354	Switchgrass Phyllosphere	TGKVFGALRPCLSPYRDERQMNLSYMVLLDMRKMFGQKFISVIRG*
Ga0182167_13324401	3300015354	Switchgrass Phyllosphere	GALRPFLSPYRDERQMNLSYMVLLDMWNMIGQKFLSFIRG*
Ga0182197_11314251	3300017408	Switchgrass Phyllosphere	TGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIVG
Ga0182199_10790422	3300017412	Switchgrass Phyllosphere	NCTGKVFGAHWPCLSPYMNERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0182199_11085901	3300017412	Switchgrass Phyllosphere	SLLNCTGKVFGDLRPCLSHYRDERQMNLSYMVLLDMWNIFGQKFLSFIGG
Ga0182199_11661591	3300017412	Switchgrass Phyllosphere	RPCLSPYRDERQMNLSYMVLVDTWNMFGQKFFSFIRG
Ga0182199_11801831	3300017412	Switchgrass Phyllosphere	TGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFG
Ga0182195_10616121	3300017414	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFVRG
Ga0182195_11139141	3300017414	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDERQMNLSYIVLLDMWNMFGVTP
Ga0182195_11408741	3300017414	Switchgrass Phyllosphere	GKVFGPLRPCLSPYRDERQMNLSYMVLLDKWNMFG
Ga0182195_11492112	3300017414	Switchgrass Phyllosphere	GSQALSTPYRDERQMNLSDMVLLDMWNMFGQKFLGFIGG
Ga0182195_11521961	3300017414	Switchgrass Phyllosphere	PLNFMGKVFGALRPCLSPYRDERQMNLSYIVLLDMWNMFGQKFLSFIEG
Ga0182195_11791421	3300017414	Switchgrass Phyllosphere	LNCTGKVFGALRPCLSPYRDEHQMNLSYMVLLDMWNMFGQKFLNFIGG
Ga0182195_11824521	3300017414	Switchgrass Phyllosphere	MRKIFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIG
Ga0182195_11995151	3300017414	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMIGQKFLSFIGC
Ga0182195_12028771	3300017414	Switchgrass Phyllosphere	RLKCTGKVFGALRPCLSPYRDERQMNLSYVVLLDMWNMFGQNFLSFIGG
Ga0182195_12030531	3300017414	Switchgrass Phyllosphere	VFGALRPCLSPYRDEHQMNLSYMVLLDMQNMFGKNFLSFIGY
Ga0182195_12237881	3300017414	Switchgrass Phyllosphere	RALRPCLSPYRDERQMNLSYMVLDMWNMFGKKFLSFIGG
Ga0182213_10980901	3300017421	Switchgrass Phyllosphere	KVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGKKFLSFIGG
Ga0182201_11122991	3300017422	Switchgrass Phyllosphere	MEKVFGALRPCLSPYRDERQMNLSYMVLLDMWNIFGQKFLSFIGG
Ga0182196_10890011	3300017432	Switchgrass Phyllosphere	LRPCLSPYRDERQMNLSYMVLLDMWKMFGQKFLSVIRG
Ga0182196_11003851	3300017432	Switchgrass Phyllosphere	VFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0182196_11515331	3300017432	Switchgrass Phyllosphere	KVFGPLRPCLSPYRDERQMNLSYMVLLGTWNMFGQKFLSFIGG
Ga0182196_11575191	3300017432	Switchgrass Phyllosphere	KVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKILSFIGG
Ga0182194_10592241	3300017435	Switchgrass Phyllosphere	PLNYTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIRG
Ga0182194_11079701	3300017435	Switchgrass Phyllosphere	MGKVFGDLRPCLSPYRDERQMNLSYMVLLDMWNMFG
Ga0182194_11357151	3300017435	Switchgrass Phyllosphere	NCTGKVFGALRPCLSPYRDERQMNLSYMVLLDTWNMFGQKFLSFIGV
Ga0182194_11457521	3300017435	Switchgrass Phyllosphere	KVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGLNFLSFIGG
Ga0182200_10612231	3300017439	Switchgrass Phyllosphere	PCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGA
Ga0182200_10777001	3300017439	Switchgrass Phyllosphere	PCLSPYRDERQMNLSYIVLLDMWNMFGQKFLSFIGG
Ga0182200_10970771	3300017439	Switchgrass Phyllosphere	STGKVFRALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFPSFIGG
Ga0182200_10975871	3300017439	Switchgrass Phyllosphere	KVFGALRPCLSPYRDERQMNLSNMVLLEMWNMFGQKFLSFIGG
Ga0182200_11112071	3300017439	Switchgrass Phyllosphere	RPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFTVG
Ga0182200_11256601	3300017439	Switchgrass Phyllosphere	CMGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFPSFIGG
Ga0182200_11280691	3300017439	Switchgrass Phyllosphere	YLLPYRDERQMNLSYMVLLDMWNMFGKIFLSFIGG
Ga0182214_10755711	3300017440	Switchgrass Phyllosphere	FGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLCFIRG
Ga0182214_10838811	3300017440	Switchgrass Phyllosphere	CTRKVFGALRPCLAPYRDERQMNLSYMVLLDMWNMFGQNFLNFIGG
Ga0182214_11400691	3300017440	Switchgrass Phyllosphere	CTGKVSGALRPFLSHYRDERQMNPSYMVLLDMWNMFGQKFLSFIGG
Ga0182198_10539631	3300017445	Switchgrass Phyllosphere	TGKVFGALRPCLSPYRDERQMNLSYMVLLDTWNMFGQKILSFIGG
Ga0182198_11569061	3300017445	Switchgrass Phyllosphere	NCMVKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0182198_11642691	3300017445	Switchgrass Phyllosphere	NCTGNVFGALRPCLSPYRDERQMILSYMVLLDMWNMFGQKFISFIGG
Ga0182198_11662871	3300017445	Switchgrass Phyllosphere	KVFWALRPCLSPYMDERQMNLSYMVILDMWNMFGQKFLSFIGG
Ga0182212_11180581	3300017691	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDERQMNLSYMVLLDMWNIFGQKFLSFIGG
Ga0182212_11403351	3300017691	Switchgrass Phyllosphere	ALRPCLLPYGDERQMNLSYMVLLDTWNMFGQKLLSLIGG
Ga0182210_11477551	3300017692	Switchgrass Phyllosphere	RGKVFGPLRPCLSPYRDERQMNLSYMVLLDMWNMIGQKFLSFIGG
Ga0182216_11136141	3300017693	Switchgrass Phyllosphere	VFGDLRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLNFIGG
Ga0182216_11439471	3300017693	Switchgrass Phyllosphere	VFGALRPCLSPYRDEHQMNLSYMVLLDMWNMFGQKFLNFIGG
Ga0182216_11507941	3300017693	Switchgrass Phyllosphere	ALRTCLSPYRDERQMNLSYVVLLDMRNIFGQKFLSFIGG
Ga0182216_11735801	3300017693	Switchgrass Phyllosphere	FGALRPCLAPYRDERQMNLSYMVLLDMWNMFGKNFLSFIVG
Ga0182216_11745891	3300017693	Switchgrass Phyllosphere	PLNCTGKVFGALRPCLSPYRDECQMNLSYLVLLDMWNMFGQKFLNFNGG
Ga0182216_11859241	3300017693	Switchgrass Phyllosphere	TGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKLLSFIGS
Ga0182216_11878881	3300017693	Switchgrass Phyllosphere	MGKVFGALRPCLSPYRDKHQMNLSYMVLLDKWNMFGQKFFCFFGG
Ga0182216_12105581	3300017693	Switchgrass Phyllosphere	VFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGLKYLSFIAG
Ga0182211_11550741	3300017694	Switchgrass Phyllosphere	GKVFGALRPCLSPYRDERQMNLSYMILLDMWNMFEQKFLSFIGG
Ga0182178_10052691	3300020023	Switchgrass Phyllosphere	LNCTGKVFGALRPCLSPYRDERQMILSYIVLLDMWNMFGQKFLSFIGG
Ga0182178_10081541	3300020023	Switchgrass Phyllosphere	LRTCLSSYRDERRINLSYTVLLDMWNMFGQKFLSFIGG
Ga0182178_10120481	3300020023	Switchgrass Phyllosphere	VFGALRPCLSPYRDERQMNLSYMVILDMWNMLGEK
Ga0182178_10136341	3300020023	Switchgrass Phyllosphere	SRTGKVFGALRPCLSSYRDELQMNLFYMVLLDMWNMFGHKFLSFIRG
Ga0182178_10164721	3300020023	Switchgrass Phyllosphere	PCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0182178_10173611	3300020023	Switchgrass Phyllosphere	LRPFLSPYRDERQINLSYMVLLDMWNMFGQKFLSFIGG
Ga0182178_10195431	3300020023	Switchgrass Phyllosphere	FTGKVFGALRPCQSPYRDERQMNLSYMVLLDMSNIFGQKFLNFIGG
Ga0182178_10219542	3300020023	Switchgrass Phyllosphere	AFKLHGEGFGALRPCLSPYRDERQINLSHMVLLDMWNMFGKKFLSFKGG
Ga0182118_1009811	3300020223	Switchgrass Phyllosphere	CIGKVFGALRPCLSPYRDERQMNLSYMVLLDTWNMFGQKFLSFIGG
Ga0213505_1227641	3300022465	Switchgrass Phyllosphere	WTGKVFGALRPCLSPNRDERQMNLSYMVLLDMWNMFG
Ga0207703_112073321	3300026035	Switchgrass Rhizosphere	KVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIRG
Ga0207641_120810311	3300026088	Switchgrass Rhizosphere	LRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0207676_122311701	3300026095	Switchgrass Rhizosphere	GKEFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGEKFLSFIRG
Ga0207675_1010873312	3300026118	Switchgrass Rhizosphere	NCTGKVFGALRPCLSPYRDERQMILSYMVLLDMWNMFGQKFLSFIGG
Ga0207439_1034181	3300026740	Soil	MGKVFRALRPCLSPYRDERQMNLSYMVLLDMWNMFEQKFLSFIGG
Ga0268322_10094541	3300028049	Phyllosphere	KVFGALRPCLSPYRDERQMNLSYMVLLDMWNIFGQKFLSFIGG
Ga0268322_10149671	3300028049	Phyllosphere	VALRLCLSPYRDERLMNLSYMALLDMWNMFGQKFLSF
Ga0268322_10269281	3300028049	Phyllosphere	PLNCTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMIGQKFLSFIGC
Ga0268322_10376421	3300028049	Phyllosphere	KVFGAIRPCLSPYRDELQMNLSYMVLLDLWNMFGHKFLSFIGG
Ga0268328_10095011	3300028050	Phyllosphere	RPCLSPYRDECQMNLSYMVLLDMWNMFGQKFLSFIVG
Ga0268328_10472511	3300028050	Phyllosphere	LRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFVRG
Ga0268328_10541641	3300028050	Phyllosphere	KVFGALRPCLSPYRDERQINLSYMVLLDMWNMFGQKFLSFIGG
Ga0268328_10545111	3300028050	Phyllosphere	YLSPYRDERQMNLSYVVLLDMWNMFGQKFLSFIGG
Ga0268328_10650581	3300028050	Phyllosphere	GKVFGALRPCLSPYRDERQMNLSYLVLLDMWNMFGQKFLNFIGG
Ga0268344_10075441	3300028051	Phyllosphere	TGKVFGALRPCLSPYRDERQMNLSYLVLLDMWNMFGQNFLSFIGG
Ga0268344_10075501	3300028051	Phyllosphere	YPLNCTGKVFGAHRPCLSPYRDERQMNLSYVVLLDMWNMFGQKFLSFIGG
Ga0268344_10117611	3300028051	Phyllosphere	PLNCTGKVFGALRPCLSPYMDERQMNLSYMILLDMWNMFGQKFLSFIGG
Ga0268344_10192541	3300028051	Phyllosphere	LNCTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGKTFLSFIGG
Ga0268344_10200851	3300028051	Phyllosphere	CTGKVFEALRPCLSPYRDECQMNLSYMVLLDMWNMFGQKFLYFIEG
Ga0268344_10261401	3300028051	Phyllosphere	VFGALRPCLSPYRDERQMILSYIVLDMWNMFGQKFLSFIGG
Ga0268300_10052991	3300028052	Phyllosphere	FRDLRPCLSPYRDERQMNISYMVLLDMWNMFGQKFLSFIEG
Ga0268300_10106921	3300028052	Phyllosphere	CLSPYRDELQMNLSYMVLLDLWNMFGHKFLSFIGG
Ga0268300_10115331	3300028052	Phyllosphere	PCLSPYRDECQMNLSYVVLLDMWNMFGQKFLSFIGG
Ga0268300_10120741	3300028052	Phyllosphere	STGKVFGALRPCLSPNRDERQMNLSYMFLLDMWNMFGQNFLSFIGG
Ga0268346_10046911	3300028053	Phyllosphere	MGRVFRALRPYLSPYRDERQMNLSYKVLLDMWNMFGQKFLGFI
Ga0268338_10104351	3300028055	Phyllosphere	MGKVFRALRPCLSPYRDERQMNLSYMFLLDMWNMFGQNFLSFVGG
Ga0268330_10110761	3300028056	Phyllosphere	RNCLSPYRDEHQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0268330_10174991	3300028056	Phyllosphere	VIRALRPCLVPYRDERQMNLSYMVLLDMWNMFGKIFLSFIGG
Ga0268330_10206682	3300028056	Phyllosphere	HELYPLNCTGKIFGDLRPCLSPYRDERQMNLSYTVLLDMWNMFGQKFLSFIGG
Ga0268330_10222551	3300028056	Phyllosphere	GKVFGALRPYVSPYRDEHQMNLSYMVLQDMWNMFGQKFLSFIGG
Ga0268330_10280461	3300028056	Phyllosphere	PLNCTGKVFGALRTCLSPYRDERKMNLSYMVLLDMWNMLGEKFLSFIGG
Ga0268330_10404391	3300028056	Phyllosphere	LRPCLSPYRDERQMNLFYMVLLDMWNMFGQKFLSFIGG
Ga0268330_10406361	3300028056	Phyllosphere	RPCLSPYRDERQMNLSYMVLLDMWNIFGQKFLSFIGG
Ga0268330_10487331	3300028056	Phyllosphere	MGKVFQALRPCLSPYRDERQMNLSFMVLLDMWNMVGQIFLSFIG
Ga0268330_10494371	3300028056	Phyllosphere	NCTGKVFGALRPCLSPYSDERQMNLSYMVLADTWNMFGQKFLSFIRD
Ga0268352_10261891	3300028057	Phyllosphere	CLSPYRDERQMNLSYVVLLDMWNMFGQKFLSFIGG
Ga0268332_10137251	3300028058	Phyllosphere	PYLSPYRDEHHMNLSNMVLLDMWNMFGQKFLSFIGG
Ga0268332_10381581	3300028058	Phyllosphere	KVFVALMPCLSPYRDERQMNLSYMVLLEMRNMFGQKFLSFIGG
Ga0268332_10789281	3300028058	Phyllosphere	CLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0268314_10313241	3300028061	Phyllosphere	ALRPYLSPYRDEHQMNLSYMVLLDMWNMFGQKFLNFIGG
Ga0268342_10265941	3300028062	Phyllosphere	TGSVFEALRPCLSPYRDERQMNLSYMVLLDMWNMFGKKFISFIGG
Ga0268342_10266121	3300028062	Phyllosphere	YLSPYRDESQMNLSYMVLLDVWNMFGQKFLSFIRG
Ga0268342_10290781	3300028062	Phyllosphere	YPLNCTGKVFGALRPFLSPYRDERQMNLSYMVLLDMWKMFGQKFLSVIRG
Ga0268342_10306311	3300028062	Phyllosphere	CTGKVFGALRPCLSPYRDECQMNLSYVVLLDMWNMFGQKFLSFIRG
Ga0268342_10330581	3300028062	Phyllosphere	PCLSPYRDERQMNLYYMVLLDMWNMFGQKFLSFIGG
Ga0268340_10095811	3300028064	Phyllosphere	RKVFGDLRPYLSPYRDDCQMNLSYMVLQDMWNMFGQKFLSFVGG
Ga0268340_10565781	3300028064	Phyllosphere	PLNCTGKVFGALRPCLSPYRDERQMIFSYIVLLDMWNMFGQKFLSFIGG
Ga0268340_10747821	3300028064	Phyllosphere	RKVFGALRPCLSPYRDERQMNLSYMVLLDTWNMIGQKFLSFIGG
Ga0268340_10762501	3300028064	Phyllosphere	RPCLSPYRDERQMNLSYVVLPDMWNMFGLKFLSFIGG
Ga0268326_10088671	3300028141	Phyllosphere	GKVFGALRPCLSPYMDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0268347_10050361	3300028142	Phyllosphere	EKVFGALRPCLSPYTDERQMNLSYAILLDMWNMIGQKFLSFIRD
Ga0268347_10065531	3300028142	Phyllosphere	NYMGKVFGALKPYLSPYRDERQMSLSYMVLLDMWNMFGEKFLSIIGG
Ga0268347_10065532	3300028142	Phyllosphere	MAFKLHRKVFGALRPCLSPYRDERQMSLSYMVLLDMCNM
Ga0268347_10140381	3300028142	Phyllosphere	PVALNCTGKLFGALRPCLSPYRDERQMNLSYMVLLDM
Ga0268347_10140431	3300028142	Phyllosphere	MSKVLRALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSF
Ga0268347_10173411	3300028142	Phyllosphere	GALRPCLSPYRDERQMNLSYMVLLDMWNMFGQQFLCFIRG
Ga0268347_10261811	3300028142	Phyllosphere	FGALRPCLSPYRDELQMNLSYMVLLDLWNMFGHKFLSFIGG
Ga0268347_10313171	3300028142	Phyllosphere	STGKVFRAPRPYLSPYIDERQMNLSYLVLLDMWNMFGQKFPSFIGG
Ga0268347_10316711	3300028142	Phyllosphere	PSNYTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFG
Ga0268347_10329161	3300028142	Phyllosphere	YPLNCTEKVFGALRPCLLPYRDECQTNLSYMVLLDMWNMFGHKFLSFNGG
Ga0268348_10101021	3300028143	Phyllosphere	SKVLRALRPCLSPYRDERQMNLSYMVLLDIWNMFGQKFLSFIRG
Ga0268348_10140241	3300028143	Phyllosphere	MGKVFGALRPFLSPYRDERQMNLSYMILLDMWNMFGPKFLSFIG
Ga0268348_10192791	3300028143	Phyllosphere	VFGDLRPCLSPYRDERQMNLSYIFLLDMWNMFGQKFLSFIGG
Ga0268348_10260711	3300028143	Phyllosphere	CTGKVFGALRPCLSPYKDERQMNLSYVVLLDMWNMFGQKFLSFIVG
Ga0268353_1164411	3300028149	Phyllosphere	CLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIRG
Ga0268343_10107642	3300028150	Phyllosphere	LNCTGKVFEALRPCLSPYRDERLMNLSYVVLLDMWNMFGQKFLSFIGG
Ga0268343_10146391	3300028150	Phyllosphere	CLSPYRDVRQMNLSYMVLVDTWNMFGQKFLSFIGG
Ga0268308_10025691	3300028151	Phyllosphere	LNCTGKVFGALRPCLSPYRNERQMNLSYMVLLEMWNMFGEKFLSFIRG
Ga0268308_10027741	3300028151	Phyllosphere	NCTGKVFGALRHCLSPYRDELQMNLSYMVLLDMWNMFGQKYLGFIRA
Ga0268308_10064371	3300028151	Phyllosphere	TGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0268308_10077241	3300028151	Phyllosphere	GALRPCLSPYRDERQMNLSYVVLLDMWNMFGQKFLSFIGG
Ga0268308_10128501	3300028151	Phyllosphere	GNVFGALRPYLSPYRDERQMNLSYMVLLDMWNMFGQKILSFVGG
Ga0268308_10169291	3300028151	Phyllosphere	MGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLCF
Ga0268308_10176861	3300028151	Phyllosphere	TCLSPYRDERQMNLSYMVLLDMWNMLGEKFLGFIGG
Ga0268308_10223471	3300028151	Phyllosphere	ELEHLNGTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWSMFEQKFLSFFGG
Ga0268308_10314131	3300028151	Phyllosphere	STGKVFRALRPFLSPYRDERQMNLSYMVLLDMWNMFGQKFPSFIGG
Ga0268320_10197121	3300028153	Phyllosphere	PLNCTGKVFGALRPCLSPYRDERQMILSYIVLLDMWNMFGQKFLSFIGG
Ga0268320_10207471	3300028153	Phyllosphere	CTGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIVG
Ga0268320_10255521	3300028153	Phyllosphere	RPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFVRG
Ga0268341_10067321	3300028154	Phyllosphere	RLNYTGKVFGALRPCLSPYRDERQMNLSYMVLLDTWNMFGQKILSFIGG
Ga0268341_10124401	3300028154	Phyllosphere	GKVFGALRNCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0268341_10191171	3300028154	Phyllosphere	MALRPCLSLYRDERYMNLSYMVLLDMWNMFGPKFLSFI
Ga0268341_10226411	3300028154	Phyllosphere	GKVFGPLRPYLSPYRDECQMNLPYMVLLDMWNMFG
Ga0268312_10013871	3300028248	Phyllosphere	MGKVFGALRPCLSPNRDERQMNLSYMVLLDMWNMFGQKFLS
Ga0268312_10098681	3300028248	Phyllosphere	KLTGKVFGAIRPCLSPYRDELQMNLSYMVLLDLWNMFGHKFLSFIGG
Ga0268312_10279161	3300028248	Phyllosphere	LNYTVKVFGAIRPCLSPYRDERQLNLSYIVLLDMWNMFGLKFLSFIGG
Ga0268312_10376281	3300028248	Phyllosphere	RPGQSPYRDERQMNLSYMVLLDMWNIFGQKFLSFIGG
Ga0268324_10080651	3300028251	Phyllosphere	YPLNCTGKVFGALRPCLSPYRDECQMILSYMVLLDMWNMFGQKFLCFIGG
Ga0268316_10238561	3300028253	Phyllosphere	RPCLSLYRDERQMNLSYVVLLDMWNMFGQKFLSFVGG
Ga0268304_10117021	3300028256	Phyllosphere	LRALRPCLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0268310_10017741	3300028262	Phyllosphere	YMGKVFGALRPCLSPYRDESQMNLSYTVLLDMWNMIGQKFLSFIGG
Ga0268310_10153241	3300028262	Phyllosphere	CLSPYRDERQMNLSYMVFLDMWNLFGKKFLCFIGG
Ga0268310_10347052	3300028262	Phyllosphere	LRALRPSLSPYRDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0268310_10392821	3300028262	Phyllosphere	RPCLSPYRDERQMNLSYMVILDMWNMFGKKFLSSIGG
Ga0268310_10396851	3300028262	Phyllosphere	CTGKVFEALMPCLSPYRDERQLNLSYMVLLDLWNMFGQKFLGFVGG
Ga0268310_10448641	3300028262	Phyllosphere	GKVFGALRPCLSPYRDERQMNLSYMVHLDMWNMFGQKFLSFIGG
Ga0268310_10465871	3300028262	Phyllosphere	FGALRPYLSPYRDERQMNLSYMVLLDMWNLFGQNFLSFIGG
Ga0268302_1049531	3300028464	Phyllosphere	VRPCLSPYRDERQMNLSYIILIDMWNMFGQKFLSFIGG
Ga0268302_1092311	3300028464	Phyllosphere	LRPCLSPYRDERQMNLSYMVLLDTWNMFGQKFLSFI
Ga0268321_1105381	3300028466	Phyllosphere	NVFGALRPCLSPYRDERQMILSYMVLLDMWNMFGQKFISFIGG
Ga0268317_10116671	3300028468	Phyllosphere	NCPGKVFGALRHCLLPYRDERQINLSYMVLLDMWNMFGQKFLSFIGG
Ga0268337_10162511	3300028469	Phyllosphere	MHGKVFGALRPCLSPYRDERQMNLSYMVLLDMWNMFVQKFLSFIG
Ga0268323_10157561	3300028471	Phyllosphere	QPLNCTGKVFGALRPCLSPYMDERQMTLSYMVLLDMWNMFGQKLLSFILG
Ga0268315_10058571	3300028472	Phyllosphere	FGAVRPCLSPYRDERQMNLAYMVLLDMWNMFGQKFLSFIRG
Ga0268315_10127741	3300028472	Phyllosphere	GALRTCLSPYRDERQMNLSYVVLLDMRNIFGQKFISFIGG
Ga0268319_10027701	3300028473	Phyllosphere	CTGKVFGAVRPCLSPYRDERQMNLSYMVLLDMWNMIGQKFLSFIGC
Ga0268319_10172941	3300028473	Phyllosphere	FGALRPCLLPYRDERQMNLSYMVLLDTWNMFGQKFLSFI
Ga0268319_10223181	3300028473	Phyllosphere	RVVFSPYRDERQMNLFYMVLLDMWNIFGQKFLSFIGG
Ga0268331_10213301	3300028474	Phyllosphere	CLSLYRDERQMNLSYMVLLDMWNMFGQKFLSFIRG
Ga0268327_10175441	3300028475	Phyllosphere	CLSPYRDEHQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0268329_10066811	3300028476	Phyllosphere	ALRPYLSPYRDERQLNLSYIVLLDMWNMFGLKFLSFIGG
Ga0268313_10068011	3300028523	Phyllosphere	RPYLSPYRDERQMNLSYIVLLDMWNMFGQKFLSFIGG
Ga0268313_10103291	3300028523	Phyllosphere	GLSPYRDERQTNLSYMVLLDMWNMFGQKFLSFIGG
Ga0268305_1100881	3300028525	Phyllosphere	CLSPYRYERQMNLSYMVLLDKWNMFGQKFLSFIGG
Ga0268339_10108071	3300028526	Phyllosphere	MGKVFGALRPRLSPYRDERQMSHSYMVLLDMWNMF
Ga0268339_10116541	3300028526	Phyllosphere	MVFGALRPCLSPYRDERQINLSYMVLLDMWNMFGQKLLSFIGG
Ga0268339_10176911	3300028526	Phyllosphere	PCLSAYRDERQMNLSYMVLLDMWNMFGLNFLSFVGG
Ga0268339_10189551	3300028526	Phyllosphere	TCTGNVFGALRTCLSPYRDERQMNLSYVVLLDMRNIFGQKFLSFIGG
Ga0268335_10106741	3300028527	Phyllosphere	LRPCLSPYRDERQMILSYIVLLDMWNMFGQKFLSFIGG
Ga0268311_10108991	3300028529	Phyllosphere	RYSGALRPCLSPYRAERQMNLSYLVLLDMWNMFGQKFLSFIGG
Ga0268311_10144491	3300028529	Phyllosphere	LNCTGKVFGALRPCLSPYRDERQMNLSYVVLLDMWNMFGQKFLIFIGG
Ga0268311_10184491	3300028529	Phyllosphere	GALRSCLSPYSDERQMNLSYMVLLDMWNIFGQKFLSFIRG
Ga0268311_10195611	3300028529	Phyllosphere	ALRPCLSPYRDDCQMNLSYMVLLDMWNMIGQKFLSFIGG
Ga0214493_11536081	3300032465	Switchgrass Phyllosphere	MGKVFGALRPCLSPYSDERQMNLSYMVLLDMWNMFGQKFL
Ga0214503_12011051	3300032466	Switchgrass Phyllosphere	GALRPCLSPYWDERQMNLSYVVLLDMCNMFGQKFLSFIGG
Ga0214490_11480571	3300032502	Switchgrass Phyllosphere	FWALRPCLSPYRDERQMSLSYMVLLDMCNMFGEKFLNFIGV
Ga0214490_11612711	3300032502	Switchgrass Phyllosphere	MPFLSSYMDERQINLSYMVFLDMWNMFRQKFLSFIR
Ga0214490_11612712	3300032502	Switchgrass Phyllosphere	LLNCTRNVFVALRPCLSPYRDESQMILSYIVLLKMWNIFGQKFLSFIGG
Ga0214484_11012841	3300032591	Switchgrass Phyllosphere	GALRPCLPPYRDERQMNLSYLVLLDMWNIFGQKFLNFIGG
Ga0214499_12861681	3300032697	Switchgrass Phyllosphere	PCLSPYRDGRQMNLSYVILLDMWTMFGQKFLSFIGG
Ga0214494_10993831	3300032699	Switchgrass Phyllosphere	CLSPYRDERQMNLSDVVLLDMWIMFGQKFLSFIGG
Ga0314718_10204571	3300032811	Switchgrass Phyllosphere	GALRPCLSPYMDERQMNLSYMVLLDMWNMFGQKFLSFIGG
Ga0314739_10740161	3300032913	Switchgrass Phyllosphere	ALRPYLSPYRDERQMNLSYMVSLDIWNMFSRKFLSFIRG

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.41
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.41
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F004317

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign