Basic Information | |
---|---|
Family ID | F003929 |
Family Type | Metagenome |
Number of Sequences | 461 |
Average Sequence Length | 39 residues |
Representative Sequence | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKFD |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 461 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 4.22 % |
% of genes near scaffold ends (potentially truncated) | 62.47 % |
% of genes from short scaffolds (< 2000 bps) | 74.40 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (78.308 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment (24.729 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.410 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (41.215 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 461 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 1.74 |
PF06808 | DctM | 1.52 |
PF07992 | Pyr_redox_2 | 1.52 |
PF13561 | adh_short_C2 | 1.30 |
PF13458 | Peripla_BP_6 | 1.30 |
PF00528 | BPD_transp_1 | 1.30 |
PF03480 | DctP | 1.08 |
PF04055 | Radical_SAM | 1.08 |
PF02653 | BPD_transp_2 | 1.08 |
PF07331 | TctB | 0.87 |
PF00441 | Acyl-CoA_dh_1 | 0.87 |
PF00072 | Response_reg | 0.87 |
PF03060 | NMO | 0.87 |
PF02321 | OEP | 0.65 |
PF01040 | UbiA | 0.65 |
PF01558 | POR | 0.65 |
PF09312 | SurA_N | 0.65 |
PF02915 | Rubrerythrin | 0.65 |
PF00465 | Fe-ADH | 0.65 |
PF02769 | AIRS_C | 0.65 |
PF02737 | 3HCDH_N | 0.65 |
PF02954 | HTH_8 | 0.65 |
PF03069 | FmdA_AmdA | 0.65 |
PF01808 | AICARFT_IMPCHas | 0.65 |
PF00106 | adh_short | 0.65 |
PF01520 | Amidase_3 | 0.65 |
PF00501 | AMP-binding | 0.43 |
PF00873 | ACR_tran | 0.43 |
PF04993 | TfoX_N | 0.43 |
PF04773 | FecR | 0.43 |
PF01850 | PIN | 0.43 |
PF03972 | MmgE_PrpD | 0.43 |
PF00009 | GTP_EFTU | 0.43 |
PF01592 | NifU_N | 0.43 |
PF13193 | AMP-binding_C | 0.43 |
PF13378 | MR_MLE_C | 0.43 |
PF01545 | Cation_efflux | 0.43 |
PF03450 | CO_deh_flav_C | 0.43 |
PF04963 | Sigma54_CBD | 0.43 |
PF00912 | Transgly | 0.43 |
PF01145 | Band_7 | 0.43 |
PF00011 | HSP20 | 0.43 |
PF01048 | PNP_UDP_1 | 0.43 |
PF00378 | ECH_1 | 0.43 |
PF14833 | NAD_binding_11 | 0.43 |
PF00903 | Glyoxalase | 0.43 |
PF00440 | TetR_N | 0.43 |
PF16576 | HlyD_D23 | 0.43 |
PF16868 | NMT1_3 | 0.43 |
PF08984 | DUF1858 | 0.43 |
PF13607 | Succ_CoA_lig | 0.43 |
PF01208 | URO-D | 0.43 |
PF00950 | ABC-3 | 0.43 |
PF05853 | BKACE | 0.43 |
PF01434 | Peptidase_M41 | 0.43 |
PF00152 | tRNA-synt_2 | 0.43 |
PF01609 | DDE_Tnp_1 | 0.43 |
PF00266 | Aminotran_5 | 0.43 |
PF02673 | BacA | 0.43 |
PF13744 | HTH_37 | 0.43 |
PF00202 | Aminotran_3 | 0.43 |
PF00920 | ILVD_EDD | 0.43 |
PF05167 | DUF711 | 0.22 |
PF01312 | Bac_export_2 | 0.22 |
PF03328 | HpcH_HpaI | 0.22 |
PF13145 | Rotamase_2 | 0.22 |
PF04015 | DUF362 | 0.22 |
PF00701 | DHDPS | 0.22 |
PF04468 | PSP1 | 0.22 |
PF08402 | TOBE_2 | 0.22 |
PF01171 | ATP_bind_3 | 0.22 |
PF01066 | CDP-OH_P_transf | 0.22 |
PF01613 | Flavin_Reduct | 0.22 |
PF04295 | GD_AH_C | 0.22 |
PF00069 | Pkinase | 0.22 |
PF10996 | Beta-Casp | 0.22 |
PF00361 | Proton_antipo_M | 0.22 |
PF05973 | Gp49 | 0.22 |
PF01182 | Glucosamine_iso | 0.22 |
PF13365 | Trypsin_2 | 0.22 |
PF12441 | CopG_antitoxin | 0.22 |
PF01039 | Carboxyl_trans | 0.22 |
PF11010 | DUF2848 | 0.22 |
PF03401 | TctC | 0.22 |
PF01925 | TauE | 0.22 |
PF00164 | Ribosom_S12_S23 | 0.22 |
PF00582 | Usp | 0.22 |
PF00994 | MoCF_biosynth | 0.22 |
PF09992 | NAGPA | 0.22 |
PF01979 | Amidohydro_1 | 0.22 |
PF11219 | DUF3014 | 0.22 |
PF02374 | ArsA_ATPase | 0.22 |
PF01661 | Macro | 0.22 |
PF02775 | TPP_enzyme_C | 0.22 |
PF01951 | Archease | 0.22 |
PF00107 | ADH_zinc_N | 0.22 |
PF00395 | SLH | 0.22 |
PF00578 | AhpC-TSA | 0.22 |
PF00586 | AIRS | 0.22 |
PF02080 | TrkA_C | 0.22 |
PF02540 | NAD_synthase | 0.22 |
PF02771 | Acyl-CoA_dh_N | 0.22 |
PF11897 | DUF3417 | 0.22 |
PF13288 | DXPR_C | 0.22 |
PF14559 | TPR_19 | 0.22 |
PF00177 | Ribosomal_S7 | 0.22 |
PF01795 | Methyltransf_5 | 0.22 |
PF02195 | ParBc | 0.22 |
PF02682 | CT_C_D | 0.22 |
PF02803 | Thiolase_C | 0.22 |
PF00675 | Peptidase_M16 | 0.22 |
PF00580 | UvrD-helicase | 0.22 |
PF01970 | TctA | 0.22 |
PF12419 | DUF3670 | 0.22 |
PF02310 | B12-binding | 0.22 |
PF08901 | DUF1847 | 0.22 |
PF13358 | DDE_3 | 0.22 |
PF04715 | Anth_synt_I_N | 0.22 |
PF14358 | DUF4405 | 0.22 |
PF02629 | CoA_binding | 0.22 |
PF09339 | HTH_IclR | 0.22 |
PF00291 | PALP | 0.22 |
PF00857 | Isochorismatase | 0.22 |
PF13231 | PMT_2 | 0.22 |
PF07927 | HicA_toxin | 0.22 |
PF01370 | Epimerase | 0.22 |
PF01425 | Amidase | 0.22 |
PF13453 | zf-TFIIB | 0.22 |
PF03358 | FMN_red | 0.22 |
PF00216 | Bac_DNA_binding | 0.22 |
PF13411 | MerR_1 | 0.22 |
PF02361 | CbiQ | 0.22 |
PF03144 | GTP_EFTU_D2 | 0.22 |
PF00561 | Abhydrolase_1 | 0.22 |
PF14815 | NUDIX_4 | 0.22 |
PF02502 | LacAB_rpiB | 0.22 |
PF00550 | PP-binding | 0.22 |
PF08843 | AbiEii | 0.22 |
PF00497 | SBP_bac_3 | 0.22 |
PF01121 | CoaE | 0.22 |
PF04851 | ResIII | 0.22 |
PF13847 | Methyltransf_31 | 0.22 |
PF08281 | Sigma70_r4_2 | 0.22 |
PF12399 | BCA_ABC_TP_C | 0.22 |
PF13776 | DUF4172 | 0.22 |
PF02579 | Nitro_FeMo-Co | 0.22 |
PF09917 | DUF2147 | 0.22 |
PF13801 | Metal_resist | 0.22 |
PF01641 | SelR | 0.22 |
PF02347 | GDC-P | 0.22 |
PF13011 | LZ_Tnp_IS481 | 0.22 |
PF02397 | Bac_transf | 0.22 |
PF05015 | HigB-like_toxin | 0.22 |
PF09976 | TPR_21 | 0.22 |
PF11249 | DUF3047 | 0.22 |
PF01702 | TGT | 0.22 |
PF06429 | Flg_bbr_C | 0.22 |
PF16916 | ZT_dimer | 0.22 |
PF01887 | SAM_HAT_N | 0.22 |
PF00725 | 3HCDH | 0.22 |
PF02405 | MlaE | 0.22 |
PF00313 | CSD | 0.22 |
PF02190 | LON_substr_bdg | 0.22 |
PF13175 | AAA_15 | 0.22 |
PF09861 | Lar_N | 0.22 |
PF13533 | Biotin_lipoyl_2 | 0.22 |
PF01799 | Fer2_2 | 0.22 |
PF13380 | CoA_binding_2 | 0.22 |
PF16321 | Ribosom_S30AE_C | 0.22 |
PF02667 | SCFA_trans | 0.22 |
PF12838 | Fer4_7 | 0.22 |
PF02075 | RuvC | 0.22 |
PF00881 | Nitroreductase | 0.22 |
PF01568 | Molydop_binding | 0.22 |
PF07963 | N_methyl | 0.22 |
PF09285 | Elong-fact-P_C | 0.22 |
PF02596 | DUF169 | 0.22 |
PF02585 | PIG-L | 0.22 |
PF03205 | MobB | 0.22 |
PF01882 | DUF58 | 0.22 |
PF13727 | CoA_binding_3 | 0.22 |
PF00206 | Lyase_1 | 0.22 |
PF11304 | DUF3106 | 0.22 |
PF07729 | FCD | 0.22 |
PF04536 | TPM_phosphatase | 0.22 |
PF02391 | MoaE | 0.22 |
PF13432 | TPR_16 | 0.22 |
PF09190 | DALR_2 | 0.22 |
PF14076 | DUF4258 | 0.22 |
PF03129 | HGTP_anticodon | 0.22 |
PF01041 | DegT_DnrJ_EryC1 | 0.22 |
PF02754 | CCG | 0.22 |
PF13646 | HEAT_2 | 0.22 |
PF01546 | Peptidase_M20 | 0.22 |
PF01761 | DHQ_synthase | 0.22 |
PF13597 | NRDD | 0.22 |
PF00588 | SpoU_methylase | 0.22 |
PF00117 | GATase | 0.22 |
PF04972 | BON | 0.22 |
PF08442 | ATP-grasp_2 | 0.22 |
PF06865 | Ppnp | 0.22 |
PF09335 | SNARE_assoc | 0.22 |
PF13401 | AAA_22 | 0.22 |
PF03992 | ABM | 0.22 |
PF03748 | FliL | 0.22 |
PF13344 | Hydrolase_6 | 0.22 |
PF11453 | DUF2950 | 0.22 |
PF08299 | Bac_DnaA_C | 0.22 |
PF02683 | DsbD | 0.22 |
PF13692 | Glyco_trans_1_4 | 0.22 |
PF02784 | Orn_Arg_deC_N | 0.22 |
PF13187 | Fer4_9 | 0.22 |
PF01175 | Urocanase | 0.22 |
PF00988 | CPSase_sm_chain | 0.22 |
PF13181 | TPR_8 | 0.22 |
PF00330 | Aconitase | 0.22 |
PF17147 | PFOR_II | 0.22 |
PF00166 | Cpn10 | 0.22 |
PF01726 | LexA_DNA_bind | 0.22 |
PF13450 | NAD_binding_8 | 0.22 |
PF13511 | DUF4124 | 0.22 |
PF00753 | Lactamase_B | 0.22 |
PF00905 | Transpeptidase | 0.22 |
PF01139 | RtcB | 0.22 |
PF01977 | UbiD | 0.22 |
PF00483 | NTP_transferase | 0.22 |
PF03699 | UPF0182 | 0.22 |
PF01137 | RTC | 0.22 |
PF02018 | CBM_4_9 | 0.22 |
PF00977 | His_biosynth | 0.22 |
PF01464 | SLT | 0.22 |
PF05947 | T6SS_TssF | 0.22 |
PF06835 | LptC | 0.22 |
PF04020 | Phage_holin_4_2 | 0.22 |
PF03061 | 4HBT | 0.22 |
PF02581 | TMP-TENI | 0.22 |
PF00425 | Chorismate_bind | 0.22 |
PF00294 | PfkB | 0.22 |
PF01790 | LGT | 0.22 |
PF00496 | SBP_bac_5 | 0.22 |
PF01321 | Creatinase_N | 0.22 |
PF05635 | 23S_rRNA_IVP | 0.22 |
PF01106 | NifU | 0.22 |
PF15892 | BNR_4 | 0.22 |
PF04358 | DsrC | 0.22 |
PF00092 | VWA | 0.22 |
PF01116 | F_bP_aldolase | 0.22 |
PF00521 | DNA_topoisoIV | 0.22 |
PF16124 | RecQ_Zn_bind | 0.22 |
PF13589 | HATPase_c_3 | 0.22 |
PF09084 | NMT1 | 0.22 |
PF13307 | Helicase_C_2 | 0.22 |
PF13207 | AAA_17 | 0.22 |
PF13177 | DNA_pol3_delta2 | 0.22 |
PF03739 | LptF_LptG | 0.22 |
PF13189 | Cytidylate_kin2 | 0.22 |
PF08340 | DUF1732 | 0.22 |
PF02826 | 2-Hacid_dh_C | 0.22 |
PF06050 | HGD-D | 0.22 |
COG ID | Name | Functional Category | % Frequency in 461 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.30 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.08 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.87 |
COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 0.87 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 0.87 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.87 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.87 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.65 |
COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.65 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.65 |
COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.65 |
COG0138 | AICAR transformylase/IMP cyclohydrolase PurH | Nucleotide transport and metabolism [F] | 0.65 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.65 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.65 |
COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.65 |
COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.65 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG0760 | Peptidyl-prolyl isomerase, parvulin family | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.65 |
COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.65 |
COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.43 |
COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.43 |
COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.43 |
COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.43 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.43 |
COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.43 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.43 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.43 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.43 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.43 |
COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.43 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.43 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.43 |
COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.43 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.43 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 0.43 |
COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.43 |
COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.43 |
COG0458 | Carbamoylphosphate synthase large subunit | Amino acid transport and metabolism [E] | 0.43 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
COG0505 | Carbamoylphosphate synthase small subunit | Amino acid transport and metabolism [E] | 0.43 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.43 |
COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.43 |
COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.43 |
COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.43 |
COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 0.43 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.43 |
COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.43 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.43 |
COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.43 |
COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.22 |
COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.22 |
COG1749 | Flagellar hook protein FlgE | Cell motility [N] | 0.22 |
COG1763 | Molybdopterin-guanine dinucleotide biosynthesis protein | Coenzyme transport and metabolism [H] | 0.22 |
COG1774 | Cell fate regulator YaaT, PSP1 superfamily (controls sporulation, competence, biofilm development) | Signal transduction mechanisms [T] | 0.22 |
COG1775 | Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB | Amino acid transport and metabolism [E] | 0.22 |
COG1784 | TctA family transporter | General function prediction only [R] | 0.22 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.22 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.22 |
COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.22 |
COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.22 |
COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.22 |
COG2031 | Short chain fatty acids transporter | Lipid transport and metabolism [I] | 0.22 |
COG2043 | Uncharacterized conserved protein, DUF169 family | Function unknown [S] | 0.22 |
COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.22 |
COG2049 | 5-oxoprolinase subunit B/Allophanate hydrolase subunit 1 | Amino acid transport and metabolism [E] | 0.22 |
COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.22 |
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.22 |
COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.22 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.22 |
COG2721 | Altronate dehydratase | Carbohydrate transport and metabolism [G] | 0.22 |
COG2848 | Uncharacterized conserved protein, UPF0210 family | Cell cycle control, cell division, chromosome partitioning [D] | 0.22 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.22 |
COG2920 | Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C) | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG2978 | p-Aminobenzoyl-glutamate transporter AbgT | Coenzyme transport and metabolism [H] | 0.22 |
COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 0.22 |
COG3123 | Pyrimidine/purine nucleoside phosphorylase YaiE/PpnP, UPF0345/DUF1255 family | Nucleotide transport and metabolism [F] | 0.22 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.22 |
COG3333 | TctA family transporter | General function prediction only [R] | 0.22 |
COG3519 | Type VI protein secretion system component VasA | Intracellular trafficking, secretion, and vesicular transport [U] | 0.22 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.22 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.22 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.22 |
COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.22 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.22 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.22 |
COG4786 | Flagellar basal body rod protein FlgG | Cell motility [N] | 0.22 |
COG4787 | Flagellar basal body rod protein FlgF | Cell motility [N] | 0.22 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.22 |
COG4887 | Uncharacterized metal-binding protein MJ0455, DUF1847 family | Function unknown [S] | 0.22 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.22 |
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.22 |
COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.22 |
COG0026 | Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) | Nucleotide transport and metabolism [F] | 0.22 |
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.22 |
COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 0.22 |
COG0049 | Ribosomal protein S7 | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.22 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.22 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.22 |
COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.22 |
COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.22 |
COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.22 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.22 |
COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.22 |
COG0275 | 16S rRNA C1402 N4-methylase RsmH | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0314 | Molybdopterin synthase catalytic subunit MoaE | Coenzyme transport and metabolism [H] | 0.22 |
COG0343 | Queuine/archaeosine tRNA-ribosyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.22 |
COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.22 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.22 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.22 |
COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0430 | RNA 3'-terminal phosphate cyclase | RNA processing and modification [A] | 0.22 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.22 |
COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.22 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.22 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.22 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.22 |
COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 0.22 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG0619 | ECF-type transporter transmembrane protein EcfT | Coenzyme transport and metabolism [H] | 0.22 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.22 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 0.22 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.22 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.22 |
COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.22 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.22 |
COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.22 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.22 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.22 |
COG1042 | Acyl-CoA synthetase (NDP forming) | Energy production and conversion [C] | 0.22 |
COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.22 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.22 |
COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.22 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.22 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.22 |
COG1256 | Flagellar hook-associated protein FlgK | Cell motility [N] | 0.22 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.22 |
COG1371 | Archease, activates RNA ligation by RtcB (tRNA splicing) | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.22 |
COG1549 | Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domains | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG1558 | Flagellar basal body rod protein FlgC | Cell motility [N] | 0.22 |
COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG1580 | Flagellar basal body-associated protein FliL | Cell motility [N] | 0.22 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.22 |
COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.22 |
COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.22 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 78.96 % |
Unclassified | root | N/A | 21.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000231|TB_LI09_4DRAFT_10030053 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
3300000231|TB_LI09_4DRAFT_10078769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1269 | Open in IMG/M |
3300000231|TB_LI09_4DRAFT_10081880 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
3300001213|JGIcombinedJ13530_107344742 | Not Available | 584 | Open in IMG/M |
3300001752|JGI2173J19968_10099463 | Not Available | 848 | Open in IMG/M |
3300002053|SMTZ23_10021601 | All Organisms → cellular organisms → Bacteria | 15470 | Open in IMG/M |
3300002961|JGI11641J44799_10092293 | Not Available | 852 | Open in IMG/M |
3300003432|JGI20214J51088_10320143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1055 | Open in IMG/M |
3300003861|Ga0031654_10116444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 751 | Open in IMG/M |
3300003861|Ga0031654_10122974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 730 | Open in IMG/M |
3300003993|Ga0055468_10161458 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300004282|Ga0066599_100920582 | Not Available | 628 | Open in IMG/M |
3300004481|Ga0069718_10117812 | All Organisms → cellular organisms → Bacteria | 7227 | Open in IMG/M |
3300004481|Ga0069718_15992716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4761 | Open in IMG/M |
3300004481|Ga0069718_16175596 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300004481|Ga0069718_16375666 | Not Available | 1053 | Open in IMG/M |
3300005144|Ga0068711_1028439 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus | 1446 | Open in IMG/M |
3300005144|Ga0068711_1047348 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus | 993 | Open in IMG/M |
3300005833|Ga0074472_10292964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
3300005833|Ga0074472_10618164 | Not Available | 617 | Open in IMG/M |
3300005833|Ga0074472_11224627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
3300006224|Ga0079037_100000346 | All Organisms → cellular organisms → Bacteria | 20074 | Open in IMG/M |
3300006224|Ga0079037_100001262 | All Organisms → cellular organisms → Bacteria | 12983 | Open in IMG/M |
3300006224|Ga0079037_100003590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 8942 | Open in IMG/M |
3300006224|Ga0079037_100013256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5499 | Open in IMG/M |
3300006224|Ga0079037_100033712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3821 | Open in IMG/M |
3300006224|Ga0079037_100071893 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
3300006224|Ga0079037_100189598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1836 | Open in IMG/M |
3300006224|Ga0079037_100214835 | Not Available | 1736 | Open in IMG/M |
3300006224|Ga0079037_100611350 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
3300006224|Ga0079037_100677473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1006 | Open in IMG/M |
3300006224|Ga0079037_100709946 | Not Available | 982 | Open in IMG/M |
3300006224|Ga0079037_100960406 | Not Available | 844 | Open in IMG/M |
3300006224|Ga0079037_101239070 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300006224|Ga0079037_101824586 | Not Available | 608 | Open in IMG/M |
3300006930|Ga0079303_10007863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3097 | Open in IMG/M |
3300006930|Ga0079303_10100406 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300006930|Ga0079303_10431640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
3300009009|Ga0105105_10252617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 935 | Open in IMG/M |
3300009009|Ga0105105_10319625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
3300009009|Ga0105105_10482781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 705 | Open in IMG/M |
3300009037|Ga0105093_10067317 | All Organisms → cellular organisms → Bacteria | 1662 | Open in IMG/M |
3300009037|Ga0105093_10224292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 975 | Open in IMG/M |
3300009053|Ga0105095_10225980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1026 | Open in IMG/M |
3300009053|Ga0105095_10243083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus | 987 | Open in IMG/M |
3300009053|Ga0105095_10641288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 592 | Open in IMG/M |
3300009075|Ga0105090_10207256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1213 | Open in IMG/M |
3300009075|Ga0105090_10312105 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300009075|Ga0105090_10321256 | Not Available | 947 | Open in IMG/M |
3300009075|Ga0105090_10604398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10 | 666 | Open in IMG/M |
3300009075|Ga0105090_11000810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 510 | Open in IMG/M |
3300009078|Ga0105106_10008691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7326 | Open in IMG/M |
3300009078|Ga0105106_10016330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 5433 | Open in IMG/M |
3300009078|Ga0105106_10023377 | All Organisms → cellular organisms → Bacteria | 4557 | Open in IMG/M |
3300009078|Ga0105106_10024888 | All Organisms → cellular organisms → Bacteria | 4416 | Open in IMG/M |
3300009078|Ga0105106_10027637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4191 | Open in IMG/M |
3300009078|Ga0105106_10036462 | All Organisms → cellular organisms → Bacteria | 3643 | Open in IMG/M |
3300009078|Ga0105106_10060552 | All Organisms → cellular organisms → Bacteria | 2790 | Open in IMG/M |
3300009078|Ga0105106_10102953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2102 | Open in IMG/M |
3300009078|Ga0105106_10109331 | All Organisms → cellular organisms → Bacteria | 2033 | Open in IMG/M |
3300009078|Ga0105106_10209447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae | 1421 | Open in IMG/M |
3300009078|Ga0105106_10235936 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300009078|Ga0105106_10321554 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300009078|Ga0105106_10336532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1091 | Open in IMG/M |
3300009078|Ga0105106_10773296 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300009078|Ga0105106_10956070 | Not Available | 609 | Open in IMG/M |
3300009078|Ga0105106_10995119 | Not Available | 596 | Open in IMG/M |
3300009081|Ga0105098_10035744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1971 | Open in IMG/M |
3300009081|Ga0105098_10098166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1261 | Open in IMG/M |
3300009081|Ga0105098_10107127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1213 | Open in IMG/M |
3300009081|Ga0105098_10109333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1202 | Open in IMG/M |
3300009081|Ga0105098_10126892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11 | 1126 | Open in IMG/M |
3300009081|Ga0105098_10302898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
3300009085|Ga0105103_10045678 | All Organisms → cellular organisms → Bacteria | 2204 | Open in IMG/M |
3300009085|Ga0105103_10051590 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
3300009085|Ga0105103_10075724 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
3300009085|Ga0105103_10117979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1389 | Open in IMG/M |
3300009085|Ga0105103_10133355 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300009085|Ga0105103_10276561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 911 | Open in IMG/M |
3300009085|Ga0105103_10282763 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300009085|Ga0105103_10677905 | Not Available | 591 | Open in IMG/M |
3300009087|Ga0105107_10046063 | All Organisms → cellular organisms → Bacteria | 3085 | Open in IMG/M |
3300009087|Ga0105107_10078524 | Not Available | 2327 | Open in IMG/M |
3300009087|Ga0105107_10468527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 878 | Open in IMG/M |
3300009087|Ga0105107_10732547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 688 | Open in IMG/M |
3300009091|Ga0102851_10024597 | All Organisms → cellular organisms → Bacteria | 4497 | Open in IMG/M |
3300009091|Ga0102851_10107354 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
3300009091|Ga0102851_10205081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1852 | Open in IMG/M |
3300009091|Ga0102851_10510488 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
3300009091|Ga0102851_11256164 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300009091|Ga0102851_11434052 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300009091|Ga0102851_11666732 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300009091|Ga0102851_11873180 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300009091|Ga0102851_13253516 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300009091|Ga0102851_13274582 | Not Available | 520 | Open in IMG/M |
3300009111|Ga0115026_10003348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5988 | Open in IMG/M |
3300009111|Ga0115026_10124744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 1616 | Open in IMG/M |
3300009111|Ga0115026_10247423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1219 | Open in IMG/M |
3300009111|Ga0115026_10480028 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300009111|Ga0115026_11542434 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300009111|Ga0115026_11838239 | Not Available | 514 | Open in IMG/M |
3300009131|Ga0115027_10249062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1165 | Open in IMG/M |
3300009131|Ga0115027_10551466 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300009131|Ga0115027_11193512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
3300009131|Ga0115027_11377694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 573 | Open in IMG/M |
3300009146|Ga0105091_10194221 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 965 | Open in IMG/M |
3300009146|Ga0105091_10345793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
3300009153|Ga0105094_10059000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23 | 2134 | Open in IMG/M |
3300009153|Ga0105094_10081935 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
3300009153|Ga0105094_10105852 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
3300009153|Ga0105094_10120429 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300009153|Ga0105094_10121220 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
3300009153|Ga0105094_10157935 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300009153|Ga0105094_10308193 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300009153|Ga0105094_10436712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 759 | Open in IMG/M |
3300009153|Ga0105094_10778943 | Not Available | 562 | Open in IMG/M |
3300009165|Ga0105102_10112653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11 | 1289 | Open in IMG/M |
3300009165|Ga0105102_10287283 | Not Available | 848 | Open in IMG/M |
3300009165|Ga0105102_10908893 | Not Available | 508 | Open in IMG/M |
3300009166|Ga0105100_10090207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1796 | Open in IMG/M |
3300009166|Ga0105100_10102955 | Not Available | 1678 | Open in IMG/M |
3300009166|Ga0105100_10126791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1508 | Open in IMG/M |
3300009166|Ga0105100_10237717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont | 1088 | Open in IMG/M |
3300009166|Ga0105100_10394368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
3300009166|Ga0105100_10753457 | Not Available | 602 | Open in IMG/M |
3300009166|Ga0105100_10800090 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300009167|Ga0113563_10055760 | All Organisms → cellular organisms → Bacteria | 3371 | Open in IMG/M |
3300009167|Ga0113563_10233852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1856 | Open in IMG/M |
3300009167|Ga0113563_10360377 | Not Available | 1535 | Open in IMG/M |
3300009167|Ga0113563_11153213 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300009167|Ga0113563_11379492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 827 | Open in IMG/M |
3300009167|Ga0113563_11584305 | Not Available | 774 | Open in IMG/M |
3300009167|Ga0113563_12257467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
3300009167|Ga0113563_13941871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
3300009168|Ga0105104_10432088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca | 735 | Open in IMG/M |
3300009169|Ga0105097_10007371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5623 | Open in IMG/M |
3300009169|Ga0105097_10007497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5575 | Open in IMG/M |
3300009169|Ga0105097_10023134 | All Organisms → cellular organisms → Bacteria | 3294 | Open in IMG/M |
3300009169|Ga0105097_10032295 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
3300009169|Ga0105097_10034289 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
3300009171|Ga0105101_10017580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 3440 | Open in IMG/M |
3300009171|Ga0105101_10253433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 850 | Open in IMG/M |
3300009171|Ga0105101_10484444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
3300009179|Ga0115028_10409908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 955 | Open in IMG/M |
3300009179|Ga0115028_10413208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 952 | Open in IMG/M |
3300009179|Ga0115028_10694456 | Not Available | 776 | Open in IMG/M |
3300009430|Ga0114938_1328361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
3300009771|Ga0116155_10340617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
3300011340|Ga0151652_12680331 | Not Available | 963 | Open in IMG/M |
3300011340|Ga0151652_13769954 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 | 811 | Open in IMG/M |
3300011340|Ga0151652_13787834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
3300012964|Ga0153916_12852838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 545 | Open in IMG/M |
3300014314|Ga0075316_1205556 | Not Available | 521 | Open in IMG/M |
3300017966|Ga0187776_10580028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 778 | Open in IMG/M |
3300018029|Ga0187787_10406726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 538 | Open in IMG/M |
3300018055|Ga0184616_10306529 | Not Available | 601 | Open in IMG/M |
3300018059|Ga0184615_10571625 | Not Available | 595 | Open in IMG/M |
3300018059|Ga0184615_10612565 | Not Available | 566 | Open in IMG/M |
3300018064|Ga0187773_10743462 | Not Available | 617 | Open in IMG/M |
3300018068|Ga0184636_1098445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1000 | Open in IMG/M |
3300018068|Ga0184636_1200300 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300018070|Ga0184631_10073790 | Not Available | 1291 | Open in IMG/M |
3300020074|Ga0194113_10000045 | All Organisms → cellular organisms → Bacteria | 115301 | Open in IMG/M |
3300020074|Ga0194113_10000096 | All Organisms → cellular organisms → Bacteria | 92254 | Open in IMG/M |
3300020074|Ga0194113_10000324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 60891 | Open in IMG/M |
3300020172|Ga0211729_11162592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
3300022208|Ga0224495_10041382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum | 2123 | Open in IMG/M |
(restricted) 3300024054|Ga0233425_10315050 | Not Available | 688 | Open in IMG/M |
3300025174|Ga0209324_10030415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3712 | Open in IMG/M |
3300025174|Ga0209324_10600755 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300025314|Ga0209323_10085822 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
3300025967|Ga0210136_1076872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300027051|Ga0209269_1067596 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300027051|Ga0209269_1073508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300027693|Ga0209704_1256600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 511 | Open in IMG/M |
3300027713|Ga0209286_1298893 | Not Available | 561 | Open in IMG/M |
3300027713|Ga0209286_1336723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11 | 520 | Open in IMG/M |
3300027715|Ga0208665_10194148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 639 | Open in IMG/M |
3300027721|Ga0209492_1004497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4514 | Open in IMG/M |
3300027721|Ga0209492_1012060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2900 | Open in IMG/M |
3300027721|Ga0209492_1028584 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
3300027721|Ga0209492_1032624 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
3300027721|Ga0209492_1046865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1522 | Open in IMG/M |
3300027721|Ga0209492_1052729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1434 | Open in IMG/M |
3300027721|Ga0209492_1062599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1314 | Open in IMG/M |
3300027721|Ga0209492_1065119 | All Organisms → cellular organisms → Bacteria | 1287 | Open in IMG/M |
3300027721|Ga0209492_1133678 | Not Available | 869 | Open in IMG/M |
3300027721|Ga0209492_1146401 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300027721|Ga0209492_1197189 | Not Available | 692 | Open in IMG/M |
3300027721|Ga0209492_1211871 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300027721|Ga0209492_1231841 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300027721|Ga0209492_1293878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
3300027726|Ga0209285_10027401 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
3300027726|Ga0209285_10059850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1135 | Open in IMG/M |
3300027726|Ga0209285_10092733 | Not Available | 917 | Open in IMG/M |
3300027726|Ga0209285_10114165 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300027740|Ga0214474_1013812 | All Organisms → cellular organisms → Bacteria | 3222 | Open in IMG/M |
3300027740|Ga0214474_1182355 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300027811|Ga0256868_10002426 | All Organisms → cellular organisms → Bacteria | 9716 | Open in IMG/M |
3300027818|Ga0209706_10040910 | All Organisms → cellular organisms → Bacteria | 2342 | Open in IMG/M |
3300027818|Ga0209706_10044647 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
3300027818|Ga0209706_10056628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1971 | Open in IMG/M |
3300027818|Ga0209706_10079739 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_8 | 1637 | Open in IMG/M |
3300027818|Ga0209706_10085373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1576 | Open in IMG/M |
3300027818|Ga0209706_10160805 | Not Available | 1101 | Open in IMG/M |
3300027818|Ga0209706_10167599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1075 | Open in IMG/M |
3300027818|Ga0209706_10264787 | Not Available | 821 | Open in IMG/M |
3300027818|Ga0209706_10406016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 633 | Open in IMG/M |
3300027841|Ga0209262_10546891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 563 | Open in IMG/M |
3300027877|Ga0209293_10109257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1264 | Open in IMG/M |
3300027877|Ga0209293_10623634 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300027877|Ga0209293_10757798 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300027887|Ga0208980_10483427 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300027888|Ga0209635_10021322 | All Organisms → cellular organisms → Bacteria | 5202 | Open in IMG/M |
3300027890|Ga0209496_10156098 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
3300027890|Ga0209496_10238474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 884 | Open in IMG/M |
3300027890|Ga0209496_10503656 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300027897|Ga0209254_10016095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6845 | Open in IMG/M |
3300027897|Ga0209254_10046333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3815 | Open in IMG/M |
3300027897|Ga0209254_10047599 | All Organisms → cellular organisms → Bacteria | 3757 | Open in IMG/M |
3300027897|Ga0209254_10069105 | All Organisms → cellular organisms → Bacteria | 3027 | Open in IMG/M |
3300027897|Ga0209254_10074569 | All Organisms → cellular organisms → Bacteria | 2893 | Open in IMG/M |
3300027897|Ga0209254_10076166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2859 | Open in IMG/M |
3300027897|Ga0209254_10077613 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
3300027897|Ga0209254_10093582 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2533 | Open in IMG/M |
3300027897|Ga0209254_10136710 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA364 | 2021 | Open in IMG/M |
3300027897|Ga0209254_10413450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 997 | Open in IMG/M |
3300027897|Ga0209254_10566946 | Not Available | 807 | Open in IMG/M |
3300027897|Ga0209254_10756773 | Not Available | 663 | Open in IMG/M |
3300027899|Ga0209668_10226193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1175 | Open in IMG/M |
3300027899|Ga0209668_10862432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 610 | Open in IMG/M |
3300027900|Ga0209253_10014816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 6646 | Open in IMG/M |
3300027900|Ga0209253_10135135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2005 | Open in IMG/M |
3300027900|Ga0209253_10238058 | Not Available | 1438 | Open in IMG/M |
3300027900|Ga0209253_10238776 | Not Available | 1435 | Open in IMG/M |
3300027900|Ga0209253_10561139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 843 | Open in IMG/M |
3300027901|Ga0209427_10022990 | All Organisms → cellular organisms → Bacteria | 6460 | Open in IMG/M |
3300027901|Ga0209427_10078076 | All Organisms → cellular organisms → Bacteria | 3026 | Open in IMG/M |
3300027901|Ga0209427_10477482 | Not Available | 945 | Open in IMG/M |
3300027902|Ga0209048_10004117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 13961 | Open in IMG/M |
3300027902|Ga0209048_10011446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7945 | Open in IMG/M |
3300027902|Ga0209048_10012606 | All Organisms → cellular organisms → Bacteria | 7534 | Open in IMG/M |
3300027902|Ga0209048_10015722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6661 | Open in IMG/M |
3300027902|Ga0209048_10022944 | All Organisms → cellular organisms → Bacteria | 5387 | Open in IMG/M |
3300027902|Ga0209048_10022963 | All Organisms → cellular organisms → Bacteria | 5384 | Open in IMG/M |
3300027902|Ga0209048_10042590 | All Organisms → cellular organisms → Bacteria | 3759 | Open in IMG/M |
3300027902|Ga0209048_10048245 | All Organisms → cellular organisms → Bacteria | 3492 | Open in IMG/M |
3300027902|Ga0209048_10052838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3302 | Open in IMG/M |
3300027902|Ga0209048_10055272 | All Organisms → cellular organisms → Bacteria | 3216 | Open in IMG/M |
3300027902|Ga0209048_10060762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3037 | Open in IMG/M |
3300027902|Ga0209048_10062271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2992 | Open in IMG/M |
3300027902|Ga0209048_10077804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2607 | Open in IMG/M |
3300027902|Ga0209048_10081249 | All Organisms → cellular organisms → Bacteria | 2539 | Open in IMG/M |
3300027902|Ga0209048_10263145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1223 | Open in IMG/M |
3300027902|Ga0209048_10284601 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300027902|Ga0209048_10347630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium | 1028 | Open in IMG/M |
3300027902|Ga0209048_10361860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1003 | Open in IMG/M |
3300027902|Ga0209048_10400737 | Not Available | 942 | Open in IMG/M |
3300027902|Ga0209048_10450553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 876 | Open in IMG/M |
3300027902|Ga0209048_10538360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 785 | Open in IMG/M |
3300027902|Ga0209048_10648270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria) | 700 | Open in IMG/M |
3300027902|Ga0209048_10789754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
3300027902|Ga0209048_10792601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 619 | Open in IMG/M |
3300027902|Ga0209048_10839413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 597 | Open in IMG/M |
3300027902|Ga0209048_10938196 | Not Available | 556 | Open in IMG/M |
3300027956|Ga0209820_1078679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 886 | Open in IMG/M |
3300027979|Ga0209705_10042116 | All Organisms → cellular organisms → Bacteria | 2529 | Open in IMG/M |
3300027979|Ga0209705_10064460 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
3300027979|Ga0209705_10124188 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300027979|Ga0209705_10207015 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
3300030613|Ga0299915_10538988 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300031746|Ga0315293_10457994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 993 | Open in IMG/M |
3300031746|Ga0315293_10978319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 605 | Open in IMG/M |
3300031746|Ga0315293_11253636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 512 | Open in IMG/M |
3300031772|Ga0315288_10699815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 956 | Open in IMG/M |
3300031834|Ga0315290_10034403 | All Organisms → cellular organisms → Bacteria | 4036 | Open in IMG/M |
3300031834|Ga0315290_10166002 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
3300031834|Ga0315290_10176828 | Not Available | 1847 | Open in IMG/M |
3300031834|Ga0315290_10630959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 928 | Open in IMG/M |
3300031834|Ga0315290_10718828 | Not Available | 860 | Open in IMG/M |
3300031873|Ga0315297_10097996 | Not Available | 2319 | Open in IMG/M |
3300031873|Ga0315297_10173724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1763 | Open in IMG/M |
3300031873|Ga0315297_10184725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1710 | Open in IMG/M |
3300031873|Ga0315297_10282527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11 | 1381 | Open in IMG/M |
3300031873|Ga0315297_10617503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 910 | Open in IMG/M |
3300031873|Ga0315297_10659022 | Not Available | 877 | Open in IMG/M |
3300031949|Ga0214473_10037359 | All Organisms → cellular organisms → Bacteria | 5703 | Open in IMG/M |
3300031949|Ga0214473_10227628 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
3300031949|Ga0214473_10303828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1822 | Open in IMG/M |
3300031949|Ga0214473_10896222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300031949|Ga0214473_10962265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 905 | Open in IMG/M |
3300031952|Ga0315294_11040807 | Not Available | 679 | Open in IMG/M |
3300031952|Ga0315294_11317610 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
3300031997|Ga0315278_10049215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4124 | Open in IMG/M |
3300031997|Ga0315278_10183561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2148 | Open in IMG/M |
3300031997|Ga0315278_10266088 | All Organisms → cellular organisms → Bacteria | 1770 | Open in IMG/M |
3300031997|Ga0315278_10631097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1094 | Open in IMG/M |
3300031999|Ga0315274_10325179 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
3300031999|Ga0315274_10754406 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1041 | Open in IMG/M |
3300031999|Ga0315274_10789782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1009 | Open in IMG/M |
3300032020|Ga0315296_10175557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1300 | Open in IMG/M |
3300032020|Ga0315296_10432985 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300032046|Ga0315289_10529340 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300032053|Ga0315284_10261477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2200 | Open in IMG/M |
3300032053|Ga0315284_10379079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1752 | Open in IMG/M |
3300032053|Ga0315284_10481707 | Not Available | 1510 | Open in IMG/M |
3300032053|Ga0315284_10652830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1245 | Open in IMG/M |
3300032053|Ga0315284_11273690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 800 | Open in IMG/M |
3300032053|Ga0315284_11585194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
3300032070|Ga0315279_10052987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3825 | Open in IMG/M |
3300032070|Ga0315279_10855953 | Not Available | 526 | Open in IMG/M |
3300032143|Ga0315292_10073351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 2608 | Open in IMG/M |
3300032143|Ga0315292_10124913 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
3300032143|Ga0315292_11454398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23 | 556 | Open in IMG/M |
3300032156|Ga0315295_10082631 | All Organisms → cellular organisms → Bacteria | 3096 | Open in IMG/M |
3300032156|Ga0315295_10535507 | Not Available | 1190 | Open in IMG/M |
3300032156|Ga0315295_10584585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1132 | Open in IMG/M |
3300032156|Ga0315295_10869555 | Not Available | 901 | Open in IMG/M |
3300032156|Ga0315295_11221423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 736 | Open in IMG/M |
3300032164|Ga0315283_12033611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
3300032177|Ga0315276_10168951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2281 | Open in IMG/M |
3300032177|Ga0315276_10392962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1484 | Open in IMG/M |
3300032177|Ga0315276_11273823 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300032177|Ga0315276_12110796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
3300032177|Ga0315276_12185888 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300032342|Ga0315286_10065385 | All Organisms → cellular organisms → Bacteria | 3863 | Open in IMG/M |
3300032342|Ga0315286_11482985 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300032397|Ga0315287_10306456 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
3300032397|Ga0315287_11040051 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300032397|Ga0315287_12261066 | Not Available | 591 | Open in IMG/M |
3300032397|Ga0315287_12509344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 553 | Open in IMG/M |
3300032401|Ga0315275_10148735 | All Organisms → cellular organisms → Bacteria | 2597 | Open in IMG/M |
3300032401|Ga0315275_10209995 | Not Available | 2171 | Open in IMG/M |
3300032401|Ga0315275_10633050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1193 | Open in IMG/M |
3300032401|Ga0315275_10784433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1057 | Open in IMG/M |
3300032401|Ga0315275_11162423 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300032401|Ga0315275_11576634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 703 | Open in IMG/M |
3300032401|Ga0315275_12020344 | Not Available | 607 | Open in IMG/M |
3300032401|Ga0315275_12678473 | Not Available | 513 | Open in IMG/M |
3300032516|Ga0315273_10226246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2552 | Open in IMG/M |
3300032516|Ga0315273_10313731 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
3300032516|Ga0315273_10325352 | All Organisms → cellular organisms → Bacteria | 2084 | Open in IMG/M |
3300032516|Ga0315273_10334773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2051 | Open in IMG/M |
3300032516|Ga0315273_10381167 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus | 1903 | Open in IMG/M |
3300032516|Ga0315273_10571126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1504 | Open in IMG/M |
3300032516|Ga0315273_10649221 | All Organisms → cellular organisms → Bacteria | 1394 | Open in IMG/M |
3300032516|Ga0315273_11358464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 883 | Open in IMG/M |
3300032516|Ga0315273_11367956 | Not Available | 879 | Open in IMG/M |
3300032516|Ga0315273_12291263 | Not Available | 630 | Open in IMG/M |
3300032516|Ga0315273_13045025 | Not Available | 523 | Open in IMG/M |
3300033406|Ga0316604_10019623 | All Organisms → cellular organisms → Bacteria | 3545 | Open in IMG/M |
3300033406|Ga0316604_10043616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 2304 | Open in IMG/M |
3300033406|Ga0316604_10676337 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
3300033408|Ga0316605_10037073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3324 | Open in IMG/M |
3300033408|Ga0316605_10059347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2757 | Open in IMG/M |
3300033408|Ga0316605_10247818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 1532 | Open in IMG/M |
3300033408|Ga0316605_10375092 | Not Available | 1276 | Open in IMG/M |
3300033408|Ga0316605_10514915 | Not Available | 1104 | Open in IMG/M |
3300033408|Ga0316605_10575631 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300033408|Ga0316605_10643182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 995 | Open in IMG/M |
3300033408|Ga0316605_10959125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 820 | Open in IMG/M |
3300033408|Ga0316605_11351074 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300033408|Ga0316605_12077487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 553 | Open in IMG/M |
3300033413|Ga0316603_10094725 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
3300033413|Ga0316603_10382722 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300033413|Ga0316603_10412005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1224 | Open in IMG/M |
3300033413|Ga0316603_10759167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 909 | Open in IMG/M |
3300033413|Ga0316603_11236323 | Not Available | 707 | Open in IMG/M |
3300033413|Ga0316603_11736088 | Not Available | 591 | Open in IMG/M |
3300033413|Ga0316603_11932136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
3300033413|Ga0316603_12195587 | Not Available | 521 | Open in IMG/M |
3300033414|Ga0316619_10138054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1650 | Open in IMG/M |
3300033414|Ga0316619_10467855 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
3300033414|Ga0316619_10569286 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300033414|Ga0316619_11094352 | Not Available | 699 | Open in IMG/M |
3300033414|Ga0316619_11106014 | Not Available | 695 | Open in IMG/M |
3300033414|Ga0316619_11933719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
3300033416|Ga0316622_100249431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1925 | Open in IMG/M |
3300033418|Ga0316625_100132596 | Not Available | 1495 | Open in IMG/M |
3300033418|Ga0316625_101047509 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300033418|Ga0316625_101067067 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300033419|Ga0316601_100005257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 7254 | Open in IMG/M |
3300033419|Ga0316601_100440265 | Not Available | 1236 | Open in IMG/M |
3300033419|Ga0316601_101140706 | Not Available | 781 | Open in IMG/M |
3300033419|Ga0316601_101825493 | Not Available | 613 | Open in IMG/M |
3300033419|Ga0316601_102601353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 508 | Open in IMG/M |
3300033433|Ga0326726_10093852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans | 2676 | Open in IMG/M |
3300033433|Ga0326726_10352773 | Not Available | 1389 | Open in IMG/M |
3300033433|Ga0326726_10426162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae | 1261 | Open in IMG/M |
3300033433|Ga0326726_11107254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 770 | Open in IMG/M |
3300033433|Ga0326726_11859590 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300033434|Ga0316613_10301014 | Not Available | 1061 | Open in IMG/M |
3300033480|Ga0316620_10210797 | Not Available | 1629 | Open in IMG/M |
3300033480|Ga0316620_10500189 | Not Available | 1123 | Open in IMG/M |
3300033480|Ga0316620_10648815 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
3300033480|Ga0316620_11407919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 687 | Open in IMG/M |
3300033480|Ga0316620_11972074 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300033480|Ga0316620_12328589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
3300033481|Ga0316600_10068031 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
3300033481|Ga0316600_10146490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1495 | Open in IMG/M |
3300033481|Ga0316600_10226368 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300033481|Ga0316600_10528372 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
3300033481|Ga0316600_10985242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 597 | Open in IMG/M |
3300033481|Ga0316600_11037664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 581 | Open in IMG/M |
3300033481|Ga0316600_11201016 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 538 | Open in IMG/M |
3300033482|Ga0316627_100393533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1186 | Open in IMG/M |
3300033482|Ga0316627_100419319 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300033482|Ga0316627_100489197 | Not Available | 1088 | Open in IMG/M |
3300033482|Ga0316627_101065664 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300033482|Ga0316627_101504501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 681 | Open in IMG/M |
3300033482|Ga0316627_101614932 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300033482|Ga0316627_102259162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 570 | Open in IMG/M |
3300033482|Ga0316627_102906760 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300033483|Ga0316629_10202269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1262 | Open in IMG/M |
3300033485|Ga0316626_10056543 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
3300033485|Ga0316626_10469464 | Not Available | 1065 | Open in IMG/M |
3300033485|Ga0316626_10499252 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
3300033485|Ga0316626_10564115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 977 | Open in IMG/M |
3300033485|Ga0316626_10809934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 822 | Open in IMG/M |
3300033485|Ga0316626_10957750 | Not Available | 757 | Open in IMG/M |
3300033485|Ga0316626_10987317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 746 | Open in IMG/M |
3300033485|Ga0316626_10996330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 743 | Open in IMG/M |
3300033486|Ga0316624_10307063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini | 1288 | Open in IMG/M |
3300033486|Ga0316624_11290454 | Not Available | 666 | Open in IMG/M |
3300033486|Ga0316624_11920878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61 | 549 | Open in IMG/M |
3300033487|Ga0316630_10016167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3928 | Open in IMG/M |
3300033487|Ga0316630_10574942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 936 | Open in IMG/M |
3300033487|Ga0316630_10583877 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300033488|Ga0316621_10166931 | Not Available | 1337 | Open in IMG/M |
3300033488|Ga0316621_10336825 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300033488|Ga0316621_11262758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 560 | Open in IMG/M |
3300033489|Ga0299912_10267858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1444 | Open in IMG/M |
3300033489|Ga0299912_10388272 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300033489|Ga0299912_10456704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1036 | Open in IMG/M |
3300033513|Ga0316628_101325745 | Not Available | 959 | Open in IMG/M |
3300033513|Ga0316628_101458211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 912 | Open in IMG/M |
3300033513|Ga0316628_103443486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 572 | Open in IMG/M |
3300033521|Ga0316616_100258807 | All Organisms → cellular organisms → Bacteria | 1801 | Open in IMG/M |
3300033521|Ga0316616_100393168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1532 | Open in IMG/M |
3300033521|Ga0316616_100650972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1250 | Open in IMG/M |
3300033521|Ga0316616_101279020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 938 | Open in IMG/M |
3300033521|Ga0316616_102066671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 756 | Open in IMG/M |
3300033521|Ga0316616_102940298 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300033521|Ga0316616_103322313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 606 | Open in IMG/M |
3300033521|Ga0316616_103755970 | Not Available | 572 | Open in IMG/M |
3300033557|Ga0316617_100004217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5608 | Open in IMG/M |
3300033557|Ga0316617_100665555 | Not Available | 977 | Open in IMG/M |
3300033557|Ga0316617_101436868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28 | 694 | Open in IMG/M |
3300033557|Ga0316617_102119325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 579 | Open in IMG/M |
3300033557|Ga0316617_102489243 | Not Available | 537 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 24.73% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 20.82% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 16.27% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 10.41% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 7.16% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.17% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.30% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 1.08% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.08% |
Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 1.08% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.87% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.87% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.87% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.65% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 0.65% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.65% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.65% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.65% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.65% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.43% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.22% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.22% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.22% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.22% |
Marine Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment | 0.22% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.22% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.22% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.22% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000231 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001752 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
3300002053 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ | Environmental | Open in IMG/M |
3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005144 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG | Engineered | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300022208 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
3300025967 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300027051 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
3300027811 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeq | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB_LI09_4DRAFT_100300532 | 3300000231 | Groundwater | MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETITLVL* |
TB_LI09_4DRAFT_100787692 | 3300000231 | Groundwater | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETINIQTR* |
TB_LI09_4DRAFT_100818802 | 3300000231 | Groundwater | MQGAQKLRSEAHLGVRRNDEVEAQRRRWIFYETIKFC* |
JGIcombinedJ13530_1073447421 | 3300001213 | Wetland | MQGAQKLRSKAQLQARRTDEVAAQRHRLTFYEAIIFCPFPFPIYSRYR |
JGI2173J19968_100994631 | 3300001752 | Marine Sediment | MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAINNGF* |
SMTZ23_100216016 | 3300002053 | Marine Sediment | MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAIFIDYLF* |
JGI11641J44799_100922932 | 3300002961 | Wetland | QSPQKPGSEEHFGVRRSDEVVTQSFSERDRWTFYETIKFLKGLWE* |
JGI20214J51088_103201431 | 3300003432 | Wetland | MQGAQKLRSEAHLQVRRNDEVAAQRSRWTFHEAINIKKTKRKPK* |
Ga0031654_101164441 | 3300003861 | Freshwater Lake Sediment | MQGAQKLRREAYLQLRCNDEVAAQRRRWTFYESINLWVSKP |
Ga0031654_101229742 | 3300003861 | Freshwater Lake Sediment | MQGAQKLRSEAYLYVRCNDEVEAQRRRWNFYEAIKKNEIN* |
Ga0055468_101614581 | 3300003993 | Natural And Restored Wetlands | LQMPGAQKLRSEAHLRVRRSDEVEAQRRRWTFYETIKVRK* |
Ga0066599_1009205822 | 3300004282 | Freshwater | MPGAQKLRSEAYYQVRRNDEVAAQRRRWTFYETIKGKGGES* |
Ga0069718_101178126 | 3300004481 | Sediment | MQGAQKLRSEAHFQVRRNDEVEAQRRRWAFYVTIKKGGWQ* |
Ga0069718_159927166 | 3300004481 | Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKLGVALQFFRS* |
Ga0069718_161755961 | 3300004481 | Sediment | MQGAQKLRSEAYYQVRCNDEVEAQRRRWIFYETINFEEEI* |
Ga0069718_163756662 | 3300004481 | Sediment | MPGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIIIPRRPLPG |
Ga0068711_10284392 | 3300005144 | Enrichment Culture | MQGAQKLRSAAYLQVRCNDEGAAQRRRWTFYETINKEET* |
Ga0068711_10400232 | 3300005144 | Enrichment Culture | MQGAQKLRSKAHVQVRRNDEVAAQRRRWTFYETLNIRNNILLQEERRGGL* |
Ga0068711_10473481 | 3300005144 | Enrichment Culture | MQGPQNLRSEACKPLPGNDEDEAQRRRWTFCETIKYPDWSR |
Ga0074472_102929642 | 3300005833 | Sediment (Intertidal) | MQGAQKLRSEAHLQVRRNDDVEAQRRRWTFYEIIKFPQPHS |
Ga0074472_106181642 | 3300005833 | Sediment (Intertidal) | MQGAKKLRDEAHLWVRGNDEGEAQSRSARDRWTFYETVKFGI* |
Ga0074472_112246271 | 3300005833 | Sediment (Intertidal) | MQGAQKLRSEAHLQVRRSDEVEAQRRRWIFYETIKFAYK* |
Ga0079037_10000034610 | 3300006224 | Freshwater Wetlands | MQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK* |
Ga0079037_1000012623 | 3300006224 | Freshwater Wetlands | MPGAQKLRSEAHLRVRRNDEVAAQSRSERNRWTFYETINN* |
Ga0079037_1000035902 | 3300006224 | Freshwater Wetlands | MPGAQKLWSEAHLQVRRNDEVAAQSRSERDRWTFYETIKI* |
Ga0079037_1000132567 | 3300006224 | Freshwater Wetlands | QMQGAQKLRSEAHLQVRRSDEVAAQSRSERDRWTFCETIIL* |
Ga0079037_1000337121 | 3300006224 | Freshwater Wetlands | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKLDSF |
Ga0079037_1000718934 | 3300006224 | Freshwater Wetlands | MQGAQKLRSDAHSQLRRNDEVAVQSRSERDRWTFYETIKTG* |
Ga0079037_1001895985 | 3300006224 | Freshwater Wetlands | QGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVIIIINF* |
Ga0079037_1002148351 | 3300006224 | Freshwater Wetlands | MQGAQKLRSEAHLQVRRSDEVAAQSRSERDRWTFC |
Ga0079037_1006113502 | 3300006224 | Freshwater Wetlands | MQGAQKLRSEAHFQVRRNEEVAAQRRRWTFYETII |
Ga0079037_1006774731 | 3300006224 | Freshwater Wetlands | MVSEKAQLQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETI |
Ga0079037_1007099461 | 3300006224 | Freshwater Wetlands | AQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMPG* |
Ga0079037_1009604061 | 3300006224 | Freshwater Wetlands | MQGAQNLRSEAYLLVRCNDEGEAQRRRWTFYEVIK |
Ga0079037_1012390701 | 3300006224 | Freshwater Wetlands | KKLQMQGVQKPRSAAQLQVHRKDEVEAKRRRRTFYETIIIKGASA* |
Ga0079037_1018245861 | 3300006224 | Freshwater Wetlands | EAHLRVRRSDEVAAQSRSERDRWTFYETINFFLP* |
Ga0079303_100078631 | 3300006930 | Deep Subsurface | MQGTQKLRSEAHLCVRRNDEVEAQRSRWTFYETIK |
Ga0079303_101004061 | 3300006930 | Deep Subsurface | QGVQKLRSEAHISRASRDNDEVEAQSRSARDRRDFCETINGYLTP* |
Ga0079303_104316402 | 3300006930 | Deep Subsurface | MQGAQKLRSEAHLLVRRNDEVEAQRSRWTFYETIK |
Ga0105105_102526172 | 3300009009 | Freshwater Sediment | MQGAQKLRSETHLRVRRNDEVETHRRRWTFYETIKL* |
Ga0105105_103196251 | 3300009009 | Freshwater Sediment | LQMQGAQELRSEAHLQVRRNDEVAAQRRSWTFYKAINTDT* |
Ga0105105_104827812 | 3300009009 | Freshwater Sediment | MQGAQKLRSAAHELVRRNDEVAAQPSRWTFYETIKAGRE* |
Ga0105093_100673172 | 3300009037 | Freshwater Sediment | MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINPC* |
Ga0105093_102242922 | 3300009037 | Freshwater Sediment | MQGAQKLRREAHLQVRRNDEVAAQRRRWTFYETINFNRGYPL* |
Ga0105095_102259803 | 3300009053 | Freshwater Sediment | MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIK* |
Ga0105095_102430831 | 3300009053 | Freshwater Sediment | RSEAHLQVRRNDEVEAQRSRWTFYEIIKPTGTGF* |
Ga0105095_106412882 | 3300009053 | Freshwater Sediment | LQMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKIRRERKHNG* |
Ga0105090_102072561 | 3300009075 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRRSWTFYKAINTGT* |
Ga0105090_103121053 | 3300009075 | Freshwater Sediment | MQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIKFAEY* |
Ga0105090_103212563 | 3300009075 | Freshwater Sediment | AQKLRSEAYIKVRCNDEVEAQRRRWTFYETIKDSRDYISVL* |
Ga0105090_106043981 | 3300009075 | Freshwater Sediment | MQGAQKLRSEAHLRVRRKDEVEAQRCRWTFYETITS |
Ga0105090_110008101 | 3300009075 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEGAAQRRRWTFYEAIK* |
Ga0105106_100086917 | 3300009078 | Freshwater Sediment | MQGAQKLRIEAHLQVRRSDEVEAQRRRWTFYETINPC* |
Ga0105106_100163301 | 3300009078 | Freshwater Sediment | AQKLRSEAHLRVRRNDEVEAQRHRWTFYETIKFPAEKRGPLDFA* |
Ga0105106_100233773 | 3300009078 | Freshwater Sediment | MLQMQGAQKLRSAAHELVRRNDEVAAQRSRWTFYETIEAGRE* |
Ga0105106_100248881 | 3300009078 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKYRK* |
Ga0105106_100276371 | 3300009078 | Freshwater Sediment | AQKLRSEAYLQVRCNDEVEAQRRRWIFYETLKLGG* |
Ga0105106_100364624 | 3300009078 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINI* |
Ga0105106_100605528 | 3300009078 | Freshwater Sediment | KKLQMQGAQKLRREAHLRVRRSDEVEAQPSRWTFYETIILDSALEMGI* |
Ga0105106_101029532 | 3300009078 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKIRRERKHNG* |
Ga0105106_101093311 | 3300009078 | Freshwater Sediment | RKKLQMQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIKFAEY* |
Ga0105106_102094471 | 3300009078 | Freshwater Sediment | MPGAQKLRSEAYYQVRRNDEVAAQRRRWTFYETIK |
Ga0105106_102359361 | 3300009078 | Freshwater Sediment | QMQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYETIKKGGWQ* |
Ga0105106_103215541 | 3300009078 | Freshwater Sediment | MQGAQELRSEAHLQVRRNDEVAAQRRSWTFYKAINTDT* |
Ga0105106_103365323 | 3300009078 | Freshwater Sediment | MQGAQKLRSEPHLQVHRNDEVAAQRRRWTFYETIIF |
Ga0105106_107732961 | 3300009078 | Freshwater Sediment | MPGAQKLRSEARFPVRRNDEVEAQRRRWTFYEPIKKGGAMS |
Ga0105106_109560702 | 3300009078 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETIKYHRA* |
Ga0105106_109951191 | 3300009078 | Freshwater Sediment | KLRSEAHLQVRRNDEVEAQRSRWTFYETISILLP* |
Ga0105098_100357442 | 3300009081 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS* |
Ga0105098_100981663 | 3300009081 | Freshwater Sediment | MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETITFRIRAPALR |
Ga0105098_101071272 | 3300009081 | Freshwater Sediment | AQKLRSEAHLQVRRNDEVAAQRRRWTFYETINIRHFENS* |
Ga0105098_101093332 | 3300009081 | Freshwater Sediment | MQGAQKLRSETHLRVRRNDEVETQRRRWTFYETIKL* |
Ga0105098_101268923 | 3300009081 | Freshwater Sediment | QKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQTGP* |
Ga0105098_103028982 | 3300009081 | Freshwater Sediment | MQGAQKLRREAHFWVRRNAEVAAQRRRWTFYETITL* |
Ga0105103_100456782 | 3300009085 | Freshwater Sediment | MQGAQKLRSEAHLRVRRSDEVEAQPSRWTFYETIILDSALEMGI* |
Ga0105103_100515901 | 3300009085 | Freshwater Sediment | MQGAQKLRSEAHLRVRCNDEVEAQRSRWIFYETINHSRVI |
Ga0105103_100644682 | 3300009085 | Freshwater Sediment | MQGAQKLRSEAHFQVRRNDEFAAQRRRWTFYETINSKISGEDDGDG |
Ga0105103_100757241 | 3300009085 | Freshwater Sediment | MQRAQKLRSEAHLQVRSNDEVGTQRRRWTFLETIKEENVFMG |
Ga0105103_101179792 | 3300009085 | Freshwater Sediment | MQGAQKLRREAHLQVRRNDEVEAQRHRWTFYEAIKE* |
Ga0105103_101333551 | 3300009085 | Freshwater Sediment | MQGAQKLRSEAHFGVRRNDEVEAQRRRWTFYETII |
Ga0105103_102765612 | 3300009085 | Freshwater Sediment | MQGAQKLRSEAHLRVRRNDKVEAQRSRWTFYEVINVESLQK* |
Ga0105103_102827632 | 3300009085 | Freshwater Sediment | MPGAQKLRREAPLQVRRNGEVEAQRRSWAFYETIK* |
Ga0105103_106779052 | 3300009085 | Freshwater Sediment | MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYKTIF |
Ga0105107_100460633 | 3300009087 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITEERKK* |
Ga0105107_100785241 | 3300009087 | Freshwater Sediment | GAQKLRSEAYEQVRCNDEVEAQRRRWTFYEAITLAPFFAR* |
Ga0105107_104685271 | 3300009087 | Freshwater Sediment | MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVINIASASKP |
Ga0105107_107325471 | 3300009087 | Freshwater Sediment | GAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINI* |
Ga0102851_100245975 | 3300009091 | Freshwater Wetlands | AQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT* |
Ga0102851_101073541 | 3300009091 | Freshwater Wetlands | MPGAQKLRSEAHLRVRRNDEVAAQSRSGRNRWTFYETINN* |
Ga0102851_102050812 | 3300009091 | Freshwater Wetlands | MQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYEIITS* |
Ga0102851_105104882 | 3300009091 | Freshwater Wetlands | MQVAQKRKSAAHLQVRRNDEVEAQGRRWTSYETIKIDQFGR* |
Ga0102851_112561642 | 3300009091 | Freshwater Wetlands | MQGAQKLRSEAHLRVRHNDEVEAQRRRWTFYEIINFDSEFPETER |
Ga0102851_114340522 | 3300009091 | Freshwater Wetlands | MQGAQKLRSEAQFQVRRNDEVAAQRSRWTFYETINIEKTMKDHYKTL |
Ga0102851_116667321 | 3300009091 | Freshwater Wetlands | KKLQMQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYETIKI* |
Ga0102851_118731802 | 3300009091 | Freshwater Wetlands | KKLQMQGAQKLRSEAHLRVRRSDEVEAQRCRWTFYEVIKIISP* |
Ga0102851_132535162 | 3300009091 | Freshwater Wetlands | MPGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETI |
Ga0102851_132745821 | 3300009091 | Freshwater Wetlands | MQGAQKRRSEAHLSVRRNDEVAAQSRSERDRWTFYE |
Ga0115026_100033482 | 3300009111 | Wetland | MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT* |
Ga0115026_101247443 | 3300009111 | Wetland | MQGAQKLRSEAHDRVRRNDEVTAQSRSERDRWTFYK |
Ga0115026_102474232 | 3300009111 | Wetland | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEVIK* |
Ga0115026_104800282 | 3300009111 | Wetland | KKLQMQGAQKLRSEVHLEVRRRWTFYETINKCRKN* |
Ga0115026_115424341 | 3300009111 | Wetland | MQGAQKLRSEAHVQVRRNDEVEAQRSSWTFYEAIKVA* |
Ga0115026_118382391 | 3300009111 | Wetland | KLQMQGAQKLRSEAHLRVRRNDEVAAQSRSERNRWTFYETINN* |
Ga0115027_102490621 | 3300009131 | Wetland | MQGAQKLRSEAHIWVRRNDEVAAQSRSERDRWTFYETIKGDGILKGDAR* |
Ga0115027_105514661 | 3300009131 | Wetland | MQDAQKLRSEAHLRVRHNDEVEAQRRRWTFYEIINFDSEFPETERGGREN |
Ga0115027_111935121 | 3300009131 | Wetland | MQGAQKLRSEAHLPVRRNDEVAAQSRSERDRWTFYETII |
Ga0115027_113776942 | 3300009131 | Wetland | QGGQKLRSEAPLRVRRSDEVEAQRSRWTFYETIKKGGWQWLS* |
Ga0105091_101942211 | 3300009146 | Freshwater Sediment | MPGAQKLRSAARLRVRRNEEVEARRRRWSFYEVIYYFPIII |
Ga0105091_103457932 | 3300009146 | Freshwater Sediment | MQGARKPRSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS* |
Ga0105094_100590003 | 3300009153 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITEERKR* |
Ga0105094_100819353 | 3300009153 | Freshwater Sediment | MQGAQKLRSEAYLRVRRNDEVEAQRRRWTFYETIKL* |
Ga0105094_101058523 | 3300009153 | Freshwater Sediment | QKLRSEAHLQVRRNDEVEAQRRRWTFYETIKYRK* |
Ga0105094_101204291 | 3300009153 | Freshwater Sediment | GAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINASVL* |
Ga0105094_101212204 | 3300009153 | Freshwater Sediment | QGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKNR* |
Ga0105094_101579352 | 3300009153 | Freshwater Sediment | LQMQGAQKLRSEAHLHVRRNDKVEAQRRRWTFYETITY* |
Ga0105094_103081931 | 3300009153 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRRSWTFYKAINTDT* |
Ga0105094_104367121 | 3300009153 | Freshwater Sediment | MLQMQGAQELRSEAHLQVRRNDEVAAQRSRWTFYEAIIDRDLKDA |
Ga0105094_107789431 | 3300009153 | Freshwater Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIK |
Ga0105102_101126531 | 3300009165 | Freshwater Sediment | GAQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQTGP* |
Ga0105102_102872831 | 3300009165 | Freshwater Sediment | MPGAQKLRSAPHLKVRRNDEVAAQRRRWTFYVTIKGG |
Ga0105102_109088932 | 3300009165 | Freshwater Sediment | MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETIFIV |
Ga0105100_100902071 | 3300009166 | Freshwater Sediment | MPGAQKLRRDAHNQVRRNDAVAAQRRRWTFYETISCWPALKPLMNF |
Ga0105100_101029552 | 3300009166 | Freshwater Sediment | MQGAQNLRREAHLRVRRNDEVEAQRRRWTFYETIIIGT |
Ga0105100_101267911 | 3300009166 | Freshwater Sediment | LQMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYEAIKLFYRPF* |
Ga0105100_102377173 | 3300009166 | Freshwater Sediment | MQGTQKLRSAAHLQVRRNDKVAAQRTKWTFYDTIKILP |
Ga0105100_103943681 | 3300009166 | Freshwater Sediment | MQGAKKLRSEAYRWVRCNDEVEAQRRRWIFCETIILSI |
Ga0105100_106015491 | 3300009166 | Freshwater Sediment | FLFYGFVKSSRCEAHLRVRRNDEVEAQRRRWTFYETILF* |
Ga0105100_107534572 | 3300009166 | Freshwater Sediment | CKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRSWTFYETIK* |
Ga0105100_108000901 | 3300009166 | Freshwater Sediment | MQGAQKLRSEAHLRVCRNDKVEAQRSRWTFYEVINVESLQK* |
Ga0113563_100557604 | 3300009167 | Freshwater Wetlands | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFCETINFTPKR |
Ga0113563_102338523 | 3300009167 | Freshwater Wetlands | MQGAQKLRSEAHIWVRRNDEVEAQSRSERDRWTFYETIKGDGILKGDAR* |
Ga0113563_103603771 | 3300009167 | Freshwater Wetlands | MQGAQKLRSAAHAYVRRNDEGEAQSRSERDRWAFYE |
Ga0113563_111532132 | 3300009167 | Freshwater Wetlands | MQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETIKN* |
Ga0113563_112589082 | 3300009167 | Freshwater Wetlands | QMQGSQKLKGEAHFQVRRNDEVATQSRSEQDRWTFYEAIKNCCSK* |
Ga0113563_113794921 | 3300009167 | Freshwater Wetlands | MQGAQKLRSAAHYKVRCNDEVEVQRSSWAFYETINPDQGQQ* |
Ga0113563_115843052 | 3300009167 | Freshwater Wetlands | MQGAQKLRSEAHNQVRRNDEVEAQRRRWTFYEPIIF |
Ga0113563_122574672 | 3300009167 | Freshwater Wetlands | KKLQMQGAQKLRGEAHLQVRRNDEVEAQRRRGTF* |
Ga0113563_139418711 | 3300009167 | Freshwater Wetlands | MQGARKLRSEAHLQVRRSDEVEAQRRRWTFYETIK |
Ga0105104_104320882 | 3300009168 | Freshwater Sediment | MQGAQKLRREAHLRVRRNDEVEAQRHRWTFYETIK |
Ga0105097_100073717 | 3300009169 | Freshwater Sediment | RSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS* |
Ga0105097_100074971 | 3300009169 | Freshwater Sediment | MQGAQKLRNEAHLQVRRNDEVEAQRSRWTFYETIKPTGTGF* |
Ga0105097_100231349 | 3300009169 | Freshwater Sediment | MQGAQKLRSEPHLQVRRSDEVEAQRRRWTFYETINF |
Ga0105097_100322952 | 3300009169 | Freshwater Sediment | MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINIDSSTNQKKGG* |
Ga0105097_100342891 | 3300009169 | Freshwater Sediment | MQGAQKLRSEAHLRVRRSDEVEAQCRRWTFYETIILDGALETGI* |
Ga0105101_100175803 | 3300009171 | Freshwater Sediment | MLQMQGAQKLRSAAHELVRRNDEVATQRSRWTFYETIEAGRE* |
Ga0105101_102534332 | 3300009171 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDKVEAQRSRWNFYETIIL* |
Ga0105101_104844442 | 3300009171 | Freshwater Sediment | MQGAQKFRSEAYEQVRCNDEVEAQRRRWTFYETINFHQEIL |
Ga0115028_104099081 | 3300009179 | Wetland | MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVIIIINF* |
Ga0115028_104132082 | 3300009179 | Wetland | MQGAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGF |
Ga0115028_106944562 | 3300009179 | Wetland | QGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETINFDK* |
Ga0114938_13283611 | 3300009430 | Groundwater | MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYEAISPLAGREKPTR* |
Ga0116155_103406171 | 3300009771 | Anaerobic Digestor Sludge | MQGAQKLRSEPHLQVRRNDEVEAQRRRWTFYETIKFNS |
Ga0151652_126803312 | 3300011340 | Wetland | MQGAQKLRTEAHLQVRCKDEVEAQRRRWDFYETINDDVP* |
Ga0151652_137699542 | 3300011340 | Wetland | KKLQMQGAQKLRSEAYVQVRCNDEVEAQRGRWTFYETVNI* |
Ga0151652_137878341 | 3300011340 | Wetland | MLGAQKLRSEAHLWVRRNDEVAAQRRRWTFYETIFFKW |
Ga0153916_128528382 | 3300012964 | Freshwater Wetlands | QNLRSEAYLPVRCNDKGEAQRRRWTFYEAIKIERKVEGIL* |
Ga0075316_11762182 | 3300014314 | Natural And Restored Wetlands | MPGAQKLRSEAHLQVRRNDEEIDGQRRRWTFYETIKITPRKDQRIAG* |
Ga0075316_12055562 | 3300014314 | Natural And Restored Wetlands | VQGAQKLRNEAHLRVRRNDEVEAQRRKWTFYEVIKL* |
Ga0187776_105800282 | 3300017966 | Tropical Peatland | MQGAQKLRSEAYLHVRCNDEIEAQPRSERDRGTFYETI |
Ga0187787_104067261 | 3300018029 | Tropical Peatland | MQGAQKLRSEAHFQVRRNDGVAAQRSRWTFYETINHD |
Ga0184616_103065291 | 3300018055 | Groundwater Sediment | MQGAQNLRSEAYWLVRCNDEGEAQRRRWTFYEAISLGILGQRE |
Ga0184615_105716251 | 3300018059 | Groundwater Sediment | MPGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKIPFTGSS |
Ga0184615_106125651 | 3300018059 | Groundwater Sediment | LQMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKD |
Ga0187773_107434622 | 3300018064 | Tropical Peatland | FRKKIQMQGAQELRSEAYFHVRCNGEVEAQRRRWTFYEAVKE |
Ga0184636_10984452 | 3300018068 | Groundwater Sediment | MQGAQNLRSEAYLVVRCNDEGEAQRRRWTFYETIK |
Ga0184636_12003001 | 3300018068 | Groundwater Sediment | MPGAQNLRSEVYLLVRCNDEGEAQRRRWTFYEAIK |
Ga0184631_100737901 | 3300018070 | Groundwater Sediment | GAQKLRSEAHKQVRRNDEVAAQRSRWTFYETLKVTSPR |
Ga0194113_10000045127 | 3300020074 | Freshwater Lake | KKLQMQGAQNLRSEAYLQVRCNDEGEAQRRRWTFYETIKTFDH |
Ga0194113_1000009656 | 3300020074 | Freshwater Lake | MQGAQNLRSEAYLQVRRNDEGEAQRRRWTFYETILIEL |
Ga0194113_1000032429 | 3300020074 | Freshwater Lake | MQGAQNLRSEAYLQVHCNDEGEAQRRRWTFYETIFLDAPGKGGEYTPSKKT |
Ga0211729_111625922 | 3300020172 | Freshwater | MQGAQKLRSEAHLQVRRNDEVAAQRRRWIFYEAIKIDSA |
Ga0224495_100413822 | 3300022208 | Sediment | MQGAQNLRSEAYLLVRCNDEGEAQRRRWTLYETIRF |
(restricted) Ga0233425_103150502 | 3300024054 | Freshwater | MKGAQKLRSEAHLQVRCNDEGAAQRRRWTFYETINFDTQSSRK |
Ga0209324_100304153 | 3300025174 | Soil | MQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINFW |
Ga0209324_106007552 | 3300025174 | Soil | QMQGAQELRSEAYLHVRCNDEVEAQRSRWTFYETINH |
Ga0209323_100858223 | 3300025314 | Soil | KLQMQGAKKLRSEAYLHVRCNDEVEAQRSRWTFYETINID |
Ga0210136_10768722 | 3300025967 | Natural And Restored Wetlands | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETINV |
Ga0209269_10675962 | 3300027051 | Enrichment Culture | MQGAQKLRRAVHLPVRRNDEVEAQRRRWPFYETIKF |
Ga0209269_10735082 | 3300027051 | Enrichment Culture | MPIAQKRRSAAHLQVRRTDEVEAQRRRWTFYETIKNYETKG |
Ga0209704_12566002 | 3300027693 | Freshwater Sediment | MLQMQGAQKLRSAAHELVRRNDEVAAQRSRWTFYETIEAGRE |
Ga0209286_12988932 | 3300027713 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITEERKR |
Ga0209286_13367232 | 3300027713 | Freshwater Sediment | MQGAQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQTGP |
Ga0208665_101941481 | 3300027715 | Deep Subsurface | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYEIITS |
Ga0209492_10044975 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIK |
Ga0209492_10120604 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAYYQVRCNDEVEAQRRRWIFYETINFEEEI |
Ga0209492_10285845 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRRSWTFYKAINTGT |
Ga0209492_10326246 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAHLRVRRSDEVEAQCRRWTFYETIILDGALETGI |
Ga0209492_10468652 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAHLLVRRNDKVEAQRRRWTFYEAIKFR |
Ga0209492_10527292 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITE |
Ga0209492_10625993 | 3300027721 | Freshwater Sediment | KLQMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYEAIKLFYRPF |
Ga0209492_10651192 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAHLRVRRNDKVEAQRSRWTFYEVINVESLQK |
Ga0209492_11336781 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETINNSFFSA |
Ga0209492_11464012 | 3300027721 | Freshwater Sediment | MQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIK |
Ga0209492_11971891 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIT |
Ga0209492_12118711 | 3300027721 | Freshwater Sediment | MQGAQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQ |
Ga0209492_12318411 | 3300027721 | Freshwater Sediment | MQGAQKPRSEAHILVRRNDEVEAQRRRWTFYETITGSAWR |
Ga0209492_12938781 | 3300027721 | Freshwater Sediment | LQMQGAQKLRSEAHLQVRRNDEGAAQRRRWTFYEAIK |
Ga0209285_100274011 | 3300027726 | Freshwater Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRSRWNFYETITF |
Ga0209285_100598502 | 3300027726 | Freshwater Sediment | QMPGAQKLRNEAPSRVRRNDEVAAQRRRWIFYETIKIT |
Ga0209285_100927333 | 3300027726 | Freshwater Sediment | MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINPC |
Ga0209285_101141651 | 3300027726 | Freshwater Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYEIIAQGTMTTLIAPSS |
Ga0214474_10138123 | 3300027740 | Soil | MQGAQNLRSEAYFQVRCNDEGEAQRRRWTFYEAINV |
Ga0214474_11823551 | 3300027740 | Soil | MQGAQNLRSEAYLLERCNDEGEAQSRSERDRCTFYETIISCPMKK |
Ga0256868_100024261 | 3300027811 | Soil | MQGAQNLRSEAYLLERCNDEGEAQSRSERDRCTFYETIISCPMKKE |
Ga0209706_100409101 | 3300027818 | Freshwater Sediment | MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETIFIVS |
Ga0209706_100446472 | 3300027818 | Freshwater Sediment | MQGAQKLRSETHLRVRRNDEVETQRRRWTFYETIKL |
Ga0209706_100566283 | 3300027818 | Freshwater Sediment | KKLQMQGAQKLRSAAYLSVRCNDEVEAQRRRWTFYETIIFPG |
Ga0209706_100797391 | 3300027818 | Freshwater Sediment | MQGAQKLRSEAHLRVRRSDEVEAQPSRWTFYETIILDSALEMGI |
Ga0209706_100853731 | 3300027818 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRCRLTFYETITEE |
Ga0209706_101608052 | 3300027818 | Freshwater Sediment | MQGAQKLRSEAHLQVRRKDEVDAQRRRWTFYETINDDPIKSL |
Ga0209706_101675992 | 3300027818 | Freshwater Sediment | MQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETITFR |
Ga0209706_102647872 | 3300027818 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETIKYHRA |
Ga0209706_104060161 | 3300027818 | Freshwater Sediment | MQGAQKPRSEAHIWVRRNDEVAAQRRRWTFYESIRIFSVRF |
Ga0209262_105468911 | 3300027841 | Freshwater | MPGAQKLRSEAHYRVRRNDEVAAQRRRWTFYETINF |
Ga0209293_101092571 | 3300027877 | Wetland | MQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK |
Ga0209293_106236342 | 3300027877 | Wetland | MPGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANTVVVQ |
Ga0209293_107577982 | 3300027877 | Wetland | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEVIK |
Ga0208980_104834272 | 3300027887 | Wetland | MQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIML |
Ga0209635_100213224 | 3300027888 | Marine Sediment | MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAINNGF |
Ga0209496_101560982 | 3300027890 | Wetland | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIIFE |
Ga0209496_102384741 | 3300027890 | Wetland | QMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFLLDHLL |
Ga0209496_105036562 | 3300027890 | Wetland | MQGAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMP |
Ga0209254_100160956 | 3300027897 | Freshwater Lake Sediment | MQGAQKLRSEAHFLVRCNDEVEAQRRRWTFYETIKFLFGRKL |
Ga0209254_100463335 | 3300027897 | Freshwater Lake Sediment | GAQKLRREAHLRVRRNDEVEAQRSRWTFYETIKIGRGIG |
Ga0209254_100475992 | 3300027897 | Freshwater Lake Sediment | MQGAQKLRSEAHFQVRRNDEGAAQRRRWNFYEAIKLDP |
Ga0209254_100691052 | 3300027897 | Freshwater Lake Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYETIKHIIQP |
Ga0209254_100745692 | 3300027897 | Freshwater Lake Sediment | MQGAQKLRREAHFQVRRSDEVEAQRSRWTFYETIPS |
Ga0209254_100761663 | 3300027897 | Freshwater Lake Sediment | GAQKLRREAHLRVRRNDEVEAQRSRWTFYETIKFGIFKKNGG |
Ga0209254_100776136 | 3300027897 | Freshwater Lake Sediment | GAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKYD |
Ga0209254_100935822 | 3300027897 | Freshwater Lake Sediment | QRAPTMPGAQKLRSEAHLRVRRNDEVAAQSRSERDRWTFCETTLIGV |
Ga0209254_101367101 | 3300027897 | Freshwater Lake Sediment | MQGAQKLRSEAHLLVRRNDEVAAQRSRWTFYETILIAFYEVHRWREQ |
Ga0209254_104134502 | 3300027897 | Freshwater Lake Sediment | MQGAQKLRSEAHLQVRLSDEVEAQRRRWTFYETINIDSSTNQKKGG |
Ga0209254_105669462 | 3300027897 | Freshwater Lake Sediment | RKKLQMQGAQKLRSEEHLQVRRNDEVTAQRRRWTFYETINY |
Ga0209254_107567732 | 3300027897 | Freshwater Lake Sediment | MQGPQKLRSEAHLQVRCRDEVAGQRSRWTFYEAIDH |
Ga0209668_102261932 | 3300027899 | Freshwater Lake Sediment | MQGAQKLRSEVHLRVRRNDEVEAQRRRWTFYETIL |
Ga0209668_108624322 | 3300027899 | Freshwater Lake Sediment | MPGTQKLRGEGHLQVRRNGEVEAQRRSWAFCETVQFGLFA |
Ga0209668_110339481 | 3300027899 | Freshwater Lake Sediment | VQGGQKLRSEAYYQARGNDEVEAQRRRWTFYETIIFFIIDNQGL |
Ga0209253_100148167 | 3300027900 | Freshwater Lake Sediment | MQGAQKLRSEAHFQVRRNDEVAAQRRRWNFYETIKIDSLSLS |
Ga0209253_101351353 | 3300027900 | Freshwater Lake Sediment | QMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKF |
Ga0209253_102380583 | 3300027900 | Freshwater Lake Sediment | VGASAARPYIQGAQKLRSEAHFRVRRRWTFYETIKIY |
Ga0209253_102387762 | 3300027900 | Freshwater Lake Sediment | PPQAGLGAQELRSEAQNQVRRKDEVAAQRSRWTFYETIKAISPR |
Ga0209253_105611391 | 3300027900 | Freshwater Lake Sediment | GAQKLRSEAYLQVRCNDEVEAQRRRWTFYETINFSFAKKKGKPCNEK |
Ga0209427_100229902 | 3300027901 | Marine Sediment | MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAIFIDYLF |
Ga0209427_100780762 | 3300027901 | Marine Sediment | MQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAIILDFYHS |
Ga0209427_104774822 | 3300027901 | Marine Sediment | AQNLRSEAYLQVRRNDEGKAQRRRWTFYEAINNGF |
Ga0209048_1000411711 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEAYLHVRCNDEIEAQRRRWIFYETIKINCG |
Ga0209048_1001144610 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEAHFQLRRNDEVAAQRRKWTFYEAIRI |
Ga0209048_1001260613 | 3300027902 | Freshwater Lake Sediment | QMQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIK |
Ga0209048_100157221 | 3300027902 | Freshwater Lake Sediment | QMQGAQKLRSEAYLQVRRNDEGEVQRSRWTFYETITLDS |
Ga0209048_100229444 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIQIG |
Ga0209048_100229636 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEAYLQIRCNDEVEAQRRRWTFYETIRFYAT |
Ga0209048_100425901 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEACLQVRCNDEVEAQRRRWTFYETIN |
Ga0209048_100482455 | 3300027902 | Freshwater Lake Sediment | QGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETINDWRG |
Ga0209048_100528384 | 3300027902 | Freshwater Lake Sediment | MQGAQNLRSEAYLQVRRNDEGEVQRSRWTFCETIKEGGL |
Ga0209048_100552725 | 3300027902 | Freshwater Lake Sediment | GAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIITT |
Ga0209048_100607621 | 3300027902 | Freshwater Lake Sediment | QGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETIYNGGF |
Ga0209048_100622712 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKFD |
Ga0209048_100778043 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEAYLYVRCNDEVEAQRRRWNFYEAIKKNEIN |
Ga0209048_100812493 | 3300027902 | Freshwater Lake Sediment | QMQGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETIIIIP |
Ga0209048_102631452 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEAHLQLRRNDEVAAQRSRWTFYETIKFDDLIKSH |
Ga0209048_102846012 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETITLMGVKIA |
Ga0209048_103476301 | 3300027902 | Freshwater Lake Sediment | GAQKLRSEAHLQVRRNDEVAAQRRRWTFYETISFHE |
Ga0209048_103618601 | 3300027902 | Freshwater Lake Sediment | GAQKLRSEGYLQVPCNDEVEAQRRRWTFYETINISLIR |
Ga0209048_104007372 | 3300027902 | Freshwater Lake Sediment | QKLRSEAYLHVRCNDEVEAQRRRWIFYETTIIDPCCY |
Ga0209048_104505532 | 3300027902 | Freshwater Lake Sediment | MQGAQKLRSEAHLQMRRNKEVAAQRSRWTFYETINLWHIHK |
Ga0209048_105383602 | 3300027902 | Freshwater Lake Sediment | QMQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIKF |
Ga0209048_106482701 | 3300027902 | Freshwater Lake Sediment | GAQKLRSEGYLQVPCNDEVEAQRRRWTFYETINFCANYFLS |
Ga0209048_107897542 | 3300027902 | Freshwater Lake Sediment | QMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKFTFSD |
Ga0209048_107926011 | 3300027902 | Freshwater Lake Sediment | MHGAQKLRSEGYLQVPCNDEVEAQRRRWTFYETIN |
Ga0209048_108394131 | 3300027902 | Freshwater Lake Sediment | QGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETINIMSI |
Ga0209048_109381962 | 3300027902 | Freshwater Lake Sediment | GAQKLRSEAHLQVRRNDEVAAQRSRWTFYETIKEDSLARSQAE |
Ga0209820_10786791 | 3300027956 | Freshwater Sediment | MQGALKMRREAYYQVRCNDEVAAQRRRWNFYETITFSTW |
Ga0209705_100421162 | 3300027979 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKVRG |
Ga0209705_100644603 | 3300027979 | Freshwater Sediment | MQGAQKLRIEAHLQVRRSDEVEAQRRRWTFYETINPC |
Ga0209705_101241883 | 3300027979 | Freshwater Sediment | MQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETIC |
Ga0209705_102070151 | 3300027979 | Freshwater Sediment | MPGAQKLRSEAHSQVRRNDEVEAQRRRWTLYEAIR |
Ga0299915_105389883 | 3300030613 | Soil | MPGAQNLRSEAYLPVRRNDEGEAQRRRWTFYEAIKNNI |
Ga0315293_104579943 | 3300031746 | Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETICMN |
Ga0315293_109783191 | 3300031746 | Sediment | MQGAQNLRSEAYLQVRCNDEGEAQRRRWTFYETMVF |
Ga0315293_112536361 | 3300031746 | Sediment | MQGAQKLRSEAHLQVRRSDEVEAQRSRWTFYETIKFKDSEH |
Ga0315288_106998152 | 3300031772 | Sediment | QMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYEAIKFRL |
Ga0315290_100344034 | 3300031834 | Sediment | MQGAQKLRSEAHFQVRRNDEVEAQRSRWTFYETIMYGPP |
Ga0315290_101660022 | 3300031834 | Sediment | MQGAQKLRSEAHFLVRRNDEVEAQRRRWTFYETIISRTLRP |
Ga0315290_101768281 | 3300031834 | Sediment | FRKKLQMQGAQKLRSEAYYQVRCNDEVEAQRRRWTFYETINI |
Ga0315290_106309592 | 3300031834 | Sediment | MPGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIKTLPAGP |
Ga0315290_107188282 | 3300031834 | Sediment | LRSEAYLHVRCNDEVEAQRSRWTFYETIKIHSPKELI |
Ga0315297_100979963 | 3300031873 | Sediment | KKLQMQGAQKLRSEVHLRVRRNDEVAAQRRRWTFYETINICNLQ |
Ga0315297_101737241 | 3300031873 | Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYETIKT |
Ga0315297_101847251 | 3300031873 | Sediment | MQGAQRLRREAHLRVRRNDEVAAQRRRWTFYETIKVIS |
Ga0315297_102825273 | 3300031873 | Sediment | MQGAQKLRSQAHFQVRRNDEVEAQRSRWTFYETIMYGPP |
Ga0315297_106175031 | 3300031873 | Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCNSKKYRWLDGH |
Ga0315297_106590222 | 3300031873 | Sediment | GAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINLDEIVKSP |
Ga0214473_100373596 | 3300031949 | Soil | MQGAQKLKGEAYFHVRCNDEVEAQSRSERDRWTFYETIKIEDNPD |
Ga0214473_102276284 | 3300031949 | Soil | MQGAQNLRSDAYLLVRCNDEGEAQRRRWTFYEAIFFFF |
Ga0214473_103038283 | 3300031949 | Soil | AQNVRSEAYLQVRRNDEGEAQRRRWTFYEAINFLFLAWPVRRRKK |
Ga0214473_108962222 | 3300031949 | Soil | MQGAQNLRSEAYLAVRRSDEGEAQRRRWTFYEAIIF |
Ga0214473_109622654 | 3300031949 | Soil | AQKLRSEAHLRVRRNDEVAAQSRSERDRWTFYETIKD |
Ga0315294_110408071 | 3300031952 | Sediment | QMQDAQKLRSEAYEQVRCNDEVEAQRRRWTFYETI |
Ga0315294_113176102 | 3300031952 | Sediment | KLWSEAHLQVRRNDEGAAQRRRWTFYEIIWDRFEVIR |
Ga0315278_100492156 | 3300031997 | Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETITLT |
Ga0315278_101835613 | 3300031997 | Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIN |
Ga0315278_102660882 | 3300031997 | Sediment | MPGAQKLRSEAYLQVRGNDEVEAQSRSERDRWIFYETIKFGG |
Ga0315278_106310971 | 3300031997 | Sediment | MQGAQKLRSEAHLWVRRNDEVAAQRRRWTFYETIKISIAIYHKGRKM |
Ga0315274_103251793 | 3300031999 | Sediment | MQGAQKLRSEARLQVRRNDEVEAHRRRWTFYETINH |
Ga0315274_107544063 | 3300031999 | Sediment | MQGAQKLRREAHLRVRRNDEVEAQRRRWTFYKAINFAS |
Ga0315274_107897821 | 3300031999 | Sediment | QSKKHQMQGAQNVRSEAYLQVRLNDEGEAQRRRWTFYEAIKIH |
Ga0315296_101755572 | 3300032020 | Sediment | MQGAQKLRSEAYIRVRCNDEVEAQRSRWIFYETIMLILMLFRIEGD |
Ga0315296_104329853 | 3300032020 | Sediment | MQGAQSLRSEAYLLVRCNDKGEAQRRRWTFYETINISSCT |
Ga0315289_105293401 | 3300032046 | Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIIH |
Ga0315284_102614772 | 3300032053 | Sediment | MQGAQELRSEAYLHVRCNDEVEAQRSRWTFYETINIHFVGAGFNPAQ |
Ga0315284_103790791 | 3300032053 | Sediment | GAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINYDAKVRGTTLL |
Ga0315284_104817072 | 3300032053 | Sediment | MQGAQKLRSEAHLQVRRKDEVAAQRRSWTFYETIILILP |
Ga0315284_106528302 | 3300032053 | Sediment | KKLQMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKFRL |
Ga0315284_112736901 | 3300032053 | Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINIC |
Ga0315284_115851942 | 3300032053 | Sediment | MQGAQELRSEAHLQVRRNDEVEAQRRRWTFYETIKVDRT |
Ga0315279_100529873 | 3300032070 | Sediment | MQGAQNLRSEAYLLVRCNDEGEAQRRRWTFYEAIKFRK |
Ga0315279_108559531 | 3300032070 | Sediment | MQGAQNLRSEPYYKVRRNDEGEAQRRRWTFYEAITLE |
Ga0315292_100733511 | 3300032143 | Sediment | QMQGAQKLRSEAYLQVRCNDEVEAQRSRWTFYETIKLHRNFSA |
Ga0315292_101249133 | 3300032143 | Sediment | MQGAQKLRSEAHLQARRNDEVAAQRSRWTFYETIKNG |
Ga0315292_114543982 | 3300032143 | Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFSETIKF |
Ga0315295_100826314 | 3300032156 | Sediment | QMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINLDEIVKSP |
Ga0315295_105355074 | 3300032156 | Sediment | GAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCNSKKYRWLDGH |
Ga0315295_105845851 | 3300032156 | Sediment | QGAQKLRSEAHLRVRRNDEVAAQRRRWTFYEAIKFRL |
Ga0315295_108695552 | 3300032156 | Sediment | MQGVQKLRSEAHCQVRCNDEVEAQRSRWTFYETLTTD |
Ga0315295_112214231 | 3300032156 | Sediment | ELRSAAYLRVRCNDEVEAQSCSEQDRWTFYEIIKFACA |
Ga0315281_108489232 | 3300032163 | Sediment | RSEAHLRVRRNDEVAAQRRRWTFYETIIFYSTSFASRIIL |
Ga0315283_120336112 | 3300032164 | Sediment | MQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETINF |
Ga0315276_101689511 | 3300032177 | Sediment | GAQKLRSETHLRVRRNDEVEAQRRRWTFYEAINLGRKIWRD |
Ga0315276_103929623 | 3300032177 | Sediment | MPGAQKLRSEAHFKMHPNDEVAGQRRRWTFYETINIAISSTSNQE |
Ga0315276_112738232 | 3300032177 | Sediment | MQGAQKLRSETHLRVRRNDEVEAQRRRWTFYEAIKIYK |
Ga0315276_121107961 | 3300032177 | Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCN |
Ga0315276_121858881 | 3300032177 | Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETINIGNSGKWT |
Ga0315286_100653851 | 3300032342 | Sediment | MQGAQKLRSEANSPVRRNDEVEEQRRRWTFYETIRNKTMALRIYN |
Ga0315286_114829851 | 3300032342 | Sediment | MQGAQKLRSEAHFKVRCNDEVKAQRSRWTFYETINFGFQK |
Ga0315287_103064563 | 3300032397 | Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINLGT |
Ga0315287_110400513 | 3300032397 | Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIRNNK |
Ga0315287_122610661 | 3300032397 | Sediment | MQGAQKLRSEAYSQVRCNDEVEAQRSRWTFYETIKGFSMRRWER |
Ga0315287_125093442 | 3300032397 | Sediment | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETINYACFEGG |
Ga0315275_101487351 | 3300032401 | Sediment | MQGAQKLRSAAHLRVRRNDEVAAQRSRRTFYETIEGGSCP |
Ga0315275_102099951 | 3300032401 | Sediment | MQGAQNVRSEAYLQVRRNDEGEAQRRRWTFYEAVKF |
Ga0315275_106330501 | 3300032401 | Sediment | MQGAQKLKSEAHLRVRCNDEVEAQRRRWTFYETINFRHF |
Ga0315275_107844332 | 3300032401 | Sediment | QGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKI |
Ga0315275_111624231 | 3300032401 | Sediment | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCNS |
Ga0315275_115766341 | 3300032401 | Sediment | LQMQGAQKLRSEAYLHVRWNDEVEAQRSRWTFYETILIKSLQTREFLVKIK |
Ga0315275_120203441 | 3300032401 | Sediment | MQGAQNVRSEAYLQVRRNDEGEAQRRRWTFYEAIIVKNRM |
Ga0315275_126784731 | 3300032401 | Sediment | MQGAQKLRSEAYLHVRCNDEVEAQSRSERDRWTFYETIKIGSFAP |
Ga0315273_102262462 | 3300032516 | Sediment | MQGAQKLRSAAHLQLRRNEEVAAQRSRWTFYETINYACFEGGGSMSLG |
Ga0315273_103137314 | 3300032516 | Sediment | AQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKTKRL |
Ga0315273_103253523 | 3300032516 | Sediment | KLQMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKIHFP |
Ga0315273_103347733 | 3300032516 | Sediment | KLQMQGAQKLRSEAYLHVRCNDEVEAQSRSERETFYETTTLY |
Ga0315273_103811672 | 3300032516 | Sediment | MQGAQKLRSEAYYQVRCNDEVEAQRRRWTFYETINI |
Ga0315273_105711262 | 3300032516 | Sediment | MQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKISPFEKGG |
Ga0315273_106492211 | 3300032516 | Sediment | MQGAQKLRREAHLRVRRNDEVEAQRSRWTFYETIKFC |
Ga0315273_113584641 | 3300032516 | Sediment | QGAQELRSEAYLHVRCNDEVEAQRSRWTFYETINFDNSITKGVQAGQ |
Ga0315273_113679561 | 3300032516 | Sediment | MQGAQKLRSEAYLQVRCNDEVEAQRSRWTFYEAIKLVS |
Ga0315273_122912631 | 3300032516 | Sediment | KKLQMPGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKKP |
Ga0315273_130450251 | 3300032516 | Sediment | MPGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETIFIVST |
Ga0316604_100196235 | 3300033406 | Soil | MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT |
Ga0316604_100436161 | 3300033406 | Soil | RKKLQMPGGQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIKI |
Ga0316604_106763372 | 3300033406 | Soil | LQMQGAQKLRNEAHLQVRLNDEVAAQRRRWTFNETIKVNIFINVP |
Ga0316605_100370734 | 3300033408 | Soil | MQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYETIKI |
Ga0316605_100593471 | 3300033408 | Soil | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKLDSFLS |
Ga0316605_102478182 | 3300033408 | Soil | MQGAQKLWREAHMQVRRNDEVEAQRRRWTFHEVIKKEREHGPSS |
Ga0316605_103750922 | 3300033408 | Soil | MQGAQKLRSEAHLLVRRNDEVEAQRSRWTFYEVINN |
Ga0316605_105149151 | 3300033408 | Soil | RFCKKLQMQGARKLRSEVHFGARRNDEVEAQRRSWTFYETVNV |
Ga0316605_105756312 | 3300033408 | Soil | GAQNLRSAAHLPVRRNDEVAAQRRRWTFYETIKFDLANT |
Ga0316605_106431823 | 3300033408 | Soil | MQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYEIITS |
Ga0316605_109591252 | 3300033408 | Soil | MQGAQELRSGAHMQVRRNDEVEAQRRRWIFYETIMLW |
Ga0316605_113510742 | 3300033408 | Soil | MQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETIKN |
Ga0316605_120774872 | 3300033408 | Soil | MQGAQKLRSEPHLRVRRSDEGEAQRRGWTFYETIKKLKGGDSK |
Ga0316605_121684651 | 3300033408 | Soil | MQGALKLRNEADLLVRRNNEVAAQRRRWTFYEVILFTFSWELP |
Ga0316603_100947254 | 3300033413 | Soil | MPGAQKLWSEAHLQVRRNDEVAAQSRSERDRWTFYETIKI |
Ga0316603_103827223 | 3300033413 | Soil | KLQMPGAQKLRSEGHLQVRRNDEVAAQSRSERDRWTFYETIK |
Ga0316603_104120054 | 3300033413 | Soil | MQGAQKLRSEAHLQVRRSDEVEVQRRRWTFYETISFHG |
Ga0316603_107591672 | 3300033413 | Soil | MQGAQKLRNAAHLQVRRNDEVEAQRSRWTFYETIKKDS |
Ga0316603_112363231 | 3300033413 | Soil | MPGAQKLRSEAHLPVRRNDEVAAQRRRWTFYESIKFDL |
Ga0316603_117360882 | 3300033413 | Soil | MQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIF |
Ga0316603_119321362 | 3300033413 | Soil | MQGAQKLRSEAHIWVRRNDEVEAQSRSERDRWTFYETIKGDGILKGDAR |
Ga0316603_121955871 | 3300033413 | Soil | MQGTQKLRSEAHLCVRRNDEVEAQRSRWTFYETIKFS |
Ga0316619_101380541 | 3300033414 | Soil | QMQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK |
Ga0316619_104678551 | 3300033414 | Soil | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEAIK |
Ga0316619_105692861 | 3300033414 | Soil | MEGAQNLRSEAHLQVSRNDEVTAQCRRWTFYETIKNYCFLCQRGPSE |
Ga0316619_110943521 | 3300033414 | Soil | MQGAQKLRSEAHLWVRRSDVVAAQSRSERDRWTFYETISAGFSSG |
Ga0316619_111060142 | 3300033414 | Soil | MQGARKLRSEAYEPVRCNDEGEAQRGRWTFYEDIISRSRIPGSCSKA |
Ga0316619_119337191 | 3300033414 | Soil | RKKLQVQGAQKLRSEAHLQVRRNDEVAAQRRRWTFY |
Ga0316619_120020931 | 3300033414 | Soil | MQGAQKLRNEAHLLVRRNDEVAAQRRRWTFYEVLRFSWSLRPVSLSP |
Ga0316622_1002494311 | 3300033416 | Soil | QKLRSEAHLQVRRNDEVAAQSRSERDGWTFCETIKFGG |
Ga0316625_1001325963 | 3300033418 | Soil | MQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITI |
Ga0316625_1010475092 | 3300033418 | Soil | LQGTQKLRSEAHLRVRRSDEVEAQRRRWTFYETINNY |
Ga0316625_1010670671 | 3300033418 | Soil | MQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYQVINFDSEFPET |
Ga0316601_1000052571 | 3300033419 | Soil | MQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIFFE |
Ga0316601_1004402651 | 3300033419 | Soil | KKLQMQGAQKLRSEAHLLVRRNDEVEAQRSRWTFYEVINN |
Ga0316601_1011407061 | 3300033419 | Soil | MQGAQKLRSEAHFQVRRNDEVAAQRRRWTFYETIKFGKAVS |
Ga0316601_1018254932 | 3300033419 | Soil | QGVQKLRSEAHLQVRRNDEVAAQRRRWTFYETINVGIQE |
Ga0316601_1026013531 | 3300033419 | Soil | MQGAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMPG |
Ga0316601_1026321111 | 3300033419 | Soil | MQGALKLRNEADLLVRRNNEVAAQRRRWTFYEVILFTFSWE |
Ga0326726_100938524 | 3300033433 | Peat Soil | LQMQGAQKLRSEAHLQVRRNDEVAAHRRWTFYEAIKKNEIN |
Ga0326726_103527732 | 3300033433 | Peat Soil | MQGAQKLRSEVHLQVRRNDEVAAQRSRWTFYETITFF |
Ga0326726_104261623 | 3300033433 | Peat Soil | QMQGAQELRREAYLRVRRNDEGEGQRRRWTFYEAIKLR |
Ga0326726_111072541 | 3300033433 | Peat Soil | MQGAQKLRSEAHSRVRRNDEVAAQRRRWTFYETIKFSEK |
Ga0326726_118595903 | 3300033433 | Peat Soil | KLQMQGAQELRSEAYLLVRCNDEVEAQRRRWTFYETIIFPSP |
Ga0316613_103010142 | 3300033434 | Soil | FREKLQLQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINKA |
Ga0316620_102107973 | 3300033480 | Soil | QMQGARKLRSEVHFGARRNDEVEAQRRSWTFYETVNV |
Ga0316620_105001892 | 3300033480 | Soil | MPGAQKLSSEAHFRVRRNDEVAAQRSRWTFYEIILF |
Ga0316620_106488152 | 3300033480 | Soil | MQGAQKLRSEAHVQVRRNDEVEAQRSSWTFYEAIKVA |
Ga0316620_114079191 | 3300033480 | Soil | MVSKKLQMQGAQEMRSEAYEHVRCNDEVEARRSRWTSYK |
Ga0316620_119720742 | 3300033480 | Soil | MQGAQKLRKEAHEQVRRNDEVAAQRRRRTFYETITC |
Ga0316620_123285892 | 3300033480 | Soil | MPGAQKLRSEARLQVRRNDEVEAQRRRWIFYETIKF |
Ga0316600_100680311 | 3300033481 | Soil | MPGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT |
Ga0316600_101464902 | 3300033481 | Soil | MQGAQKLRSEAHLQVRRNDEVAAQSRSGRDRWTFYETIN |
Ga0316600_102263681 | 3300033481 | Soil | MQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETINFLPLKKDV |
Ga0316600_105283721 | 3300033481 | Soil | MQGAQKLRNEAHLQVRLNDEVAAQRRRWTFYETIKVNIFINVP |
Ga0316600_109852422 | 3300033481 | Soil | MQGAQKLRSEAHILVRRSDEVEAQRSRWTFYEAIKIVAS |
Ga0316600_110376642 | 3300033481 | Soil | MQGAQKLRSAAHAYVRRNDEGEAQSRSERDRWACYE |
Ga0316600_112010162 | 3300033481 | Soil | KKLQMQGARKLRSEVHFGARRNDEVEAQRRSWTFYETVNV |
Ga0316627_1003935332 | 3300033482 | Soil | MQGAQKLRSEAHLQVRRSDEVEAQRSGWTFYETINIE |
Ga0316627_1004193193 | 3300033482 | Soil | MPGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIK |
Ga0316627_1004891971 | 3300033482 | Soil | LRSEAHLQVRRNDEVAAQSRSERDRWTFYETIKIGGI |
Ga0316627_1010656641 | 3300033482 | Soil | MQGAQKLRSEAHLRVRRSDEVEAQSRSEWDRRTFYETI |
Ga0316627_1015045011 | 3300033482 | Soil | PQMQGTQKLRSEAHISVRRNDEVEAQRSRWTFYEVI |
Ga0316627_1016149321 | 3300033482 | Soil | GAQKLRSEAHLQVRRNDEVAAQRRRWTFCETSKSVKT |
Ga0316627_1022591621 | 3300033482 | Soil | MQGAQKLRSEAHFWVCRNDEFEAPHRRETFYETIY |
Ga0316627_1029067601 | 3300033482 | Soil | QKLRSEAHNQVRRSDEVEAQSRSERDRWTFYETFNC |
Ga0316629_102022691 | 3300033483 | Soil | KLQMQGAQKLRSQAHLRVRRNDEVEAQRRRWTFYEVINFDK |
Ga0316626_100382221 | 3300033485 | Soil | KLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMPG |
Ga0316626_100565433 | 3300033485 | Soil | MQGAQKLRSEAYTEVRGNDEVEAQRRRWTFYGTIAKGTGP |
Ga0316626_104694642 | 3300033485 | Soil | LAPAMQGAQKLRSGAHLRVRRNDEVAAQRRRWTFYETINKA |
Ga0316626_104992522 | 3300033485 | Soil | MQGAQKLRSGAHLQVRRNNEVAAQRRRWTFYETIKN |
Ga0316626_105641152 | 3300033485 | Soil | MQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIKIGGI |
Ga0316626_108099341 | 3300033485 | Soil | MQGAQKLRNEAHLQVRRNDEVEAQRSRWTFYETITLDFF |
Ga0316626_109577502 | 3300033485 | Soil | MPGTQKLRSEAHLRVRRSDVVAAQSRSERDRWTFYETINFAVFTH |
Ga0316626_109873171 | 3300033485 | Soil | MQGGQKLRSEAHLRVRLSDEVEAQRRRWTFYETIKI |
Ga0316626_109963302 | 3300033485 | Soil | MQGAQKLRSEAHIWVRRKDEAAAQRRRWTFSEVITL |
Ga0316624_103070632 | 3300033486 | Soil | MQGAQKLRSEVHFQVRRNDEVEAERSRWIFYKTIRSRK |
Ga0316624_112904541 | 3300033486 | Soil | MQGAQNLKGEAYLQVRRNNEVVAQSRSERDRWTFLQ |
Ga0316624_119208781 | 3300033486 | Soil | MQGSQKLRSETYFQARCNDEVEAQRRRWTFYETIKV |
Ga0316630_100161675 | 3300033487 | Soil | KLRSEAHLQVRRNDEVAAQSRSERDGWTFCETIKFGG |
Ga0316630_105749422 | 3300033487 | Soil | MQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFY |
Ga0316630_105838771 | 3300033487 | Soil | QGAQKLRSEAHLQVRRNDEVAAQRRRWTFCETSKSVKT |
Ga0316621_101669311 | 3300033488 | Soil | GAQKLRSEAHIYVRRSDEVAAQPRSERDRWTFYRTI |
Ga0316621_103368251 | 3300033488 | Soil | MQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFCETSKSVKT |
Ga0316621_112627582 | 3300033488 | Soil | MQGAQNLRSEAHLQVRRNDGVAAQRRRWTFYEVINFIDF |
Ga0299912_102678581 | 3300033489 | Soil | QMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKI |
Ga0299912_103882723 | 3300033489 | Soil | MQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIK |
Ga0299912_104567041 | 3300033489 | Soil | MKGAQKLRSEAYFHVRCNDEVEAQRSRWTFYETIEIEDNPD |
Ga0316628_1013257452 | 3300033513 | Soil | MQGAQKLRSEPHNQVRRNDEVEAQRSRWTFYEPVIFRIY |
Ga0316628_1014582111 | 3300033513 | Soil | TNHGAQKLRSEAHFQGRRSDEVAAQRHRWTFCETIKFGG |
Ga0316628_1034434862 | 3300033513 | Soil | MQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYEAIKIY |
Ga0316616_1002588072 | 3300033521 | Soil | MQGAQELRSEAHLQVRRNDEVEAQRSRWTFYETIIF |
Ga0316616_1003931682 | 3300033521 | Soil | MQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIKFLLPPFL |
Ga0316616_1006509721 | 3300033521 | Soil | MQGAQELRSEAHIWVRRNDEVEAQSRSERDRWTFYETIKGDGILKGDAR |
Ga0316616_1012790201 | 3300033521 | Soil | LRSEAHLQVRRNDEVAAQRSRWTFYETINFRRFSACKAF |
Ga0316616_1020666711 | 3300033521 | Soil | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEVINLHF |
Ga0316616_1029402981 | 3300033521 | Soil | CKKFQMKGAQKLRSEAHLGVRRNDEVAAQRRRWTFYEAIRG |
Ga0316616_1033223131 | 3300033521 | Soil | QKLRSEAHSQVRRNDEIKAQRRRGTLYETIKEKIIPYP |
Ga0316616_1037559702 | 3300033521 | Soil | MQVAQKRKSAAHLQVRRNDEVEAQGRRWTSYETIKIDQFGR |
Ga0316617_1000042173 | 3300033557 | Soil | MQGAQKLRSEAHLGVRRNGEVEAQRRRWTFNEVIKF |
Ga0316617_1006655551 | 3300033557 | Soil | KLQMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYQVINFDSEFPET |
Ga0316617_1014368681 | 3300033557 | Soil | MQGTQKLRSEAHLLVRRNDEVEAQRSRWTFYETMKKGR |
Ga0316617_1021193251 | 3300033557 | Soil | MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEAIN |
Ga0316617_1024892432 | 3300033557 | Soil | MQGAQKLRSEAHLLVRRNDEIEAQRRRWAFYEFINL |
⦗Top⦘ |