NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F003929

Metagenome Family F003929

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F003929
Family Type Metagenome
Number of Sequences 461
Average Sequence Length 39 residues
Representative Sequence MQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKFD
Number of Associated Samples 117
Number of Associated Scaffolds 461

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.22 %
% of genes near scaffold ends (potentially truncated) 62.47 %
% of genes from short scaffolds (< 2000 bps) 74.40 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.308 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment
(24.729 % of family members)
Environment Ontology (ENVO) Unclassified
(51.410 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(41.215 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.31%    β-sheet: 0.00%    Coil/Unstructured: 47.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 461 Family Scaffolds
PF00005ABC_tran 1.74
PF06808DctM 1.52
PF07992Pyr_redox_2 1.52
PF13561adh_short_C2 1.30
PF13458Peripla_BP_6 1.30
PF00528BPD_transp_1 1.30
PF03480DctP 1.08
PF04055Radical_SAM 1.08
PF02653BPD_transp_2 1.08
PF07331TctB 0.87
PF00441Acyl-CoA_dh_1 0.87
PF00072Response_reg 0.87
PF03060NMO 0.87
PF02321OEP 0.65
PF01040UbiA 0.65
PF01558POR 0.65
PF09312SurA_N 0.65
PF02915Rubrerythrin 0.65
PF00465Fe-ADH 0.65
PF02769AIRS_C 0.65
PF027373HCDH_N 0.65
PF02954HTH_8 0.65
PF03069FmdA_AmdA 0.65
PF01808AICARFT_IMPCHas 0.65
PF00106adh_short 0.65
PF01520Amidase_3 0.65
PF00501AMP-binding 0.43
PF00873ACR_tran 0.43
PF04993TfoX_N 0.43
PF04773FecR 0.43
PF01850PIN 0.43
PF03972MmgE_PrpD 0.43
PF00009GTP_EFTU 0.43
PF01592NifU_N 0.43
PF13193AMP-binding_C 0.43
PF13378MR_MLE_C 0.43
PF01545Cation_efflux 0.43
PF03450CO_deh_flav_C 0.43
PF04963Sigma54_CBD 0.43
PF00912Transgly 0.43
PF01145Band_7 0.43
PF00011HSP20 0.43
PF01048PNP_UDP_1 0.43
PF00378ECH_1 0.43
PF14833NAD_binding_11 0.43
PF00903Glyoxalase 0.43
PF00440TetR_N 0.43
PF16576HlyD_D23 0.43
PF16868NMT1_3 0.43
PF08984DUF1858 0.43
PF13607Succ_CoA_lig 0.43
PF01208URO-D 0.43
PF00950ABC-3 0.43
PF05853BKACE 0.43
PF01434Peptidase_M41 0.43
PF00152tRNA-synt_2 0.43
PF01609DDE_Tnp_1 0.43
PF00266Aminotran_5 0.43
PF02673BacA 0.43
PF13744HTH_37 0.43
PF00202Aminotran_3 0.43
PF00920ILVD_EDD 0.43
PF05167DUF711 0.22
PF01312Bac_export_2 0.22
PF03328HpcH_HpaI 0.22
PF13145Rotamase_2 0.22
PF04015DUF362 0.22
PF00701DHDPS 0.22
PF04468PSP1 0.22
PF08402TOBE_2 0.22
PF01171ATP_bind_3 0.22
PF01066CDP-OH_P_transf 0.22
PF01613Flavin_Reduct 0.22
PF04295GD_AH_C 0.22
PF00069Pkinase 0.22
PF10996Beta-Casp 0.22
PF00361Proton_antipo_M 0.22
PF05973Gp49 0.22
PF01182Glucosamine_iso 0.22
PF13365Trypsin_2 0.22
PF12441CopG_antitoxin 0.22
PF01039Carboxyl_trans 0.22
PF11010DUF2848 0.22
PF03401TctC 0.22
PF01925TauE 0.22
PF00164Ribosom_S12_S23 0.22
PF00582Usp 0.22
PF00994MoCF_biosynth 0.22
PF09992NAGPA 0.22
PF01979Amidohydro_1 0.22
PF11219DUF3014 0.22
PF02374ArsA_ATPase 0.22
PF01661Macro 0.22
PF02775TPP_enzyme_C 0.22
PF01951Archease 0.22
PF00107ADH_zinc_N 0.22
PF00395SLH 0.22
PF00578AhpC-TSA 0.22
PF00586AIRS 0.22
PF02080TrkA_C 0.22
PF02540NAD_synthase 0.22
PF02771Acyl-CoA_dh_N 0.22
PF11897DUF3417 0.22
PF13288DXPR_C 0.22
PF14559TPR_19 0.22
PF00177Ribosomal_S7 0.22
PF01795Methyltransf_5 0.22
PF02195ParBc 0.22
PF02682CT_C_D 0.22
PF02803Thiolase_C 0.22
PF00675Peptidase_M16 0.22
PF00580UvrD-helicase 0.22
PF01970TctA 0.22
PF12419DUF3670 0.22
PF02310B12-binding 0.22
PF08901DUF1847 0.22
PF13358DDE_3 0.22
PF04715Anth_synt_I_N 0.22
PF14358DUF4405 0.22
PF02629CoA_binding 0.22
PF09339HTH_IclR 0.22
PF00291PALP 0.22
PF00857Isochorismatase 0.22
PF13231PMT_2 0.22
PF07927HicA_toxin 0.22
PF01370Epimerase 0.22
PF01425Amidase 0.22
PF13453zf-TFIIB 0.22
PF03358FMN_red 0.22
PF00216Bac_DNA_binding 0.22
PF13411MerR_1 0.22
PF02361CbiQ 0.22
PF03144GTP_EFTU_D2 0.22
PF00561Abhydrolase_1 0.22
PF14815NUDIX_4 0.22
PF02502LacAB_rpiB 0.22
PF00550PP-binding 0.22
PF08843AbiEii 0.22
PF00497SBP_bac_3 0.22
PF01121CoaE 0.22
PF04851ResIII 0.22
PF13847Methyltransf_31 0.22
PF08281Sigma70_r4_2 0.22
PF12399BCA_ABC_TP_C 0.22
PF13776DUF4172 0.22
PF02579Nitro_FeMo-Co 0.22
PF09917DUF2147 0.22
PF13801Metal_resist 0.22
PF01641SelR 0.22
PF02347GDC-P 0.22
PF13011LZ_Tnp_IS481 0.22
PF02397Bac_transf 0.22
PF05015HigB-like_toxin 0.22
PF09976TPR_21 0.22
PF11249DUF3047 0.22
PF01702TGT 0.22
PF06429Flg_bbr_C 0.22
PF16916ZT_dimer 0.22
PF01887SAM_HAT_N 0.22
PF007253HCDH 0.22
PF02405MlaE 0.22
PF00313CSD 0.22
PF02190LON_substr_bdg 0.22
PF13175AAA_15 0.22
PF09861Lar_N 0.22
PF13533Biotin_lipoyl_2 0.22
PF01799Fer2_2 0.22
PF13380CoA_binding_2 0.22
PF16321Ribosom_S30AE_C 0.22
PF02667SCFA_trans 0.22
PF12838Fer4_7 0.22
PF02075RuvC 0.22
PF00881Nitroreductase 0.22
PF01568Molydop_binding 0.22
PF07963N_methyl 0.22
PF09285Elong-fact-P_C 0.22
PF02596DUF169 0.22
PF02585PIG-L 0.22
PF03205MobB 0.22
PF01882DUF58 0.22
PF13727CoA_binding_3 0.22
PF00206Lyase_1 0.22
PF11304DUF3106 0.22
PF07729FCD 0.22
PF04536TPM_phosphatase 0.22
PF02391MoaE 0.22
PF13432TPR_16 0.22
PF09190DALR_2 0.22
PF14076DUF4258 0.22
PF03129HGTP_anticodon 0.22
PF01041DegT_DnrJ_EryC1 0.22
PF02754CCG 0.22
PF13646HEAT_2 0.22
PF01546Peptidase_M20 0.22
PF01761DHQ_synthase 0.22
PF13597NRDD 0.22
PF00588SpoU_methylase 0.22
PF00117GATase 0.22
PF04972BON 0.22
PF08442ATP-grasp_2 0.22
PF06865Ppnp 0.22
PF09335SNARE_assoc 0.22
PF13401AAA_22 0.22
PF03992ABM 0.22
PF03748FliL 0.22
PF13344Hydrolase_6 0.22
PF11453DUF2950 0.22
PF08299Bac_DnaA_C 0.22
PF02683DsbD 0.22
PF13692Glyco_trans_1_4 0.22
PF02784Orn_Arg_deC_N 0.22
PF13187Fer4_9 0.22
PF01175Urocanase 0.22
PF00988CPSase_sm_chain 0.22
PF13181TPR_8 0.22
PF00330Aconitase 0.22
PF17147PFOR_II 0.22
PF00166Cpn10 0.22
PF01726LexA_DNA_bind 0.22
PF13450NAD_binding_8 0.22
PF13511DUF4124 0.22
PF00753Lactamase_B 0.22
PF00905Transpeptidase 0.22
PF01139RtcB 0.22
PF01977UbiD 0.22
PF00483NTP_transferase 0.22
PF03699UPF0182 0.22
PF01137RTC 0.22
PF02018CBM_4_9 0.22
PF00977His_biosynth 0.22
PF01464SLT 0.22
PF05947T6SS_TssF 0.22
PF06835LptC 0.22
PF04020Phage_holin_4_2 0.22
PF030614HBT 0.22
PF02581TMP-TENI 0.22
PF00425Chorismate_bind 0.22
PF00294PfkB 0.22
PF01790LGT 0.22
PF00496SBP_bac_5 0.22
PF01321Creatinase_N 0.22
PF0563523S_rRNA_IVP 0.22
PF01106NifU 0.22
PF15892BNR_4 0.22
PF04358DsrC 0.22
PF00092VWA 0.22
PF01116F_bP_aldolase 0.22
PF00521DNA_topoisoIV 0.22
PF16124RecQ_Zn_bind 0.22
PF13589HATPase_c_3 0.22
PF09084NMT1 0.22
PF13307Helicase_C_2 0.22
PF13207AAA_17 0.22
PF13177DNA_pol3_delta2 0.22
PF03739LptF_LptG 0.22
PF13189Cytidylate_kin2 0.22
PF08340DUF1732 0.22
PF028262-Hacid_dh_C 0.22
PF06050HGD-D 0.22

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 461 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.30
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.08
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.87
COG0129Dihydroxyacid dehydratase/phosphogluconate dehydrataseCarbohydrate transport and metabolism [G] 0.87
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 0.87
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.87
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.87
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.65
COG1979Alcohol dehydrogenase YqhD, Fe-dependent ADH familyEnergy production and conversion [C] 0.65
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.65
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 0.65
COG0138AICAR transformylase/IMP cyclohydrolase PurHNucleotide transport and metabolism [F] 0.65
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.65
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.65
COG03373-dehydroquinate synthetaseAmino acid transport and metabolism [E] 0.65
COG0371Glycerol dehydrogenase or related enzyme, iron-containing ADH familyEnergy production and conversion [C] 0.65
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.65
COG0760Peptidyl-prolyl isomerase, parvulin familyPosttranslational modification, protein turnover, chaperones [O] 0.65
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 0.65
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.65
COG1014Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunitEnergy production and conversion [C] 0.65
COG1454Alcohol dehydrogenase, class IVEnergy production and conversion [C] 0.65
COG1968Undecaprenyl pyrophosphate phosphataseLipid transport and metabolism [I] 0.43
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.43
COG2269Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)Translation, ribosomal structure and biogenesis [J] 0.43
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.43
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.43
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 0.43
COG3246Uncharacterized conserved protein, DUF849 familyFunction unknown [S] 0.43
COG3293TransposaseMobilome: prophages, transposons [X] 0.43
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.43
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.43
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 0.43
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.43
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.43
COG5421TransposaseMobilome: prophages, transposons [X] 0.43
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.43
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.43
COG0017Aspartyl/asparaginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.43
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.43
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.43
COG0147Anthranilate/para-aminobenzoate synthases component IAmino acid transport and metabolism [E] 0.43
COG0173Aspartyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.43
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 0.43
COG0407Uroporphyrinogen-III decarboxylase HemECoenzyme transport and metabolism [H] 0.43
COG0458Carbamoylphosphate synthase large subunitAmino acid transport and metabolism [E] 0.43
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 0.43
COG0505Carbamoylphosphate synthase small subunitAmino acid transport and metabolism [E] 0.43
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 0.43
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.43
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.43
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.43
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 0.43
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.43
COG1190Lysyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.43
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.43
COG1508DNA-directed RNA polymerase specialized sigma subunit, sigma54 homologTranscription [K] 0.43
COG1721Uncharacterized conserved protein, DUF58 family, contains vWF domainFunction unknown [S] 0.22
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.22
COG1749Flagellar hook protein FlgECell motility [N] 0.22
COG1763Molybdopterin-guanine dinucleotide biosynthesis proteinCoenzyme transport and metabolism [H] 0.22
COG1774Cell fate regulator YaaT, PSP1 superfamily (controls sporulation, competence, biofilm development)Signal transduction mechanisms [T] 0.22
COG1775Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdBAmino acid transport and metabolism [E] 0.22
COG1784TctA family transporterGeneral function prediction only [R] 0.22
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.22
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.22
COG1912Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)Defense mechanisms [V] 0.22
COG1950Uncharacterized membrane protein YvlD, DUF360 familyFunction unknown [S] 0.22
COG2006Uncharacterized conserved protein, DUF362 familyFunction unknown [S] 0.22
COG2031Short chain fatty acids transporterLipid transport and metabolism [I] 0.22
COG2043Uncharacterized conserved protein, DUF169 familyFunction unknown [S] 0.22
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 0.22
COG20495-oxoprolinase subunit B/Allophanate hydrolase subunit 1Amino acid transport and metabolism [E] 0.22
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 0.22
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.22
COG2148Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid)Cell wall/membrane/envelope biogenesis [M] 0.22
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.22
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.22
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 0.22
COG2721Altronate dehydrataseCarbohydrate transport and metabolism [G] 0.22
COG2848Uncharacterized conserved protein, UPF0210 familyCell cycle control, cell division, chromosome partitioning [D] 0.22
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.22
COG2920Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C)Translation, ribosomal structure and biogenesis [J] 0.22
COG2978p-Aminobenzoyl-glutamate transporter AbgTCoenzyme transport and metabolism [H] 0.22
COG2987Urocanate hydrataseAmino acid transport and metabolism [E] 0.22
COG3123Pyrimidine/purine nucleoside phosphorylase YaiE/PpnP, UPF0345/DUF1255 familyNucleotide transport and metabolism [F] 0.22
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.22
COG3333TctA family transporterGeneral function prediction only [R] 0.22
COG3519Type VI protein secretion system component VasAIntracellular trafficking, secretion, and vesicular transport [U] 0.22
COG3549Plasmid maintenance system killer proteinDefense mechanisms [V] 0.22
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.22
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 0.22
COG3973DNA helicase IVReplication, recombination and repair [L] 0.22
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.22
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.22
COG4786Flagellar basal body rod protein FlgGCell motility [N] 0.22
COG4787Flagellar basal body rod protein FlgFCell motility [N] 0.22
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.22
COG4887Uncharacterized metal-binding protein MJ0455, DUF1847 familyFunction unknown [S] 0.22
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.22
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 0.22
COG0019Diaminopimelate decarboxylaseAmino acid transport and metabolism [E] 0.22
COG0026Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)Nucleotide transport and metabolism [F] 0.22
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.22
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 0.22
COG0045Succinyl-CoA synthetase, beta subunitEnergy production and conversion [C] 0.22
COG0049Ribosomal protein S7Translation, ribosomal structure and biogenesis [J] 0.22
COG0124Histidyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.22
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.22
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.22
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.22
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.22
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.22
COG0191Fructose/tagatose bisphosphate aldolaseCarbohydrate transport and metabolism [G] 0.22
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.22
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.22
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 0.22
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 0.22
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.22
COG0237Dephospho-CoA kinaseCoenzyme transport and metabolism [H] 0.22
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 0.22
COG027516S rRNA C1402 N4-methylase RsmHTranslation, ribosomal structure and biogenesis [J] 0.22
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.22
COG0314Molybdopterin synthase catalytic subunit MoaECoenzyme transport and metabolism [H] 0.22
COG0343Queuine/archaeosine tRNA-ribosyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.22
COG0352Thiamine monophosphate synthaseCoenzyme transport and metabolism [H] 0.22
COG03636-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminaseCarbohydrate transport and metabolism [G] 0.22
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.22
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.22
COG0403Glycine cleavage system protein P (pyridoxal-binding), N-terminal domainAmino acid transport and metabolism [E] 0.22
COG0423Glycyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.22
COG0430RNA 3'-terminal phosphate cyclaseRNA processing and modification [A] 0.22
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.22
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.22
COG0442Prolyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.22
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 0.22
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.22
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.22
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.22
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.22
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.22
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.22
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.22
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 0.22
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.22
COG0619ECF-type transporter transmembrane protein EcfTCoenzyme transport and metabolism [H] 0.22
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.22
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.22
COG0694Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domainPosttranslational modification, protein turnover, chaperones [O] 0.22
COG0698Ribose 5-phosphate isomerase RpiBCarbohydrate transport and metabolism [G] 0.22
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.22
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.22
COG0767Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.22
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.22
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.22
COG0795Lipopolysaccharide export LptBFGC system, permease protein LptFCell wall/membrane/envelope biogenesis [M] 0.22
COG0817Holliday junction resolvasome RuvABC endonuclease subunit RuvCReplication, recombination and repair [L] 0.22
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.22
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.22
COG1042Acyl-CoA synthetase (NDP forming)Energy production and conversion [C] 0.22
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.22
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.22
COG1166Arginine decarboxylase (spermidine biosynthesis)Amino acid transport and metabolism [E] 0.22
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.22
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.22
COG1256Flagellar hook-associated protein FlgKCell motility [N] 0.22
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.22
COG1371Archease, activates RNA ligation by RtcB (tRNA splicing)Translation, ribosomal structure and biogenesis [J] 0.22
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.22
COG1549Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domainsTranslation, ribosomal structure and biogenesis [J] 0.22
COG1558Flagellar basal body rod protein FlgCCell motility [N] 0.22
COG1561Endoribonuclease YloC, YicC familyTranslation, ribosomal structure and biogenesis [J] 0.22
COG1580Flagellar basal body-associated protein FliLCell motility [N] 0.22
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.22
COG1615Uncharacterized membrane protein, UPF0182 familyFunction unknown [S] 0.22
COG1690RNA-splicing ligase RtcB, repairs tRNA damageTranslation, ribosomal structure and biogenesis [J] 0.22


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.96 %
UnclassifiedrootN/A21.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000231|TB_LI09_4DRAFT_10030053All Organisms → cellular organisms → Bacteria2386Open in IMG/M
3300000231|TB_LI09_4DRAFT_10078769All Organisms → cellular organisms → Bacteria → Proteobacteria1269Open in IMG/M
3300000231|TB_LI09_4DRAFT_10081880All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300001213|JGIcombinedJ13530_107344742Not Available584Open in IMG/M
3300001752|JGI2173J19968_10099463Not Available848Open in IMG/M
3300002053|SMTZ23_10021601All Organisms → cellular organisms → Bacteria15470Open in IMG/M
3300002961|JGI11641J44799_10092293Not Available852Open in IMG/M
3300003432|JGI20214J51088_10320143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1055Open in IMG/M
3300003861|Ga0031654_10116444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300003861|Ga0031654_10122974All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium730Open in IMG/M
3300003993|Ga0055468_10161458All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300004282|Ga0066599_100920582Not Available628Open in IMG/M
3300004481|Ga0069718_10117812All Organisms → cellular organisms → Bacteria7227Open in IMG/M
3300004481|Ga0069718_15992716All Organisms → cellular organisms → Bacteria → Proteobacteria4761Open in IMG/M
3300004481|Ga0069718_16175596All Organisms → cellular organisms → Bacteria1133Open in IMG/M
3300004481|Ga0069718_16375666Not Available1053Open in IMG/M
3300005144|Ga0068711_1028439All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus1446Open in IMG/M
3300005144|Ga0068711_1047348All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus993Open in IMG/M
3300005833|Ga0074472_10292964All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300005833|Ga0074472_10618164Not Available617Open in IMG/M
3300005833|Ga0074472_11224627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300006224|Ga0079037_100000346All Organisms → cellular organisms → Bacteria20074Open in IMG/M
3300006224|Ga0079037_100001262All Organisms → cellular organisms → Bacteria12983Open in IMG/M
3300006224|Ga0079037_100003590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales8942Open in IMG/M
3300006224|Ga0079037_100013256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5499Open in IMG/M
3300006224|Ga0079037_100033712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3821Open in IMG/M
3300006224|Ga0079037_100071893All Organisms → cellular organisms → Bacteria2802Open in IMG/M
3300006224|Ga0079037_100189598All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1836Open in IMG/M
3300006224|Ga0079037_100214835Not Available1736Open in IMG/M
3300006224|Ga0079037_100611350All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300006224|Ga0079037_100677473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1006Open in IMG/M
3300006224|Ga0079037_100709946Not Available982Open in IMG/M
3300006224|Ga0079037_100960406Not Available844Open in IMG/M
3300006224|Ga0079037_101239070All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300006224|Ga0079037_101824586Not Available608Open in IMG/M
3300006930|Ga0079303_10007863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3097Open in IMG/M
3300006930|Ga0079303_10100406All Organisms → cellular organisms → Bacteria1091Open in IMG/M
3300006930|Ga0079303_10431640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300009009|Ga0105105_10252617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium935Open in IMG/M
3300009009|Ga0105105_10319625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium844Open in IMG/M
3300009009|Ga0105105_10482781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria705Open in IMG/M
3300009037|Ga0105093_10067317All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300009037|Ga0105093_10224292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria975Open in IMG/M
3300009053|Ga0105095_10225980All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium1026Open in IMG/M
3300009053|Ga0105095_10243083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Selenomonadales → Sporomusaceae → Sporolituus → Sporolituus thermophilus987Open in IMG/M
3300009053|Ga0105095_10641288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria592Open in IMG/M
3300009075|Ga0105090_10207256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1213Open in IMG/M
3300009075|Ga0105090_10312105All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300009075|Ga0105090_10321256Not Available947Open in IMG/M
3300009075|Ga0105090_10604398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_51_10666Open in IMG/M
3300009075|Ga0105090_11000810All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300009078|Ga0105106_10008691All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria7326Open in IMG/M
3300009078|Ga0105106_10016330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales5433Open in IMG/M
3300009078|Ga0105106_10023377All Organisms → cellular organisms → Bacteria4557Open in IMG/M
3300009078|Ga0105106_10024888All Organisms → cellular organisms → Bacteria4416Open in IMG/M
3300009078|Ga0105106_10027637All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4191Open in IMG/M
3300009078|Ga0105106_10036462All Organisms → cellular organisms → Bacteria3643Open in IMG/M
3300009078|Ga0105106_10060552All Organisms → cellular organisms → Bacteria2790Open in IMG/M
3300009078|Ga0105106_10102953All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2102Open in IMG/M
3300009078|Ga0105106_10109331All Organisms → cellular organisms → Bacteria2033Open in IMG/M
3300009078|Ga0105106_10209447All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus gentianae1421Open in IMG/M
3300009078|Ga0105106_10235936All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300009078|Ga0105106_10321554All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300009078|Ga0105106_10336532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1091Open in IMG/M
3300009078|Ga0105106_10773296All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300009078|Ga0105106_10956070Not Available609Open in IMG/M
3300009078|Ga0105106_10995119Not Available596Open in IMG/M
3300009081|Ga0105098_10035744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1971Open in IMG/M
3300009081|Ga0105098_10098166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1261Open in IMG/M
3300009081|Ga0105098_10107127All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1213Open in IMG/M
3300009081|Ga0105098_10109333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1202Open in IMG/M
3300009081|Ga0105098_10126892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_111126Open in IMG/M
3300009081|Ga0105098_10302898All Organisms → cellular organisms → Bacteria → Proteobacteria768Open in IMG/M
3300009085|Ga0105103_10045678All Organisms → cellular organisms → Bacteria2204Open in IMG/M
3300009085|Ga0105103_10051590All Organisms → cellular organisms → Bacteria2079Open in IMG/M
3300009085|Ga0105103_10075724All Organisms → cellular organisms → Bacteria1725Open in IMG/M
3300009085|Ga0105103_10117979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1389Open in IMG/M
3300009085|Ga0105103_10133355All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300009085|Ga0105103_10276561All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium911Open in IMG/M
3300009085|Ga0105103_10282763All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300009085|Ga0105103_10677905Not Available591Open in IMG/M
3300009087|Ga0105107_10046063All Organisms → cellular organisms → Bacteria3085Open in IMG/M
3300009087|Ga0105107_10078524Not Available2327Open in IMG/M
3300009087|Ga0105107_10468527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium878Open in IMG/M
3300009087|Ga0105107_10732547All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria688Open in IMG/M
3300009091|Ga0102851_10024597All Organisms → cellular organisms → Bacteria4497Open in IMG/M
3300009091|Ga0102851_10107354All Organisms → cellular organisms → Bacteria2437Open in IMG/M
3300009091|Ga0102851_10205081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1852Open in IMG/M
3300009091|Ga0102851_10510488All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300009091|Ga0102851_11256164All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300009091|Ga0102851_11434052All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300009091|Ga0102851_11666732All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300009091|Ga0102851_11873180All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300009091|Ga0102851_13253516All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300009091|Ga0102851_13274582Not Available520Open in IMG/M
3300009111|Ga0115026_10003348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5988Open in IMG/M
3300009111|Ga0115026_10124744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales1616Open in IMG/M
3300009111|Ga0115026_10247423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1219Open in IMG/M
3300009111|Ga0115026_10480028All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300009111|Ga0115026_11542434All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300009111|Ga0115026_11838239Not Available514Open in IMG/M
3300009131|Ga0115027_10249062All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1165Open in IMG/M
3300009131|Ga0115027_10551466All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300009131|Ga0115027_11193512All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300009131|Ga0115027_11377694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria573Open in IMG/M
3300009146|Ga0105091_10194221All Organisms → cellular organisms → Bacteria → Proteobacteria965Open in IMG/M
3300009146|Ga0105091_10345793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium733Open in IMG/M
3300009153|Ga0105094_10059000All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_232134Open in IMG/M
3300009153|Ga0105094_10081935All Organisms → cellular organisms → Bacteria1809Open in IMG/M
3300009153|Ga0105094_10105852All Organisms → cellular organisms → Bacteria1589Open in IMG/M
3300009153|Ga0105094_10120429All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300009153|Ga0105094_10121220All Organisms → cellular organisms → Bacteria1483Open in IMG/M
3300009153|Ga0105094_10157935All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300009153|Ga0105094_10308193All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300009153|Ga0105094_10436712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium759Open in IMG/M
3300009153|Ga0105094_10778943Not Available562Open in IMG/M
3300009165|Ga0105102_10112653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_111289Open in IMG/M
3300009165|Ga0105102_10287283Not Available848Open in IMG/M
3300009165|Ga0105102_10908893Not Available508Open in IMG/M
3300009166|Ga0105100_10090207All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1796Open in IMG/M
3300009166|Ga0105100_10102955Not Available1678Open in IMG/M
3300009166|Ga0105100_10126791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium1508Open in IMG/M
3300009166|Ga0105100_10237717All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont1088Open in IMG/M
3300009166|Ga0105100_10394368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium837Open in IMG/M
3300009166|Ga0105100_10753457Not Available602Open in IMG/M
3300009166|Ga0105100_10800090All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300009167|Ga0113563_10055760All Organisms → cellular organisms → Bacteria3371Open in IMG/M
3300009167|Ga0113563_10233852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1856Open in IMG/M
3300009167|Ga0113563_10360377Not Available1535Open in IMG/M
3300009167|Ga0113563_11153213All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300009167|Ga0113563_11379492All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria827Open in IMG/M
3300009167|Ga0113563_11584305Not Available774Open in IMG/M
3300009167|Ga0113563_12257467All Organisms → cellular organisms → Bacteria → Proteobacteria654Open in IMG/M
3300009167|Ga0113563_13941871All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300009168|Ga0105104_10432088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca735Open in IMG/M
3300009169|Ga0105097_10007371All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5623Open in IMG/M
3300009169|Ga0105097_10007497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5575Open in IMG/M
3300009169|Ga0105097_10023134All Organisms → cellular organisms → Bacteria3294Open in IMG/M
3300009169|Ga0105097_10032295All Organisms → cellular organisms → Bacteria2795Open in IMG/M
3300009169|Ga0105097_10034289All Organisms → cellular organisms → Bacteria2715Open in IMG/M
3300009171|Ga0105101_10017580All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae3440Open in IMG/M
3300009171|Ga0105101_10253433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales850Open in IMG/M
3300009171|Ga0105101_10484444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300009179|Ga0115028_10409908All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria955Open in IMG/M
3300009179|Ga0115028_10413208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria952Open in IMG/M
3300009179|Ga0115028_10694456Not Available776Open in IMG/M
3300009430|Ga0114938_1328361All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300009771|Ga0116155_10340617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300011340|Ga0151652_12680331Not Available963Open in IMG/M
3300011340|Ga0151652_13769954All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10811Open in IMG/M
3300011340|Ga0151652_13787834All Organisms → cellular organisms → Bacteria → Proteobacteria858Open in IMG/M
3300012964|Ga0153916_12852838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria545Open in IMG/M
3300014314|Ga0075316_1205556Not Available521Open in IMG/M
3300017966|Ga0187776_10580028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria778Open in IMG/M
3300018029|Ga0187787_10406726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria538Open in IMG/M
3300018055|Ga0184616_10306529Not Available601Open in IMG/M
3300018059|Ga0184615_10571625Not Available595Open in IMG/M
3300018059|Ga0184615_10612565Not Available566Open in IMG/M
3300018064|Ga0187773_10743462Not Available617Open in IMG/M
3300018068|Ga0184636_1098445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1000Open in IMG/M
3300018068|Ga0184636_1200300All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300018070|Ga0184631_10073790Not Available1291Open in IMG/M
3300020074|Ga0194113_10000045All Organisms → cellular organisms → Bacteria115301Open in IMG/M
3300020074|Ga0194113_10000096All Organisms → cellular organisms → Bacteria92254Open in IMG/M
3300020074|Ga0194113_10000324All Organisms → cellular organisms → Bacteria → Proteobacteria60891Open in IMG/M
3300020172|Ga0211729_11162592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300022208|Ga0224495_10041382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halanaerobium → Halanaerobium saccharolyticum2123Open in IMG/M
(restricted) 3300024054|Ga0233425_10315050Not Available688Open in IMG/M
3300025174|Ga0209324_10030415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3712Open in IMG/M
3300025174|Ga0209324_10600755All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300025314|Ga0209323_10085822All Organisms → cellular organisms → Bacteria2138Open in IMG/M
3300025967|Ga0210136_1076872All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300027051|Ga0209269_1067596All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300027051|Ga0209269_1073508All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300027693|Ga0209704_1256600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria511Open in IMG/M
3300027713|Ga0209286_1298893Not Available561Open in IMG/M
3300027713|Ga0209286_1336723All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_11520Open in IMG/M
3300027715|Ga0208665_10194148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria639Open in IMG/M
3300027721|Ga0209492_1004497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4514Open in IMG/M
3300027721|Ga0209492_1012060All Organisms → cellular organisms → Bacteria → Proteobacteria2900Open in IMG/M
3300027721|Ga0209492_1028584All Organisms → cellular organisms → Bacteria1934Open in IMG/M
3300027721|Ga0209492_1032624All Organisms → cellular organisms → Bacteria1815Open in IMG/M
3300027721|Ga0209492_1046865All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1522Open in IMG/M
3300027721|Ga0209492_1052729All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium1434Open in IMG/M
3300027721|Ga0209492_1062599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium1314Open in IMG/M
3300027721|Ga0209492_1065119All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300027721|Ga0209492_1133678Not Available869Open in IMG/M
3300027721|Ga0209492_1146401All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300027721|Ga0209492_1197189Not Available692Open in IMG/M
3300027721|Ga0209492_1211871All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300027721|Ga0209492_1231841All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300027721|Ga0209492_1293878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300027726|Ga0209285_10027401All Organisms → cellular organisms → Bacteria1639Open in IMG/M
3300027726|Ga0209285_10059850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1135Open in IMG/M
3300027726|Ga0209285_10092733Not Available917Open in IMG/M
3300027726|Ga0209285_10114165All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300027740|Ga0214474_1013812All Organisms → cellular organisms → Bacteria3222Open in IMG/M
3300027740|Ga0214474_1182355All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300027811|Ga0256868_10002426All Organisms → cellular organisms → Bacteria9716Open in IMG/M
3300027818|Ga0209706_10040910All Organisms → cellular organisms → Bacteria2342Open in IMG/M
3300027818|Ga0209706_10044647All Organisms → cellular organisms → Bacteria2238Open in IMG/M
3300027818|Ga0209706_10056628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1971Open in IMG/M
3300027818|Ga0209706_10079739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium RBG_13_46_81637Open in IMG/M
3300027818|Ga0209706_10085373All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium1576Open in IMG/M
3300027818|Ga0209706_10160805Not Available1101Open in IMG/M
3300027818|Ga0209706_10167599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1075Open in IMG/M
3300027818|Ga0209706_10264787Not Available821Open in IMG/M
3300027818|Ga0209706_10406016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium633Open in IMG/M
3300027841|Ga0209262_10546891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300027877|Ga0209293_10109257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1264Open in IMG/M
3300027877|Ga0209293_10623634All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300027877|Ga0209293_10757798All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300027887|Ga0208980_10483427All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300027888|Ga0209635_10021322All Organisms → cellular organisms → Bacteria5202Open in IMG/M
3300027890|Ga0209496_10156098All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300027890|Ga0209496_10238474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium884Open in IMG/M
3300027890|Ga0209496_10503656All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300027897|Ga0209254_10016095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6845Open in IMG/M
3300027897|Ga0209254_10046333All Organisms → cellular organisms → Bacteria → Proteobacteria3815Open in IMG/M
3300027897|Ga0209254_10047599All Organisms → cellular organisms → Bacteria3757Open in IMG/M
3300027897|Ga0209254_10069105All Organisms → cellular organisms → Bacteria3027Open in IMG/M
3300027897|Ga0209254_10074569All Organisms → cellular organisms → Bacteria2893Open in IMG/M
3300027897|Ga0209254_10076166All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2859Open in IMG/M
3300027897|Ga0209254_10077613All Organisms → cellular organisms → Bacteria2828Open in IMG/M
3300027897|Ga0209254_10093582All Organisms → cellular organisms → Bacteria → Proteobacteria2533Open in IMG/M
3300027897|Ga0209254_10136710All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.BinA3642021Open in IMG/M
3300027897|Ga0209254_10413450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium997Open in IMG/M
3300027897|Ga0209254_10566946Not Available807Open in IMG/M
3300027897|Ga0209254_10756773Not Available663Open in IMG/M
3300027899|Ga0209668_10226193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1175Open in IMG/M
3300027899|Ga0209668_10862432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300027900|Ga0209253_10014816All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini6646Open in IMG/M
3300027900|Ga0209253_10135135All Organisms → cellular organisms → Bacteria → Proteobacteria2005Open in IMG/M
3300027900|Ga0209253_10238058Not Available1438Open in IMG/M
3300027900|Ga0209253_10238776Not Available1435Open in IMG/M
3300027900|Ga0209253_10561139All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium843Open in IMG/M
3300027901|Ga0209427_10022990All Organisms → cellular organisms → Bacteria6460Open in IMG/M
3300027901|Ga0209427_10078076All Organisms → cellular organisms → Bacteria3026Open in IMG/M
3300027901|Ga0209427_10477482Not Available945Open in IMG/M
3300027902|Ga0209048_10004117All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria13961Open in IMG/M
3300027902|Ga0209048_10011446All Organisms → cellular organisms → Bacteria → Proteobacteria7945Open in IMG/M
3300027902|Ga0209048_10012606All Organisms → cellular organisms → Bacteria7534Open in IMG/M
3300027902|Ga0209048_10015722All Organisms → cellular organisms → Bacteria → Proteobacteria6661Open in IMG/M
3300027902|Ga0209048_10022944All Organisms → cellular organisms → Bacteria5387Open in IMG/M
3300027902|Ga0209048_10022963All Organisms → cellular organisms → Bacteria5384Open in IMG/M
3300027902|Ga0209048_10042590All Organisms → cellular organisms → Bacteria3759Open in IMG/M
3300027902|Ga0209048_10048245All Organisms → cellular organisms → Bacteria3492Open in IMG/M
3300027902|Ga0209048_10052838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3302Open in IMG/M
3300027902|Ga0209048_10055272All Organisms → cellular organisms → Bacteria3216Open in IMG/M
3300027902|Ga0209048_10060762All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3037Open in IMG/M
3300027902|Ga0209048_10062271All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2992Open in IMG/M
3300027902|Ga0209048_10077804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2607Open in IMG/M
3300027902|Ga0209048_10081249All Organisms → cellular organisms → Bacteria2539Open in IMG/M
3300027902|Ga0209048_10263145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1223Open in IMG/M
3300027902|Ga0209048_10284601All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300027902|Ga0209048_10347630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → unclassified Syntrophobacterales → Syntrophobacterales bacterium1028Open in IMG/M
3300027902|Ga0209048_10361860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1003Open in IMG/M
3300027902|Ga0209048_10400737Not Available942Open in IMG/M
3300027902|Ga0209048_10450553All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria876Open in IMG/M
3300027902|Ga0209048_10538360All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria785Open in IMG/M
3300027902|Ga0209048_10648270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)700Open in IMG/M
3300027902|Ga0209048_10789754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium620Open in IMG/M
3300027902|Ga0209048_10792601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300027902|Ga0209048_10839413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium597Open in IMG/M
3300027902|Ga0209048_10938196Not Available556Open in IMG/M
3300027956|Ga0209820_1078679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium886Open in IMG/M
3300027979|Ga0209705_10042116All Organisms → cellular organisms → Bacteria2529Open in IMG/M
3300027979|Ga0209705_10064460All Organisms → cellular organisms → Bacteria2014Open in IMG/M
3300027979|Ga0209705_10124188All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300027979|Ga0209705_10207015All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300030613|Ga0299915_10538988All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300031746|Ga0315293_10457994All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria993Open in IMG/M
3300031746|Ga0315293_10978319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300031746|Ga0315293_11253636All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300031772|Ga0315288_10699815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria956Open in IMG/M
3300031834|Ga0315290_10034403All Organisms → cellular organisms → Bacteria4036Open in IMG/M
3300031834|Ga0315290_10166002All Organisms → cellular organisms → Bacteria1906Open in IMG/M
3300031834|Ga0315290_10176828Not Available1847Open in IMG/M
3300031834|Ga0315290_10630959All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium928Open in IMG/M
3300031834|Ga0315290_10718828Not Available860Open in IMG/M
3300031873|Ga0315297_10097996Not Available2319Open in IMG/M
3300031873|Ga0315297_10173724All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1763Open in IMG/M
3300031873|Ga0315297_10184725All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1710Open in IMG/M
3300031873|Ga0315297_10282527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_19FT_COMBO_52_111381Open in IMG/M
3300031873|Ga0315297_10617503All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium910Open in IMG/M
3300031873|Ga0315297_10659022Not Available877Open in IMG/M
3300031949|Ga0214473_10037359All Organisms → cellular organisms → Bacteria5703Open in IMG/M
3300031949|Ga0214473_10227628All Organisms → cellular organisms → Bacteria2150Open in IMG/M
3300031949|Ga0214473_10303828All Organisms → cellular organisms → Bacteria → Proteobacteria1822Open in IMG/M
3300031949|Ga0214473_10896222All Organisms → cellular organisms → Bacteria → Proteobacteria946Open in IMG/M
3300031949|Ga0214473_10962265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria905Open in IMG/M
3300031952|Ga0315294_11040807Not Available679Open in IMG/M
3300031952|Ga0315294_11317610All Organisms → cellular organisms → Bacteria → Proteobacteria577Open in IMG/M
3300031997|Ga0315278_10049215All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4124Open in IMG/M
3300031997|Ga0315278_10183561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia2148Open in IMG/M
3300031997|Ga0315278_10266088All Organisms → cellular organisms → Bacteria1770Open in IMG/M
3300031997|Ga0315278_10631097All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1094Open in IMG/M
3300031999|Ga0315274_10325179All Organisms → cellular organisms → Bacteria1822Open in IMG/M
3300031999|Ga0315274_10754406All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1041Open in IMG/M
3300031999|Ga0315274_10789782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium1009Open in IMG/M
3300032020|Ga0315296_10175557All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1300Open in IMG/M
3300032020|Ga0315296_10432985All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300032046|Ga0315289_10529340All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300032053|Ga0315284_10261477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2200Open in IMG/M
3300032053|Ga0315284_10379079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1752Open in IMG/M
3300032053|Ga0315284_10481707Not Available1510Open in IMG/M
3300032053|Ga0315284_10652830All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1245Open in IMG/M
3300032053|Ga0315284_11273690All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria800Open in IMG/M
3300032053|Ga0315284_11585194All Organisms → cellular organisms → Bacteria → Proteobacteria689Open in IMG/M
3300032070|Ga0315279_10052987All Organisms → cellular organisms → Bacteria → Proteobacteria3825Open in IMG/M
3300032070|Ga0315279_10855953Not Available526Open in IMG/M
3300032143|Ga0315292_10073351All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter2608Open in IMG/M
3300032143|Ga0315292_10124913All Organisms → cellular organisms → Bacteria2039Open in IMG/M
3300032143|Ga0315292_11454398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23556Open in IMG/M
3300032156|Ga0315295_10082631All Organisms → cellular organisms → Bacteria3096Open in IMG/M
3300032156|Ga0315295_10535507Not Available1190Open in IMG/M
3300032156|Ga0315295_10584585All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1132Open in IMG/M
3300032156|Ga0315295_10869555Not Available901Open in IMG/M
3300032156|Ga0315295_11221423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia736Open in IMG/M
3300032164|Ga0315283_12033611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300032177|Ga0315276_10168951All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2281Open in IMG/M
3300032177|Ga0315276_10392962All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1484Open in IMG/M
3300032177|Ga0315276_11273823All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300032177|Ga0315276_12110796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300032177|Ga0315276_12185888All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300032342|Ga0315286_10065385All Organisms → cellular organisms → Bacteria3863Open in IMG/M
3300032342|Ga0315286_11482985All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300032397|Ga0315287_10306456All Organisms → cellular organisms → Bacteria1872Open in IMG/M
3300032397|Ga0315287_11040051All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300032397|Ga0315287_12261066Not Available591Open in IMG/M
3300032397|Ga0315287_12509344All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria553Open in IMG/M
3300032401|Ga0315275_10148735All Organisms → cellular organisms → Bacteria2597Open in IMG/M
3300032401|Ga0315275_10209995Not Available2171Open in IMG/M
3300032401|Ga0315275_10633050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1193Open in IMG/M
3300032401|Ga0315275_10784433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1057Open in IMG/M
3300032401|Ga0315275_11162423All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300032401|Ga0315275_11576634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria703Open in IMG/M
3300032401|Ga0315275_12020344Not Available607Open in IMG/M
3300032401|Ga0315275_12678473Not Available513Open in IMG/M
3300032516|Ga0315273_10226246All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2552Open in IMG/M
3300032516|Ga0315273_10313731All Organisms → cellular organisms → Bacteria2127Open in IMG/M
3300032516|Ga0315273_10325352All Organisms → cellular organisms → Bacteria2084Open in IMG/M
3300032516|Ga0315273_10334773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2051Open in IMG/M
3300032516|Ga0315273_10381167All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Coleoptera → Polyphaga → Cucujiformia → Curculionoidea → Curculionidae → Entiminae → Celeuthetini → Syntrophus1903Open in IMG/M
3300032516|Ga0315273_10571126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1504Open in IMG/M
3300032516|Ga0315273_10649221All Organisms → cellular organisms → Bacteria1394Open in IMG/M
3300032516|Ga0315273_11358464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria883Open in IMG/M
3300032516|Ga0315273_11367956Not Available879Open in IMG/M
3300032516|Ga0315273_12291263Not Available630Open in IMG/M
3300032516|Ga0315273_13045025Not Available523Open in IMG/M
3300033406|Ga0316604_10019623All Organisms → cellular organisms → Bacteria3545Open in IMG/M
3300033406|Ga0316604_10043616All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales2304Open in IMG/M
3300033406|Ga0316604_10676337All Organisms → cellular organisms → Bacteria → Proteobacteria567Open in IMG/M
3300033408|Ga0316605_10037073All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3324Open in IMG/M
3300033408|Ga0316605_10059347All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2757Open in IMG/M
3300033408|Ga0316605_10247818All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales1532Open in IMG/M
3300033408|Ga0316605_10375092Not Available1276Open in IMG/M
3300033408|Ga0316605_10514915Not Available1104Open in IMG/M
3300033408|Ga0316605_10575631All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300033408|Ga0316605_10643182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria995Open in IMG/M
3300033408|Ga0316605_10959125All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria820Open in IMG/M
3300033408|Ga0316605_11351074All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300033408|Ga0316605_12077487All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300033413|Ga0316603_10094725All Organisms → cellular organisms → Bacteria2340Open in IMG/M
3300033413|Ga0316603_10382722All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300033413|Ga0316603_10412005All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1224Open in IMG/M
3300033413|Ga0316603_10759167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales909Open in IMG/M
3300033413|Ga0316603_11236323Not Available707Open in IMG/M
3300033413|Ga0316603_11736088Not Available591Open in IMG/M
3300033413|Ga0316603_11932136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300033413|Ga0316603_12195587Not Available521Open in IMG/M
3300033414|Ga0316619_10138054All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1650Open in IMG/M
3300033414|Ga0316619_10467855All Organisms → cellular organisms → Bacteria1018Open in IMG/M
3300033414|Ga0316619_10569286All Organisms → cellular organisms → Bacteria936Open in IMG/M
3300033414|Ga0316619_11094352Not Available699Open in IMG/M
3300033414|Ga0316619_11106014Not Available695Open in IMG/M
3300033414|Ga0316619_11933719All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300033416|Ga0316622_100249431All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1925Open in IMG/M
3300033418|Ga0316625_100132596Not Available1495Open in IMG/M
3300033418|Ga0316625_101047509All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300033418|Ga0316625_101067067All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300033419|Ga0316601_100005257All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria7254Open in IMG/M
3300033419|Ga0316601_100440265Not Available1236Open in IMG/M
3300033419|Ga0316601_101140706Not Available781Open in IMG/M
3300033419|Ga0316601_101825493Not Available613Open in IMG/M
3300033419|Ga0316601_102601353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes508Open in IMG/M
3300033433|Ga0326726_10093852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → Syntrophobacter fumaroxidans2676Open in IMG/M
3300033433|Ga0326726_10352773Not Available1389Open in IMG/M
3300033433|Ga0326726_10426162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae1261Open in IMG/M
3300033433|Ga0326726_11107254All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria770Open in IMG/M
3300033433|Ga0326726_11859590All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300033434|Ga0316613_10301014Not Available1061Open in IMG/M
3300033480|Ga0316620_10210797Not Available1629Open in IMG/M
3300033480|Ga0316620_10500189Not Available1123Open in IMG/M
3300033480|Ga0316620_10648815All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300033480|Ga0316620_11407919All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium687Open in IMG/M
3300033480|Ga0316620_11972074All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300033480|Ga0316620_12328589All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium533Open in IMG/M
3300033481|Ga0316600_10068031All Organisms → cellular organisms → Bacteria2067Open in IMG/M
3300033481|Ga0316600_10146490All Organisms → cellular organisms → Bacteria → Proteobacteria1495Open in IMG/M
3300033481|Ga0316600_10226368All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300033481|Ga0316600_10528372All Organisms → cellular organisms → Bacteria → Proteobacteria821Open in IMG/M
3300033481|Ga0316600_10985242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria597Open in IMG/M
3300033481|Ga0316600_11037664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae581Open in IMG/M
3300033481|Ga0316600_11201016All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium538Open in IMG/M
3300033482|Ga0316627_100393533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1186Open in IMG/M
3300033482|Ga0316627_100419319All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300033482|Ga0316627_100489197Not Available1088Open in IMG/M
3300033482|Ga0316627_101065664All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300033482|Ga0316627_101504501All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria681Open in IMG/M
3300033482|Ga0316627_101614932All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300033482|Ga0316627_102259162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria570Open in IMG/M
3300033482|Ga0316627_102906760All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300033483|Ga0316629_10202269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1262Open in IMG/M
3300033485|Ga0316626_10056543All Organisms → cellular organisms → Bacteria2701Open in IMG/M
3300033485|Ga0316626_10469464Not Available1065Open in IMG/M
3300033485|Ga0316626_10499252All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300033485|Ga0316626_10564115All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria977Open in IMG/M
3300033485|Ga0316626_10809934All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria822Open in IMG/M
3300033485|Ga0316626_10957750Not Available757Open in IMG/M
3300033485|Ga0316626_10987317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium746Open in IMG/M
3300033485|Ga0316626_10996330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium743Open in IMG/M
3300033486|Ga0316624_10307063All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Deferrisoma → Deferrisoma camini1288Open in IMG/M
3300033486|Ga0316624_11290454Not Available666Open in IMG/M
3300033486|Ga0316624_11920878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SM23_61549Open in IMG/M
3300033487|Ga0316630_10016167All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3928Open in IMG/M
3300033487|Ga0316630_10574942All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria936Open in IMG/M
3300033487|Ga0316630_10583877All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300033488|Ga0316621_10166931Not Available1337Open in IMG/M
3300033488|Ga0316621_10336825All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300033488|Ga0316621_11262758All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria560Open in IMG/M
3300033489|Ga0299912_10267858All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium1444Open in IMG/M
3300033489|Ga0299912_10388272All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300033489|Ga0299912_10456704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1036Open in IMG/M
3300033513|Ga0316628_101325745Not Available959Open in IMG/M
3300033513|Ga0316628_101458211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria912Open in IMG/M
3300033513|Ga0316628_103443486All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria572Open in IMG/M
3300033521|Ga0316616_100258807All Organisms → cellular organisms → Bacteria1801Open in IMG/M
3300033521|Ga0316616_100393168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1532Open in IMG/M
3300033521|Ga0316616_100650972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1250Open in IMG/M
3300033521|Ga0316616_101279020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium938Open in IMG/M
3300033521|Ga0316616_102066671All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria756Open in IMG/M
3300033521|Ga0316616_102940298All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300033521|Ga0316616_103322313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria606Open in IMG/M
3300033521|Ga0316616_103755970Not Available572Open in IMG/M
3300033557|Ga0316617_100004217All Organisms → cellular organisms → Bacteria → Proteobacteria5608Open in IMG/M
3300033557|Ga0316617_100665555Not Available977Open in IMG/M
3300033557|Ga0316617_101436868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28694Open in IMG/M
3300033557|Ga0316617_102119325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300033557|Ga0316617_102489243Not Available537Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment24.73%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil20.82%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment16.27%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment10.41%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands7.16%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland4.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.17%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.30%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.08%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.08%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture1.08%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.87%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.87%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.87%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.65%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.65%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater0.65%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.65%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.43%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.22%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.22%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.22%
Marine SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment0.22%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.22%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.22%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.22%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000231Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001752Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30EnvironmentalOpen in IMG/M
3300002053Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZEnvironmentalOpen in IMG/M
3300002961Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005144Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaGEngineeredOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009430Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big SpringEnvironmentalOpen in IMG/M
3300009771Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaGEngineeredOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018070Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300022208Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300024054 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MGEnvironmentalOpen in IMG/M
3300025174Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025967Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300027051Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027693Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027713Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027715Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027726Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027740Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeqEnvironmentalOpen in IMG/M
3300027811Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 HiSeqEnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027901Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032020Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TB_LI09_4DRAFT_1003005323300000231GroundwaterMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETITLVL*
TB_LI09_4DRAFT_1007876923300000231GroundwaterMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETINIQTR*
TB_LI09_4DRAFT_1008188023300000231GroundwaterMQGAQKLRSEAHLGVRRNDEVEAQRRRWIFYETIKFC*
JGIcombinedJ13530_10734474213300001213WetlandMQGAQKLRSKAQLQARRTDEVAAQRHRLTFYEAIIFCPFPFPIYSRYR
JGI2173J19968_1009946313300001752Marine SedimentMQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAINNGF*
SMTZ23_1002160163300002053Marine SedimentMQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAIFIDYLF*
JGI11641J44799_1009229323300002961WetlandQSPQKPGSEEHFGVRRSDEVVTQSFSERDRWTFYETIKFLKGLWE*
JGI20214J51088_1032014313300003432WetlandMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFHEAINIKKTKRKPK*
Ga0031654_1011644413300003861Freshwater Lake SedimentMQGAQKLRREAYLQLRCNDEVAAQRRRWTFYESINLWVSKP
Ga0031654_1012297423300003861Freshwater Lake SedimentMQGAQKLRSEAYLYVRCNDEVEAQRRRWNFYEAIKKNEIN*
Ga0055468_1016145813300003993Natural And Restored WetlandsLQMPGAQKLRSEAHLRVRRSDEVEAQRRRWTFYETIKVRK*
Ga0066599_10092058223300004282FreshwaterMPGAQKLRSEAYYQVRRNDEVAAQRRRWTFYETIKGKGGES*
Ga0069718_1011781263300004481SedimentMQGAQKLRSEAHFQVRRNDEVEAQRRRWAFYVTIKKGGWQ*
Ga0069718_1599271663300004481SedimentMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKLGVALQFFRS*
Ga0069718_1617559613300004481SedimentMQGAQKLRSEAYYQVRCNDEVEAQRRRWIFYETINFEEEI*
Ga0069718_1637566623300004481SedimentMPGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIIIPRRPLPG
Ga0068711_102843923300005144Enrichment CultureMQGAQKLRSAAYLQVRCNDEGAAQRRRWTFYETINKEET*
Ga0068711_104002323300005144Enrichment CultureMQGAQKLRSKAHVQVRRNDEVAAQRRRWTFYETLNIRNNILLQEERRGGL*
Ga0068711_104734813300005144Enrichment CultureMQGPQNLRSEACKPLPGNDEDEAQRRRWTFCETIKYPDWSR
Ga0074472_1029296423300005833Sediment (Intertidal)MQGAQKLRSEAHLQVRRNDDVEAQRRRWTFYEIIKFPQPHS
Ga0074472_1061816423300005833Sediment (Intertidal)MQGAKKLRDEAHLWVRGNDEGEAQSRSARDRWTFYETVKFGI*
Ga0074472_1122462713300005833Sediment (Intertidal)MQGAQKLRSEAHLQVRRSDEVEAQRRRWIFYETIKFAYK*
Ga0079037_100000346103300006224Freshwater WetlandsMQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK*
Ga0079037_10000126233300006224Freshwater WetlandsMPGAQKLRSEAHLRVRRNDEVAAQSRSERNRWTFYETINN*
Ga0079037_10000359023300006224Freshwater WetlandsMPGAQKLWSEAHLQVRRNDEVAAQSRSERDRWTFYETIKI*
Ga0079037_10001325673300006224Freshwater WetlandsQMQGAQKLRSEAHLQVRRSDEVAAQSRSERDRWTFCETIIL*
Ga0079037_10003371213300006224Freshwater WetlandsMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKLDSF
Ga0079037_10007189343300006224Freshwater WetlandsMQGAQKLRSDAHSQLRRNDEVAVQSRSERDRWTFYETIKTG*
Ga0079037_10018959853300006224Freshwater WetlandsQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVIIIINF*
Ga0079037_10021483513300006224Freshwater WetlandsMQGAQKLRSEAHLQVRRSDEVAAQSRSERDRWTFC
Ga0079037_10061135023300006224Freshwater WetlandsMQGAQKLRSEAHFQVRRNEEVAAQRRRWTFYETII
Ga0079037_10067747313300006224Freshwater WetlandsMVSEKAQLQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETI
Ga0079037_10070994613300006224Freshwater WetlandsAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMPG*
Ga0079037_10096040613300006224Freshwater WetlandsMQGAQNLRSEAYLLVRCNDEGEAQRRRWTFYEVIK
Ga0079037_10123907013300006224Freshwater WetlandsKKLQMQGVQKPRSAAQLQVHRKDEVEAKRRRRTFYETIIIKGASA*
Ga0079037_10182458613300006224Freshwater WetlandsEAHLRVRRSDEVAAQSRSERDRWTFYETINFFLP*
Ga0079303_1000786313300006930Deep SubsurfaceMQGTQKLRSEAHLCVRRNDEVEAQRSRWTFYETIK
Ga0079303_1010040613300006930Deep SubsurfaceQGVQKLRSEAHISRASRDNDEVEAQSRSARDRRDFCETINGYLTP*
Ga0079303_1043164023300006930Deep SubsurfaceMQGAQKLRSEAHLLVRRNDEVEAQRSRWTFYETIK
Ga0105105_1025261723300009009Freshwater SedimentMQGAQKLRSETHLRVRRNDEVETHRRRWTFYETIKL*
Ga0105105_1031962513300009009Freshwater SedimentLQMQGAQELRSEAHLQVRRNDEVAAQRRSWTFYKAINTDT*
Ga0105105_1048278123300009009Freshwater SedimentMQGAQKLRSAAHELVRRNDEVAAQPSRWTFYETIKAGRE*
Ga0105093_1006731723300009037Freshwater SedimentMQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINPC*
Ga0105093_1022429223300009037Freshwater SedimentMQGAQKLRREAHLQVRRNDEVAAQRRRWTFYETINFNRGYPL*
Ga0105095_1022598033300009053Freshwater SedimentMQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIK*
Ga0105095_1024308313300009053Freshwater SedimentRSEAHLQVRRNDEVEAQRSRWTFYEIIKPTGTGF*
Ga0105095_1064128823300009053Freshwater SedimentLQMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKIRRERKHNG*
Ga0105090_1020725613300009075Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVAAQRRSWTFYKAINTGT*
Ga0105090_1031210533300009075Freshwater SedimentMQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIKFAEY*
Ga0105090_1032125633300009075Freshwater SedimentAQKLRSEAYIKVRCNDEVEAQRRRWTFYETIKDSRDYISVL*
Ga0105090_1060439813300009075Freshwater SedimentMQGAQKLRSEAHLRVRRKDEVEAQRCRWTFYETITS
Ga0105090_1100081013300009075Freshwater SedimentMQGAQKLRSEAHLQVRRNDEGAAQRRRWTFYEAIK*
Ga0105106_1000869173300009078Freshwater SedimentMQGAQKLRIEAHLQVRRSDEVEAQRRRWTFYETINPC*
Ga0105106_1001633013300009078Freshwater SedimentAQKLRSEAHLRVRRNDEVEAQRHRWTFYETIKFPAEKRGPLDFA*
Ga0105106_1002337733300009078Freshwater SedimentMLQMQGAQKLRSAAHELVRRNDEVAAQRSRWTFYETIEAGRE*
Ga0105106_1002488813300009078Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKYRK*
Ga0105106_1002763713300009078Freshwater SedimentAQKLRSEAYLQVRCNDEVEAQRRRWIFYETLKLGG*
Ga0105106_1003646243300009078Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINI*
Ga0105106_1006055283300009078Freshwater SedimentKKLQMQGAQKLRREAHLRVRRSDEVEAQPSRWTFYETIILDSALEMGI*
Ga0105106_1010295323300009078Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKIRRERKHNG*
Ga0105106_1010933113300009078Freshwater SedimentRKKLQMQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIKFAEY*
Ga0105106_1020944713300009078Freshwater SedimentMPGAQKLRSEAYYQVRRNDEVAAQRRRWTFYETIK
Ga0105106_1023593613300009078Freshwater SedimentQMQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYETIKKGGWQ*
Ga0105106_1032155413300009078Freshwater SedimentMQGAQELRSEAHLQVRRNDEVAAQRRSWTFYKAINTDT*
Ga0105106_1033653233300009078Freshwater SedimentMQGAQKLRSEPHLQVHRNDEVAAQRRRWTFYETIIF
Ga0105106_1077329613300009078Freshwater SedimentMPGAQKLRSEARFPVRRNDEVEAQRRRWTFYEPIKKGGAMS
Ga0105106_1095607023300009078Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETIKYHRA*
Ga0105106_1099511913300009078Freshwater SedimentKLRSEAHLQVRRNDEVEAQRSRWTFYETISILLP*
Ga0105098_1003574423300009081Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS*
Ga0105098_1009816633300009081Freshwater SedimentMQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETITFRIRAPALR
Ga0105098_1010712723300009081Freshwater SedimentAQKLRSEAHLQVRRNDEVAAQRRRWTFYETINIRHFENS*
Ga0105098_1010933323300009081Freshwater SedimentMQGAQKLRSETHLRVRRNDEVETQRRRWTFYETIKL*
Ga0105098_1012689233300009081Freshwater SedimentQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQTGP*
Ga0105098_1030289823300009081Freshwater SedimentMQGAQKLRREAHFWVRRNAEVAAQRRRWTFYETITL*
Ga0105103_1004567823300009085Freshwater SedimentMQGAQKLRSEAHLRVRRSDEVEAQPSRWTFYETIILDSALEMGI*
Ga0105103_1005159013300009085Freshwater SedimentMQGAQKLRSEAHLRVRCNDEVEAQRSRWIFYETINHSRVI
Ga0105103_1006446823300009085Freshwater SedimentMQGAQKLRSEAHFQVRRNDEFAAQRRRWTFYETINSKISGEDDGDG
Ga0105103_1007572413300009085Freshwater SedimentMQRAQKLRSEAHLQVRSNDEVGTQRRRWTFLETIKEENVFMG
Ga0105103_1011797923300009085Freshwater SedimentMQGAQKLRREAHLQVRRNDEVEAQRHRWTFYEAIKE*
Ga0105103_1013335513300009085Freshwater SedimentMQGAQKLRSEAHFGVRRNDEVEAQRRRWTFYETII
Ga0105103_1027656123300009085Freshwater SedimentMQGAQKLRSEAHLRVRRNDKVEAQRSRWTFYEVINVESLQK*
Ga0105103_1028276323300009085Freshwater SedimentMPGAQKLRREAPLQVRRNGEVEAQRRSWAFYETIK*
Ga0105103_1067790523300009085Freshwater SedimentMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYKTIF
Ga0105107_1004606333300009087Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITEERKK*
Ga0105107_1007852413300009087Freshwater SedimentGAQKLRSEAYEQVRCNDEVEAQRRRWTFYEAITLAPFFAR*
Ga0105107_1046852713300009087Freshwater SedimentMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVINIASASKP
Ga0105107_1073254713300009087Freshwater SedimentGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINI*
Ga0102851_1002459753300009091Freshwater WetlandsAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT*
Ga0102851_1010735413300009091Freshwater WetlandsMPGAQKLRSEAHLRVRRNDEVAAQSRSGRNRWTFYETINN*
Ga0102851_1020508123300009091Freshwater WetlandsMQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYEIITS*
Ga0102851_1051048823300009091Freshwater WetlandsMQVAQKRKSAAHLQVRRNDEVEAQGRRWTSYETIKIDQFGR*
Ga0102851_1125616423300009091Freshwater WetlandsMQGAQKLRSEAHLRVRHNDEVEAQRRRWTFYEIINFDSEFPETER
Ga0102851_1143405223300009091Freshwater WetlandsMQGAQKLRSEAQFQVRRNDEVAAQRSRWTFYETINIEKTMKDHYKTL
Ga0102851_1166673213300009091Freshwater WetlandsKKLQMQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYETIKI*
Ga0102851_1187318023300009091Freshwater WetlandsKKLQMQGAQKLRSEAHLRVRRSDEVEAQRCRWTFYEVIKIISP*
Ga0102851_1325351623300009091Freshwater WetlandsMPGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETI
Ga0102851_1327458213300009091Freshwater WetlandsMQGAQKRRSEAHLSVRRNDEVAAQSRSERDRWTFYE
Ga0115026_1000334823300009111WetlandMQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT*
Ga0115026_1012474433300009111WetlandMQGAQKLRSEAHDRVRRNDEVTAQSRSERDRWTFYK
Ga0115026_1024742323300009111WetlandMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEVIK*
Ga0115026_1048002823300009111WetlandKKLQMQGAQKLRSEVHLEVRRRWTFYETINKCRKN*
Ga0115026_1154243413300009111WetlandMQGAQKLRSEAHVQVRRNDEVEAQRSSWTFYEAIKVA*
Ga0115026_1183823913300009111WetlandKLQMQGAQKLRSEAHLRVRRNDEVAAQSRSERNRWTFYETINN*
Ga0115027_1024906213300009131WetlandMQGAQKLRSEAHIWVRRNDEVAAQSRSERDRWTFYETIKGDGILKGDAR*
Ga0115027_1055146613300009131WetlandMQDAQKLRSEAHLRVRHNDEVEAQRRRWTFYEIINFDSEFPETERGGREN
Ga0115027_1119351213300009131WetlandMQGAQKLRSEAHLPVRRNDEVAAQSRSERDRWTFYETII
Ga0115027_1137769423300009131WetlandQGGQKLRSEAPLRVRRSDEVEAQRSRWTFYETIKKGGWQWLS*
Ga0105091_1019422113300009146Freshwater SedimentMPGAQKLRSAARLRVRRNEEVEARRRRWSFYEVIYYFPIII
Ga0105091_1034579323300009146Freshwater SedimentMQGARKPRSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS*
Ga0105094_1005900033300009153Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITEERKR*
Ga0105094_1008193533300009153Freshwater SedimentMQGAQKLRSEAYLRVRRNDEVEAQRRRWTFYETIKL*
Ga0105094_1010585233300009153Freshwater SedimentQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKYRK*
Ga0105094_1012042913300009153Freshwater SedimentGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINASVL*
Ga0105094_1012122043300009153Freshwater SedimentQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKNR*
Ga0105094_1015793523300009153Freshwater SedimentLQMQGAQKLRSEAHLHVRRNDKVEAQRRRWTFYETITY*
Ga0105094_1030819313300009153Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVAAQRRSWTFYKAINTDT*
Ga0105094_1043671213300009153Freshwater SedimentMLQMQGAQELRSEAHLQVRRNDEVAAQRSRWTFYEAIIDRDLKDA
Ga0105094_1077894313300009153Freshwater SedimentMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIK
Ga0105102_1011265313300009165Freshwater SedimentGAQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQTGP*
Ga0105102_1028728313300009165Freshwater SedimentMPGAQKLRSAPHLKVRRNDEVAAQRRRWTFYVTIKGG
Ga0105102_1090889323300009165Freshwater SedimentMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETIFIV
Ga0105100_1009020713300009166Freshwater SedimentMPGAQKLRRDAHNQVRRNDAVAAQRRRWTFYETISCWPALKPLMNF
Ga0105100_1010295523300009166Freshwater SedimentMQGAQNLRREAHLRVRRNDEVEAQRRRWTFYETIIIGT
Ga0105100_1012679113300009166Freshwater SedimentLQMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYEAIKLFYRPF*
Ga0105100_1023771733300009166Freshwater SedimentMQGTQKLRSAAHLQVRRNDKVAAQRTKWTFYDTIKILP
Ga0105100_1039436813300009166Freshwater SedimentMQGAKKLRSEAYRWVRCNDEVEAQRRRWIFCETIILSI
Ga0105100_1060154913300009166Freshwater SedimentFLFYGFVKSSRCEAHLRVRRNDEVEAQRRRWTFYETILF*
Ga0105100_1075345723300009166Freshwater SedimentCKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRSWTFYETIK*
Ga0105100_1080009013300009166Freshwater SedimentMQGAQKLRSEAHLRVCRNDKVEAQRSRWTFYEVINVESLQK*
Ga0113563_1005576043300009167Freshwater WetlandsMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFCETINFTPKR
Ga0113563_1023385233300009167Freshwater WetlandsMQGAQKLRSEAHIWVRRNDEVEAQSRSERDRWTFYETIKGDGILKGDAR*
Ga0113563_1036037713300009167Freshwater WetlandsMQGAQKLRSAAHAYVRRNDEGEAQSRSERDRWAFYE
Ga0113563_1115321323300009167Freshwater WetlandsMQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETIKN*
Ga0113563_1125890823300009167Freshwater WetlandsQMQGSQKLKGEAHFQVRRNDEVATQSRSEQDRWTFYEAIKNCCSK*
Ga0113563_1137949213300009167Freshwater WetlandsMQGAQKLRSAAHYKVRCNDEVEVQRSSWAFYETINPDQGQQ*
Ga0113563_1158430523300009167Freshwater WetlandsMQGAQKLRSEAHNQVRRNDEVEAQRRRWTFYEPIIF
Ga0113563_1225746723300009167Freshwater WetlandsKKLQMQGAQKLRGEAHLQVRRNDEVEAQRRRGTF*
Ga0113563_1394187113300009167Freshwater WetlandsMQGARKLRSEAHLQVRRSDEVEAQRRRWTFYETIK
Ga0105104_1043208823300009168Freshwater SedimentMQGAQKLRREAHLRVRRNDEVEAQRHRWTFYETIK
Ga0105097_1000737173300009169Freshwater SedimentRSEAHLQVRRNDEVEAQRRRWTFYETITLQFFEKGAS*
Ga0105097_1000749713300009169Freshwater SedimentMQGAQKLRNEAHLQVRRNDEVEAQRSRWTFYETIKPTGTGF*
Ga0105097_1002313493300009169Freshwater SedimentMQGAQKLRSEPHLQVRRSDEVEAQRRRWTFYETINF
Ga0105097_1003229523300009169Freshwater SedimentMQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINIDSSTNQKKGG*
Ga0105097_1003428913300009169Freshwater SedimentMQGAQKLRSEAHLRVRRSDEVEAQCRRWTFYETIILDGALETGI*
Ga0105101_1001758033300009171Freshwater SedimentMLQMQGAQKLRSAAHELVRRNDEVATQRSRWTFYETIEAGRE*
Ga0105101_1025343323300009171Freshwater SedimentMQGAQKLRSEAHLQVRRNDKVEAQRSRWNFYETIIL*
Ga0105101_1048444423300009171Freshwater SedimentMQGAQKFRSEAYEQVRCNDEVEAQRRRWTFYETINFHQEIL
Ga0115028_1040990813300009179WetlandMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYEVIIIINF*
Ga0115028_1041320823300009179WetlandMQGAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGF
Ga0115028_1069445623300009179WetlandQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETINFDK*
Ga0114938_132836113300009430GroundwaterMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYEAISPLAGREKPTR*
Ga0116155_1034061713300009771Anaerobic Digestor SludgeMQGAQKLRSEPHLQVRRNDEVEAQRRRWTFYETIKFNS
Ga0151652_1268033123300011340WetlandMQGAQKLRTEAHLQVRCKDEVEAQRRRWDFYETINDDVP*
Ga0151652_1376995423300011340WetlandKKLQMQGAQKLRSEAYVQVRCNDEVEAQRGRWTFYETVNI*
Ga0151652_1378783413300011340WetlandMLGAQKLRSEAHLWVRRNDEVAAQRRRWTFYETIFFKW
Ga0153916_1285283823300012964Freshwater WetlandsQNLRSEAYLPVRCNDKGEAQRRRWTFYEAIKIERKVEGIL*
Ga0075316_117621823300014314Natural And Restored WetlandsMPGAQKLRSEAHLQVRRNDEEIDGQRRRWTFYETIKITPRKDQRIAG*
Ga0075316_120555623300014314Natural And Restored WetlandsVQGAQKLRNEAHLRVRRNDEVEAQRRKWTFYEVIKL*
Ga0187776_1058002823300017966Tropical PeatlandMQGAQKLRSEAYLHVRCNDEIEAQPRSERDRGTFYETI
Ga0187787_1040672613300018029Tropical PeatlandMQGAQKLRSEAHFQVRRNDGVAAQRSRWTFYETINHD
Ga0184616_1030652913300018055Groundwater SedimentMQGAQNLRSEAYWLVRCNDEGEAQRRRWTFYEAISLGILGQRE
Ga0184615_1057162513300018059Groundwater SedimentMPGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKIPFTGSS
Ga0184615_1061256513300018059Groundwater SedimentLQMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKD
Ga0187773_1074346223300018064Tropical PeatlandFRKKIQMQGAQELRSEAYFHVRCNGEVEAQRRRWTFYEAVKE
Ga0184636_109844523300018068Groundwater SedimentMQGAQNLRSEAYLVVRCNDEGEAQRRRWTFYETIK
Ga0184636_120030013300018068Groundwater SedimentMPGAQNLRSEVYLLVRCNDEGEAQRRRWTFYEAIK
Ga0184631_1007379013300018070Groundwater SedimentGAQKLRSEAHKQVRRNDEVAAQRSRWTFYETLKVTSPR
Ga0194113_100000451273300020074Freshwater LakeKKLQMQGAQNLRSEAYLQVRCNDEGEAQRRRWTFYETIKTFDH
Ga0194113_10000096563300020074Freshwater LakeMQGAQNLRSEAYLQVRRNDEGEAQRRRWTFYETILIEL
Ga0194113_10000324293300020074Freshwater LakeMQGAQNLRSEAYLQVHCNDEGEAQRRRWTFYETIFLDAPGKGGEYTPSKKT
Ga0211729_1116259223300020172FreshwaterMQGAQKLRSEAHLQVRRNDEVAAQRRRWIFYEAIKIDSA
Ga0224495_1004138223300022208SedimentMQGAQNLRSEAYLLVRCNDEGEAQRRRWTLYETIRF
(restricted) Ga0233425_1031505023300024054FreshwaterMKGAQKLRSEAHLQVRCNDEGAAQRRRWTFYETINFDTQSSRK
Ga0209324_1003041533300025174SoilMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINFW
Ga0209324_1060075523300025174SoilQMQGAQELRSEAYLHVRCNDEVEAQRSRWTFYETINH
Ga0209323_1008582233300025314SoilKLQMQGAKKLRSEAYLHVRCNDEVEAQRSRWTFYETINID
Ga0210136_107687223300025967Natural And Restored WetlandsMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETINV
Ga0209269_106759623300027051Enrichment CultureMQGAQKLRRAVHLPVRRNDEVEAQRRRWPFYETIKF
Ga0209269_107350823300027051Enrichment CultureMPIAQKRRSAAHLQVRRTDEVEAQRRRWTFYETIKNYETKG
Ga0209704_125660023300027693Freshwater SedimentMLQMQGAQKLRSAAHELVRRNDEVAAQRSRWTFYETIEAGRE
Ga0209286_129889323300027713Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITEERKR
Ga0209286_133672323300027713Freshwater SedimentMQGAQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQTGP
Ga0208665_1019414813300027715Deep SubsurfaceMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYEIITS
Ga0209492_100449753300027721Freshwater SedimentMQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIK
Ga0209492_101206043300027721Freshwater SedimentMQGAQKLRSEAYYQVRCNDEVEAQRRRWIFYETINFEEEI
Ga0209492_102858453300027721Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVAAQRRSWTFYKAINTGT
Ga0209492_103262463300027721Freshwater SedimentMQGAQKLRSEAHLRVRRSDEVEAQCRRWTFYETIILDGALETGI
Ga0209492_104686523300027721Freshwater SedimentMQGAQKLRSEAHLLVRRNDKVEAQRRRWTFYEAIKFR
Ga0209492_105272923300027721Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVAAQRCRWTFYETITE
Ga0209492_106259933300027721Freshwater SedimentKLQMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYEAIKLFYRPF
Ga0209492_106511923300027721Freshwater SedimentMQGAQKLRSEAHLRVRRNDKVEAQRSRWTFYEVINVESLQK
Ga0209492_113367813300027721Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETINNSFFSA
Ga0209492_114640123300027721Freshwater SedimentMQGAQKLRREAHLRVRRNDEVEAQRRRWTFYETIK
Ga0209492_119718913300027721Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIT
Ga0209492_121187113300027721Freshwater SedimentMQGAQKLRSEAHLQVRRSDEVEAQRSRWAFYETIKFQ
Ga0209492_123184113300027721Freshwater SedimentMQGAQKPRSEAHILVRRNDEVEAQRRRWTFYETITGSAWR
Ga0209492_129387813300027721Freshwater SedimentLQMQGAQKLRSEAHLQVRRNDEGAAQRRRWTFYEAIK
Ga0209285_1002740113300027726Freshwater SedimentMQGAQKLRSEAHLRVRRNDEVAAQRSRWNFYETITF
Ga0209285_1005985023300027726Freshwater SedimentQMPGAQKLRNEAPSRVRRNDEVAAQRRRWIFYETIKIT
Ga0209285_1009273333300027726Freshwater SedimentMQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETINPC
Ga0209285_1011416513300027726Freshwater SedimentMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYEIIAQGTMTTLIAPSS
Ga0214474_101381233300027740SoilMQGAQNLRSEAYFQVRCNDEGEAQRRRWTFYEAINV
Ga0214474_118235513300027740SoilMQGAQNLRSEAYLLERCNDEGEAQSRSERDRCTFYETIISCPMKK
Ga0256868_1000242613300027811SoilMQGAQNLRSEAYLLERCNDEGEAQSRSERDRCTFYETIISCPMKKE
Ga0209706_1004091013300027818Freshwater SedimentMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETIFIVS
Ga0209706_1004464723300027818Freshwater SedimentMQGAQKLRSETHLRVRRNDEVETQRRRWTFYETIKL
Ga0209706_1005662833300027818Freshwater SedimentKKLQMQGAQKLRSAAYLSVRCNDEVEAQRRRWTFYETIIFPG
Ga0209706_1007973913300027818Freshwater SedimentMQGAQKLRSEAHLRVRRSDEVEAQPSRWTFYETIILDSALEMGI
Ga0209706_1008537313300027818Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVAAQRCRLTFYETITEE
Ga0209706_1016080523300027818Freshwater SedimentMQGAQKLRSEAHLQVRRKDEVDAQRRRWTFYETINDDPIKSL
Ga0209706_1016759923300027818Freshwater SedimentMQGAQKLRSEAHLQVRRSDEVEAQRRRWTFYETITFR
Ga0209706_1026478723300027818Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVDAQRRRWTFYETIKYHRA
Ga0209706_1040601613300027818Freshwater SedimentMQGAQKPRSEAHIWVRRNDEVAAQRRRWTFYESIRIFSVRF
Ga0209262_1054689113300027841FreshwaterMPGAQKLRSEAHYRVRRNDEVAAQRRRWTFYETINF
Ga0209293_1010925713300027877WetlandMQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK
Ga0209293_1062363423300027877WetlandMPGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANTVVVQ
Ga0209293_1075779823300027877WetlandMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEVIK
Ga0208980_1048342723300027887WetlandMQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIML
Ga0209635_1002132243300027888Marine SedimentMQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAINNGF
Ga0209496_1015609823300027890WetlandMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIIFE
Ga0209496_1023847413300027890WetlandQMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFLLDHLL
Ga0209496_1050365623300027890WetlandMQGAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMP
Ga0209254_1001609563300027897Freshwater Lake SedimentMQGAQKLRSEAHFLVRCNDEVEAQRRRWTFYETIKFLFGRKL
Ga0209254_1004633353300027897Freshwater Lake SedimentGAQKLRREAHLRVRRNDEVEAQRSRWTFYETIKIGRGIG
Ga0209254_1004759923300027897Freshwater Lake SedimentMQGAQKLRSEAHFQVRRNDEGAAQRRRWNFYEAIKLDP
Ga0209254_1006910523300027897Freshwater Lake SedimentMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYETIKHIIQP
Ga0209254_1007456923300027897Freshwater Lake SedimentMQGAQKLRREAHFQVRRSDEVEAQRSRWTFYETIPS
Ga0209254_1007616633300027897Freshwater Lake SedimentGAQKLRREAHLRVRRNDEVEAQRSRWTFYETIKFGIFKKNGG
Ga0209254_1007761363300027897Freshwater Lake SedimentGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKYD
Ga0209254_1009358223300027897Freshwater Lake SedimentQRAPTMPGAQKLRSEAHLRVRRNDEVAAQSRSERDRWTFCETTLIGV
Ga0209254_1013671013300027897Freshwater Lake SedimentMQGAQKLRSEAHLLVRRNDEVAAQRSRWTFYETILIAFYEVHRWREQ
Ga0209254_1041345023300027897Freshwater Lake SedimentMQGAQKLRSEAHLQVRLSDEVEAQRRRWTFYETINIDSSTNQKKGG
Ga0209254_1056694623300027897Freshwater Lake SedimentRKKLQMQGAQKLRSEEHLQVRRNDEVTAQRRRWTFYETINY
Ga0209254_1075677323300027897Freshwater Lake SedimentMQGPQKLRSEAHLQVRCRDEVAGQRSRWTFYEAIDH
Ga0209668_1022619323300027899Freshwater Lake SedimentMQGAQKLRSEVHLRVRRNDEVEAQRRRWTFYETIL
Ga0209668_1086243223300027899Freshwater Lake SedimentMPGTQKLRGEGHLQVRRNGEVEAQRRSWAFCETVQFGLFA
Ga0209668_1103394813300027899Freshwater Lake SedimentVQGGQKLRSEAYYQARGNDEVEAQRRRWTFYETIIFFIIDNQGL
Ga0209253_1001481673300027900Freshwater Lake SedimentMQGAQKLRSEAHFQVRRNDEVAAQRRRWNFYETIKIDSLSLS
Ga0209253_1013513533300027900Freshwater Lake SedimentQMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKF
Ga0209253_1023805833300027900Freshwater Lake SedimentVGASAARPYIQGAQKLRSEAHFRVRRRWTFYETIKIY
Ga0209253_1023877623300027900Freshwater Lake SedimentPPQAGLGAQELRSEAQNQVRRKDEVAAQRSRWTFYETIKAISPR
Ga0209253_1056113913300027900Freshwater Lake SedimentGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETINFSFAKKKGKPCNEK
Ga0209427_1002299023300027901Marine SedimentMQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAIFIDYLF
Ga0209427_1007807623300027901Marine SedimentMQGAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAIILDFYHS
Ga0209427_1047748223300027901Marine SedimentAQNLRSEAYLQVRRNDEGKAQRRRWTFYEAINNGF
Ga0209048_10004117113300027902Freshwater Lake SedimentMQGAQKLRSEAYLHVRCNDEIEAQRRRWIFYETIKINCG
Ga0209048_10011446103300027902Freshwater Lake SedimentMQGAQKLRSEAHFQLRRNDEVAAQRRKWTFYEAIRI
Ga0209048_10012606133300027902Freshwater Lake SedimentQMQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIK
Ga0209048_1001572213300027902Freshwater Lake SedimentQMQGAQKLRSEAYLQVRRNDEGEVQRSRWTFYETITLDS
Ga0209048_1002294443300027902Freshwater Lake SedimentMQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIQIG
Ga0209048_1002296363300027902Freshwater Lake SedimentMQGAQKLRSEAYLQIRCNDEVEAQRRRWTFYETIRFYAT
Ga0209048_1004259013300027902Freshwater Lake SedimentMQGAQKLRSEACLQVRCNDEVEAQRRRWTFYETIN
Ga0209048_1004824553300027902Freshwater Lake SedimentQGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETINDWRG
Ga0209048_1005283843300027902Freshwater Lake SedimentMQGAQNLRSEAYLQVRRNDEGEVQRSRWTFCETIKEGGL
Ga0209048_1005527253300027902Freshwater Lake SedimentGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIITT
Ga0209048_1006076213300027902Freshwater Lake SedimentQGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETIYNGGF
Ga0209048_1006227123300027902Freshwater Lake SedimentMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKFD
Ga0209048_1007780433300027902Freshwater Lake SedimentMQGAQKLRSEAYLYVRCNDEVEAQRRRWNFYEAIKKNEIN
Ga0209048_1008124933300027902Freshwater Lake SedimentQMQGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETIIIIP
Ga0209048_1026314523300027902Freshwater Lake SedimentMQGAQKLRSEAHLQLRRNDEVAAQRSRWTFYETIKFDDLIKSH
Ga0209048_1028460123300027902Freshwater Lake SedimentMQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETITLMGVKIA
Ga0209048_1034763013300027902Freshwater Lake SedimentGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETISFHE
Ga0209048_1036186013300027902Freshwater Lake SedimentGAQKLRSEGYLQVPCNDEVEAQRRRWTFYETINISLIR
Ga0209048_1040073723300027902Freshwater Lake SedimentQKLRSEAYLHVRCNDEVEAQRRRWIFYETTIIDPCCY
Ga0209048_1045055323300027902Freshwater Lake SedimentMQGAQKLRSEAHLQMRRNKEVAAQRSRWTFYETINLWHIHK
Ga0209048_1053836023300027902Freshwater Lake SedimentQMQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIKF
Ga0209048_1064827013300027902Freshwater Lake SedimentGAQKLRSEGYLQVPCNDEVEAQRRRWTFYETINFCANYFLS
Ga0209048_1078975423300027902Freshwater Lake SedimentQMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKFTFSD
Ga0209048_1079260113300027902Freshwater Lake SedimentMHGAQKLRSEGYLQVPCNDEVEAQRRRWTFYETIN
Ga0209048_1083941313300027902Freshwater Lake SedimentQGAQKLRSEAYLHVRCNDEVEAQRRRWTFYETINIMSI
Ga0209048_1093819623300027902Freshwater Lake SedimentGAQKLRSEAHLQVRRNDEVAAQRSRWTFYETIKEDSLARSQAE
Ga0209820_107867913300027956Freshwater SedimentMQGALKMRREAYYQVRCNDEVAAQRRRWNFYETITFSTW
Ga0209705_1004211623300027979Freshwater SedimentMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKVRG
Ga0209705_1006446033300027979Freshwater SedimentMQGAQKLRIEAHLQVRRSDEVEAQRRRWTFYETINPC
Ga0209705_1012418833300027979Freshwater SedimentMQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETIC
Ga0209705_1020701513300027979Freshwater SedimentMPGAQKLRSEAHSQVRRNDEVEAQRRRWTLYEAIR
Ga0299915_1053898833300030613SoilMPGAQNLRSEAYLPVRRNDEGEAQRRRWTFYEAIKNNI
Ga0315293_1045799433300031746SedimentMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETICMN
Ga0315293_1097831913300031746SedimentMQGAQNLRSEAYLQVRCNDEGEAQRRRWTFYETMVF
Ga0315293_1125363613300031746SedimentMQGAQKLRSEAHLQVRRSDEVEAQRSRWTFYETIKFKDSEH
Ga0315288_1069981523300031772SedimentQMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYEAIKFRL
Ga0315290_1003440343300031834SedimentMQGAQKLRSEAHFQVRRNDEVEAQRSRWTFYETIMYGPP
Ga0315290_1016600223300031834SedimentMQGAQKLRSEAHFLVRRNDEVEAQRRRWTFYETIISRTLRP
Ga0315290_1017682813300031834SedimentFRKKLQMQGAQKLRSEAYYQVRCNDEVEAQRRRWTFYETINI
Ga0315290_1063095923300031834SedimentMPGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETIKTLPAGP
Ga0315290_1071882823300031834SedimentLRSEAYLHVRCNDEVEAQRSRWTFYETIKIHSPKELI
Ga0315297_1009799633300031873SedimentKKLQMQGAQKLRSEVHLRVRRNDEVAAQRRRWTFYETINICNLQ
Ga0315297_1017372413300031873SedimentMQGAQKLRSEAHLQVRRNDEVAAQRSRWTFYETIKT
Ga0315297_1018472513300031873SedimentMQGAQRLRREAHLRVRRNDEVAAQRRRWTFYETIKVIS
Ga0315297_1028252733300031873SedimentMQGAQKLRSQAHFQVRRNDEVEAQRSRWTFYETIMYGPP
Ga0315297_1061750313300031873SedimentMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCNSKKYRWLDGH
Ga0315297_1065902223300031873SedimentGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINLDEIVKSP
Ga0214473_1003735963300031949SoilMQGAQKLKGEAYFHVRCNDEVEAQSRSERDRWTFYETIKIEDNPD
Ga0214473_1022762843300031949SoilMQGAQNLRSDAYLLVRCNDEGEAQRRRWTFYEAIFFFF
Ga0214473_1030382833300031949SoilAQNVRSEAYLQVRRNDEGEAQRRRWTFYEAINFLFLAWPVRRRKK
Ga0214473_1089622223300031949SoilMQGAQNLRSEAYLAVRRSDEGEAQRRRWTFYEAIIF
Ga0214473_1096226543300031949SoilAQKLRSEAHLRVRRNDEVAAQSRSERDRWTFYETIKD
Ga0315294_1104080713300031952SedimentQMQDAQKLRSEAYEQVRCNDEVEAQRRRWTFYETI
Ga0315294_1131761023300031952SedimentKLWSEAHLQVRRNDEGAAQRRRWTFYEIIWDRFEVIR
Ga0315278_1004921563300031997SedimentMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETITLT
Ga0315278_1018356133300031997SedimentMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIN
Ga0315278_1026608823300031997SedimentMPGAQKLRSEAYLQVRGNDEVEAQSRSERDRWIFYETIKFGG
Ga0315278_1063109713300031997SedimentMQGAQKLRSEAHLWVRRNDEVAAQRRRWTFYETIKISIAIYHKGRKM
Ga0315274_1032517933300031999SedimentMQGAQKLRSEARLQVRRNDEVEAHRRRWTFYETINH
Ga0315274_1075440633300031999SedimentMQGAQKLRREAHLRVRRNDEVEAQRRRWTFYKAINFAS
Ga0315274_1078978213300031999SedimentQSKKHQMQGAQNVRSEAYLQVRLNDEGEAQRRRWTFYEAIKIH
Ga0315296_1017555723300032020SedimentMQGAQKLRSEAYIRVRCNDEVEAQRSRWIFYETIMLILMLFRIEGD
Ga0315296_1043298533300032020SedimentMQGAQSLRSEAYLLVRCNDKGEAQRRRWTFYETINISSCT
Ga0315289_1052934013300032046SedimentMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIIH
Ga0315284_1026147723300032053SedimentMQGAQELRSEAYLHVRCNDEVEAQRSRWTFYETINIHFVGAGFNPAQ
Ga0315284_1037907913300032053SedimentGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINYDAKVRGTTLL
Ga0315284_1048170723300032053SedimentMQGAQKLRSEAHLQVRRKDEVAAQRRSWTFYETIILILP
Ga0315284_1065283023300032053SedimentKKLQMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKFRL
Ga0315284_1127369013300032053SedimentMQGAQKLRSEAHLQVRRNDEVEAQRSRWTFYETINIC
Ga0315284_1158519423300032053SedimentMQGAQELRSEAHLQVRRNDEVEAQRRRWTFYETIKVDRT
Ga0315279_1005298733300032070SedimentMQGAQNLRSEAYLLVRCNDEGEAQRRRWTFYEAIKFRK
Ga0315279_1085595313300032070SedimentMQGAQNLRSEPYYKVRRNDEGEAQRRRWTFYEAITLE
Ga0315292_1007335113300032143SedimentQMQGAQKLRSEAYLQVRCNDEVEAQRSRWTFYETIKLHRNFSA
Ga0315292_1012491333300032143SedimentMQGAQKLRSEAHLQARRNDEVAAQRSRWTFYETIKNG
Ga0315292_1145439823300032143SedimentMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFSETIKF
Ga0315295_1008263143300032156SedimentQMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETINLDEIVKSP
Ga0315295_1053550743300032156SedimentGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCNSKKYRWLDGH
Ga0315295_1058458513300032156SedimentQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYEAIKFRL
Ga0315295_1086955523300032156SedimentMQGVQKLRSEAHCQVRCNDEVEAQRSRWTFYETLTTD
Ga0315295_1122142313300032156SedimentELRSAAYLRVRCNDEVEAQSCSEQDRWTFYEIIKFACA
Ga0315281_1084892323300032163SedimentRSEAHLRVRRNDEVAAQRRRWTFYETIIFYSTSFASRIIL
Ga0315283_1203361123300032164SedimentMQGAQKLRSEAYLQVRCNDEVEAQRRRWTFYETINF
Ga0315276_1016895113300032177SedimentGAQKLRSETHLRVRRNDEVEAQRRRWTFYEAINLGRKIWRD
Ga0315276_1039296233300032177SedimentMPGAQKLRSEAHFKMHPNDEVAGQRRRWTFYETINIAISSTSNQE
Ga0315276_1127382323300032177SedimentMQGAQKLRSETHLRVRRNDEVEAQRRRWTFYEAIKIYK
Ga0315276_1211079613300032177SedimentMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCN
Ga0315276_1218588813300032177SedimentMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETINIGNSGKWT
Ga0315286_1006538513300032342SedimentMQGAQKLRSEANSPVRRNDEVEEQRRRWTFYETIRNKTMALRIYN
Ga0315286_1148298513300032342SedimentMQGAQKLRSEAHFKVRCNDEVKAQRSRWTFYETINFGFQK
Ga0315287_1030645633300032397SedimentMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINLGT
Ga0315287_1104005133300032397SedimentMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIRNNK
Ga0315287_1226106613300032397SedimentMQGAQKLRSEAYSQVRCNDEVEAQRSRWTFYETIKGFSMRRWER
Ga0315287_1250934423300032397SedimentMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETINYACFEGG
Ga0315275_1014873513300032401SedimentMQGAQKLRSAAHLRVRRNDEVAAQRSRRTFYETIEGGSCP
Ga0315275_1020999513300032401SedimentMQGAQNVRSEAYLQVRRNDEGEAQRRRWTFYEAVKF
Ga0315275_1063305013300032401SedimentMQGAQKLKSEAHLRVRCNDEVEAQRRRWTFYETINFRHF
Ga0315275_1078443323300032401SedimentQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKI
Ga0315275_1116242313300032401SedimentMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYETIKCNS
Ga0315275_1157663413300032401SedimentLQMQGAQKLRSEAYLHVRWNDEVEAQRSRWTFYETILIKSLQTREFLVKIK
Ga0315275_1202034413300032401SedimentMQGAQNVRSEAYLQVRRNDEGEAQRRRWTFYEAIIVKNRM
Ga0315275_1267847313300032401SedimentMQGAQKLRSEAYLHVRCNDEVEAQSRSERDRWTFYETIKIGSFAP
Ga0315273_1022624623300032516SedimentMQGAQKLRSAAHLQLRRNEEVAAQRSRWTFYETINYACFEGGGSMSLG
Ga0315273_1031373143300032516SedimentAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKTKRL
Ga0315273_1032535233300032516SedimentKLQMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIKIHFP
Ga0315273_1033477333300032516SedimentKLQMQGAQKLRSEAYLHVRCNDEVEAQSRSERETFYETTTLY
Ga0315273_1038116723300032516SedimentMQGAQKLRSEAYYQVRCNDEVEAQRRRWTFYETINI
Ga0315273_1057112623300032516SedimentMQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETIKISPFEKGG
Ga0315273_1064922113300032516SedimentMQGAQKLRREAHLRVRRNDEVEAQRSRWTFYETIKFC
Ga0315273_1135846413300032516SedimentQGAQELRSEAYLHVRCNDEVEAQRSRWTFYETINFDNSITKGVQAGQ
Ga0315273_1136795613300032516SedimentMQGAQKLRSEAYLQVRCNDEVEAQRSRWTFYEAIKLVS
Ga0315273_1229126313300032516SedimentKKLQMPGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKKP
Ga0315273_1304502513300032516SedimentMPGAQKLRSEAHLRVRRNDEVEAQRRRWTFYETIFIVST
Ga0316604_1001962353300033406SoilMQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT
Ga0316604_1004361613300033406SoilRKKLQMPGGQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIKI
Ga0316604_1067633723300033406SoilLQMQGAQKLRNEAHLQVRLNDEVAAQRRRWTFNETIKVNIFINVP
Ga0316605_1003707343300033408SoilMQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYETIKI
Ga0316605_1005934713300033408SoilMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYETIKLDSFLS
Ga0316605_1024781823300033408SoilMQGAQKLWREAHMQVRRNDEVEAQRRRWTFHEVIKKEREHGPSS
Ga0316605_1037509223300033408SoilMQGAQKLRSEAHLLVRRNDEVEAQRSRWTFYEVINN
Ga0316605_1051491513300033408SoilRFCKKLQMQGARKLRSEVHFGARRNDEVEAQRRSWTFYETVNV
Ga0316605_1057563123300033408SoilGAQNLRSAAHLPVRRNDEVAAQRRRWTFYETIKFDLANT
Ga0316605_1064318233300033408SoilMQGAQKLRSEAHFQVRRNDEVEAQRRRWTFYEIITS
Ga0316605_1095912523300033408SoilMQGAQELRSGAHMQVRRNDEVEAQRRRWIFYETIMLW
Ga0316605_1135107423300033408SoilMQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETIKN
Ga0316605_1207748723300033408SoilMQGAQKLRSEPHLRVRRSDEGEAQRRGWTFYETIKKLKGGDSK
Ga0316605_1216846513300033408SoilMQGALKLRNEADLLVRRNNEVAAQRRRWTFYEVILFTFSWELP
Ga0316603_1009472543300033413SoilMPGAQKLWSEAHLQVRRNDEVAAQSRSERDRWTFYETIKI
Ga0316603_1038272233300033413SoilKLQMPGAQKLRSEGHLQVRRNDEVAAQSRSERDRWTFYETIK
Ga0316603_1041200543300033413SoilMQGAQKLRSEAHLQVRRSDEVEVQRRRWTFYETISFHG
Ga0316603_1075916723300033413SoilMQGAQKLRNAAHLQVRRNDEVEAQRSRWTFYETIKKDS
Ga0316603_1123632313300033413SoilMPGAQKLRSEAHLPVRRNDEVAAQRRRWTFYESIKFDL
Ga0316603_1173608823300033413SoilMQGAQKLRSEAHLRVRRNDEVAAQRSRWTFYETIF
Ga0316603_1193213623300033413SoilMQGAQKLRSEAHIWVRRNDEVEAQSRSERDRWTFYETIKGDGILKGDAR
Ga0316603_1219558713300033413SoilMQGTQKLRSEAHLCVRRNDEVEAQRSRWTFYETIKFS
Ga0316619_1013805413300033414SoilQMQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITILFLKK
Ga0316619_1046785513300033414SoilMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEAIK
Ga0316619_1056928613300033414SoilMEGAQNLRSEAHLQVSRNDEVTAQCRRWTFYETIKNYCFLCQRGPSE
Ga0316619_1109435213300033414SoilMQGAQKLRSEAHLWVRRSDVVAAQSRSERDRWTFYETISAGFSSG
Ga0316619_1110601423300033414SoilMQGARKLRSEAYEPVRCNDEGEAQRGRWTFYEDIISRSRIPGSCSKA
Ga0316619_1193371913300033414SoilRKKLQVQGAQKLRSEAHLQVRRNDEVAAQRRRWTFY
Ga0316619_1200209313300033414SoilMQGAQKLRNEAHLLVRRNDEVAAQRRRWTFYEVLRFSWSLRPVSLSP
Ga0316622_10024943113300033416SoilQKLRSEAHLQVRRNDEVAAQSRSERDGWTFCETIKFGG
Ga0316625_10013259633300033418SoilMQGAQKLSSEAHFRVRRSDEVAAQSRSERDRWTFYETITI
Ga0316625_10104750923300033418SoilLQGTQKLRSEAHLRVRRSDEVEAQRRRWTFYETINNY
Ga0316625_10106706713300033418SoilMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYQVINFDSEFPET
Ga0316601_10000525713300033419SoilMQGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIFFE
Ga0316601_10044026513300033419SoilKKLQMQGAQKLRSEAHLLVRRNDEVEAQRSRWTFYEVINN
Ga0316601_10114070613300033419SoilMQGAQKLRSEAHFQVRRNDEVAAQRRRWTFYETIKFGKAVS
Ga0316601_10182549323300033419SoilQGVQKLRSEAHLQVRRNDEVAAQRRRWTFYETINVGIQE
Ga0316601_10260135313300033419SoilMQGAQKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMPG
Ga0316601_10263211113300033419SoilMQGALKLRNEADLLVRRNNEVAAQRRRWTFYEVILFTFSWE
Ga0326726_1009385243300033433Peat SoilLQMQGAQKLRSEAHLQVRRNDEVAAHRRWTFYEAIKKNEIN
Ga0326726_1035277323300033433Peat SoilMQGAQKLRSEVHLQVRRNDEVAAQRSRWTFYETITFF
Ga0326726_1042616233300033433Peat SoilQMQGAQELRREAYLRVRRNDEGEGQRRRWTFYEAIKLR
Ga0326726_1110725413300033433Peat SoilMQGAQKLRSEAHSRVRRNDEVAAQRRRWTFYETIKFSEK
Ga0326726_1185959033300033433Peat SoilKLQMQGAQELRSEAYLLVRCNDEVEAQRRRWTFYETIIFPSP
Ga0316613_1030101423300033434SoilFREKLQLQGAQKLRSEAHLRVRRNDEVAAQRRRWTFYETINKA
Ga0316620_1021079733300033480SoilQMQGARKLRSEVHFGARRNDEVEAQRRSWTFYETVNV
Ga0316620_1050018923300033480SoilMPGAQKLSSEAHFRVRRNDEVAAQRSRWTFYEIILF
Ga0316620_1064881523300033480SoilMQGAQKLRSEAHVQVRRNDEVEAQRSSWTFYEAIKVA
Ga0316620_1140791913300033480SoilMVSKKLQMQGAQEMRSEAYEHVRCNDEVEARRSRWTSYK
Ga0316620_1197207423300033480SoilMQGAQKLRKEAHEQVRRNDEVAAQRRRRTFYETITC
Ga0316620_1232858923300033480SoilMPGAQKLRSEARLQVRRNDEVEAQRRRWIFYETIKF
Ga0316600_1006803113300033481SoilMPGAQKLRSEAHLPVRRNDEVAAQRRRWTFYETIKFDLANT
Ga0316600_1014649023300033481SoilMQGAQKLRSEAHLQVRRNDEVAAQSRSGRDRWTFYETIN
Ga0316600_1022636813300033481SoilMQGAQKLRSEAHLQVRRNNEVAAQRRRWTFYETINFLPLKKDV
Ga0316600_1052837213300033481SoilMQGAQKLRNEAHLQVRLNDEVAAQRRRWTFYETIKVNIFINVP
Ga0316600_1098524223300033481SoilMQGAQKLRSEAHILVRRSDEVEAQRSRWTFYEAIKIVAS
Ga0316600_1103766423300033481SoilMQGAQKLRSAAHAYVRRNDEGEAQSRSERDRWACYE
Ga0316600_1120101623300033481SoilKKLQMQGARKLRSEVHFGARRNDEVEAQRRSWTFYETVNV
Ga0316627_10039353323300033482SoilMQGAQKLRSEAHLQVRRSDEVEAQRSGWTFYETINIE
Ga0316627_10041931933300033482SoilMPGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIK
Ga0316627_10048919713300033482SoilLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIKIGGI
Ga0316627_10106566413300033482SoilMQGAQKLRSEAHLRVRRSDEVEAQSRSEWDRRTFYETI
Ga0316627_10150450113300033482SoilPQMQGTQKLRSEAHISVRRNDEVEAQRSRWTFYEVI
Ga0316627_10161493213300033482SoilGAQKLRSEAHLQVRRNDEVAAQRRRWTFCETSKSVKT
Ga0316627_10225916213300033482SoilMQGAQKLRSEAHFWVCRNDEFEAPHRRETFYETIY
Ga0316627_10290676013300033482SoilQKLRSEAHNQVRRSDEVEAQSRSERDRWTFYETFNC
Ga0316629_1020226913300033483SoilKLQMQGAQKLRSQAHLRVRRNDEVEAQRRRWTFYEVINFDK
Ga0316626_1003822213300033485SoilKLRSEAHLRVRRSDEVEAQSRSERDRWTFYETILFGFMPG
Ga0316626_1005654333300033485SoilMQGAQKLRSEAYTEVRGNDEVEAQRRRWTFYGTIAKGTGP
Ga0316626_1046946423300033485SoilLAPAMQGAQKLRSGAHLRVRRNDEVAAQRRRWTFYETINKA
Ga0316626_1049925223300033485SoilMQGAQKLRSGAHLQVRRNNEVAAQRRRWTFYETIKN
Ga0316626_1056411523300033485SoilMQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFYETIKIGGI
Ga0316626_1080993413300033485SoilMQGAQKLRNEAHLQVRRNDEVEAQRSRWTFYETITLDFF
Ga0316626_1095775023300033485SoilMPGTQKLRSEAHLRVRRSDVVAAQSRSERDRWTFYETINFAVFTH
Ga0316626_1098731713300033485SoilMQGGQKLRSEAHLRVRLSDEVEAQRRRWTFYETIKI
Ga0316626_1099633023300033485SoilMQGAQKLRSEAHIWVRRKDEAAAQRRRWTFSEVITL
Ga0316624_1030706323300033486SoilMQGAQKLRSEVHFQVRRNDEVEAERSRWIFYKTIRSRK
Ga0316624_1129045413300033486SoilMQGAQNLKGEAYLQVRRNNEVVAQSRSERDRWTFLQ
Ga0316624_1192087813300033486SoilMQGSQKLRSETYFQARCNDEVEAQRRRWTFYETIKV
Ga0316630_1001616753300033487SoilKLRSEAHLQVRRNDEVAAQSRSERDGWTFCETIKFGG
Ga0316630_1057494223300033487SoilMQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFY
Ga0316630_1058387713300033487SoilQGAQKLRSEAHLQVRRNDEVAAQRRRWTFCETSKSVKT
Ga0316621_1016693113300033488SoilGAQKLRSEAHIYVRRSDEVAAQPRSERDRWTFYRTI
Ga0316621_1033682513300033488SoilMQGAQKLRSEAHLQVRRNDEVAAQSRSERDRWTFCETSKSVKT
Ga0316621_1126275823300033488SoilMQGAQNLRSEAHLQVRRNDGVAAQRRRWTFYEVINFIDF
Ga0299912_1026785813300033489SoilQMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIKI
Ga0299912_1038827233300033489SoilMQGAQKLRSEAYLHVRCNDEVEAQRSRWTFYETIK
Ga0299912_1045670413300033489SoilMKGAQKLRSEAYFHVRCNDEVEAQRSRWTFYETIEIEDNPD
Ga0316628_10132574523300033513SoilMQGAQKLRSEPHNQVRRNDEVEAQRSRWTFYEPVIFRIY
Ga0316628_10145821113300033513SoilTNHGAQKLRSEAHFQGRRSDEVAAQRHRWTFCETIKFGG
Ga0316628_10344348623300033513SoilMQGAQKLRSEAHLQVRRNDEVEAQRRRWTFYEAIKIY
Ga0316616_10025880723300033521SoilMQGAQELRSEAHLQVRRNDEVEAQRSRWTFYETIIF
Ga0316616_10039316823300033521SoilMQGAQKLRSEAHLQMRRNDEVAAQRRRWTFYETIKFLLPPFL
Ga0316616_10065097213300033521SoilMQGAQELRSEAHIWVRRNDEVEAQSRSERDRWTFYETIKGDGILKGDAR
Ga0316616_10127902013300033521SoilLRSEAHLQVRRNDEVAAQRSRWTFYETINFRRFSACKAF
Ga0316616_10206667113300033521SoilMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEVINLHF
Ga0316616_10294029813300033521SoilCKKFQMKGAQKLRSEAHLGVRRNDEVAAQRRRWTFYEAIRG
Ga0316616_10332231313300033521SoilQKLRSEAHSQVRRNDEIKAQRRRGTLYETIKEKIIPYP
Ga0316616_10375597023300033521SoilMQVAQKRKSAAHLQVRRNDEVEAQGRRWTSYETIKIDQFGR
Ga0316617_10000421733300033557SoilMQGAQKLRSEAHLGVRRNGEVEAQRRRWTFNEVIKF
Ga0316617_10066555513300033557SoilKLQMQGAQKLRSEAHLRVRRNDEVEAQRRRWTFYQVINFDSEFPET
Ga0316617_10143686813300033557SoilMQGTQKLRSEAHLLVRRNDEVEAQRSRWTFYETMKKGR
Ga0316617_10211932513300033557SoilMQGAQKLRSEAHLQVRRNDEVAAQRRRWTFYEAIN
Ga0316617_10248924323300033557SoilMQGAQKLRSEAHLLVRRNDEIEAQRRRWAFYEFINL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.