NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F003149

Metatranscriptome Family F003149

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F003149
Family Type Metatranscriptome
Number of Sequences 504
Average Sequence Length 136 residues
Representative Sequence MASVAALLFLCLSGAQASNLRLTNSTSSVVQHESMHLAAKADMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Number of Associated Samples 139
Number of Associated Scaffolds 504

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 19.88 %
% of genes near scaffold ends (potentially truncated) 39.68 %
% of genes from short scaffolds (< 2000 bps) 99.80 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.802 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(65.278 % of family members)
Environment Ontology (ENVO) Unclassified
(88.889 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(75.198 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 26.28%    β-sheet: 19.87%    Coil/Unstructured: 53.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.80 %
UnclassifiedrootN/A0.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009028|Ga0103708_100084979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata766Open in IMG/M
3300009028|Ga0103708_100293758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300009606|Ga0115102_10716204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300009608|Ga0115100_10002266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300009608|Ga0115100_10157892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300009608|Ga0115100_10975376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300010981|Ga0138316_10226693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300010981|Ga0138316_10470792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300010981|Ga0138316_10800328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300010981|Ga0138316_10981171All Organisms → cellular organisms → Eukaryota → Sar586Open in IMG/M
3300010981|Ga0138316_11322264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300010981|Ga0138316_11451448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300010981|Ga0138316_11637138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300010981|Ga0138316_11640838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300010985|Ga0138326_10828561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300010985|Ga0138326_11504103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300010986|Ga0138327_11237455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300010987|Ga0138324_10683116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300010987|Ga0138324_10702058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300010987|Ga0138324_10705195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300010987|Ga0138324_10718207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300010987|Ga0138324_10722169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300012414|Ga0138264_1077848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata533Open in IMG/M
3300012414|Ga0138264_1699743All Organisms → cellular organisms → Eukaryota → Sar554Open in IMG/M
3300012415|Ga0138263_1075052All Organisms → cellular organisms → Eukaryota → Sar535Open in IMG/M
3300012415|Ga0138263_1783426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300012415|Ga0138263_1845385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata581Open in IMG/M
3300012416|Ga0138259_1189578All Organisms → cellular organisms → Eukaryota → Sar530Open in IMG/M
3300012416|Ga0138259_1200016All Organisms → cellular organisms → Eukaryota → Sar588Open in IMG/M
3300012416|Ga0138259_1444335All Organisms → cellular organisms → Eukaryota → Sar518Open in IMG/M
3300012416|Ga0138259_1519722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300012416|Ga0138259_1576856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300012416|Ga0138259_1694292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300012417|Ga0138262_1303552All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300012417|Ga0138262_1493313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300012418|Ga0138261_1482093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300012419|Ga0138260_10186230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata633Open in IMG/M
3300012419|Ga0138260_10273943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata599Open in IMG/M
3300012419|Ga0138260_10280448All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300012419|Ga0138260_10386124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata578Open in IMG/M
3300012419|Ga0138260_10484363All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300012419|Ga0138260_10868208All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300012419|Ga0138260_10924437All Organisms → cellular organisms → Eukaryota → Sar519Open in IMG/M
3300012782|Ga0138268_1143236All Organisms → cellular organisms → Eukaryota → Sar590Open in IMG/M
3300012782|Ga0138268_1435773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300012935|Ga0138257_1382682All Organisms → cellular organisms → Eukaryota → Sar616Open in IMG/M
3300012935|Ga0138257_1667538All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300012935|Ga0138257_1680371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300018732|Ga0193381_1061914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300018755|Ga0192896_1071235All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300018755|Ga0192896_1072501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300018773|Ga0193396_1077125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300018781|Ga0193380_1075199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata518Open in IMG/M
3300018810|Ga0193422_1084299All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300018831|Ga0192949_1085373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata609Open in IMG/M
3300018831|Ga0192949_1099583All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata548Open in IMG/M
3300018831|Ga0192949_1103858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300018836|Ga0192870_1092686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300018842|Ga0193219_1071748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300018846|Ga0193253_1105180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata653Open in IMG/M
3300018846|Ga0193253_1110479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata630Open in IMG/M
3300018846|Ga0193253_1113908All Organisms → cellular organisms → Eukaryota → Sar616Open in IMG/M
3300018849|Ga0193005_1069920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata546Open in IMG/M
3300018862|Ga0193308_1082365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300018862|Ga0193308_1084580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300018864|Ga0193421_1122599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300018874|Ga0192977_1105972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300018889|Ga0192901_1133933All Organisms → cellular organisms → Eukaryota → Sar508Open in IMG/M
3300018899|Ga0193090_1088483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata713Open in IMG/M
3300018899|Ga0193090_1137906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300018899|Ga0193090_1140147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300018905|Ga0193028_1110843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300018905|Ga0193028_1116283All Organisms → cellular organisms → Eukaryota → Sar514Open in IMG/M
3300018926|Ga0192989_10163511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300018928|Ga0193260_10147524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300018945|Ga0193287_1140772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300018955|Ga0193379_10205128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300018955|Ga0193379_10220364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300018955|Ga0193379_10225228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300019003|Ga0193033_10213602All Organisms → cellular organisms → Eukaryota → Sar533Open in IMG/M
3300021169|Ga0206687_1071572All Organisms → cellular organisms → Eukaryota → Sar558Open in IMG/M
3300021345|Ga0206688_10207336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300021345|Ga0206688_10398491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300021350|Ga0206692_1553550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300021353|Ga0206693_1336830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300021353|Ga0206693_1429231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300021359|Ga0206689_10232640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300021359|Ga0206689_10545010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300021874|Ga0063147_119000All Organisms → cellular organisms → Eukaryota → Sar602Open in IMG/M
3300021887|Ga0063105_1067412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300021898|Ga0063097_1042598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300021902|Ga0063086_1026044All Organisms → cellular organisms → Eukaryota → Sar542Open in IMG/M
3300021902|Ga0063086_1055848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300021910|Ga0063100_1011280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300021910|Ga0063100_1026283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300021910|Ga0063100_1045542All Organisms → cellular organisms → Eukaryota → Sar507Open in IMG/M
3300021911|Ga0063106_1008655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300021911|Ga0063106_1015093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300021911|Ga0063106_1045140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300021911|Ga0063106_1052788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300021911|Ga0063106_1053647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300021927|Ga0063103_1055034All Organisms → cellular organisms → Eukaryota → Sar502Open in IMG/M
3300021927|Ga0063103_1066036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300021927|Ga0063103_1066783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300021927|Ga0063103_1067889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300021927|Ga0063103_1076003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata546Open in IMG/M
3300021927|Ga0063103_1171975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300021930|Ga0063145_1091923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300021930|Ga0063145_1131525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300021936|Ga0063092_1188144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata546Open in IMG/M
3300021939|Ga0063095_1125815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300021940|Ga0063108_1064573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300021941|Ga0063102_1056907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300021941|Ga0063102_1060396All Organisms → cellular organisms → Eukaryota → Sar509Open in IMG/M
3300021941|Ga0063102_1089477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300021941|Ga0063102_1126118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300021943|Ga0063094_1118719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata570Open in IMG/M
3300028106|Ga0247596_1164434All Organisms → cellular organisms → Eukaryota → Sar508Open in IMG/M
3300028109|Ga0247582_1181697All Organisms → cellular organisms → Eukaryota → Sar535Open in IMG/M
3300028575|Ga0304731_10032274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300028575|Ga0304731_10487772All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300028575|Ga0304731_10784006All Organisms → cellular organisms → Eukaryota → Sar586Open in IMG/M
3300028575|Ga0304731_10811105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300028575|Ga0304731_11338080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300028575|Ga0304731_11466031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300030653|Ga0307402_10656285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300030653|Ga0307402_10713274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M
3300030653|Ga0307402_10715462All Organisms → cellular organisms → Eukaryota → Sar583Open in IMG/M
3300030653|Ga0307402_10780816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata557Open in IMG/M
3300030653|Ga0307402_10782290All Organisms → cellular organisms → Eukaryota → Sar557Open in IMG/M
3300030653|Ga0307402_10786119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300030653|Ga0307402_10799051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300030653|Ga0307402_10803412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300030653|Ga0307402_10819697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300030653|Ga0307402_10838654All Organisms → cellular organisms → Eukaryota → Sar537Open in IMG/M
3300030653|Ga0307402_10840162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300030653|Ga0307402_10845022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300030653|Ga0307402_10888991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300030653|Ga0307402_10891135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300030653|Ga0307402_10898441All Organisms → cellular organisms → Eukaryota → Sar516Open in IMG/M
3300030653|Ga0307402_10902952All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300030653|Ga0307402_10903125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300030653|Ga0307402_10913168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300030653|Ga0307402_10916411All Organisms → cellular organisms → Eukaryota → Sar510Open in IMG/M
3300030653|Ga0307402_10920549All Organisms → cellular organisms → Eukaryota → Sar509Open in IMG/M
3300030653|Ga0307402_10928308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300030653|Ga0307402_10931093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii505Open in IMG/M
3300030670|Ga0307401_10424969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata604Open in IMG/M
3300030670|Ga0307401_10468761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata573Open in IMG/M
3300030670|Ga0307401_10473235All Organisms → cellular organisms → Eukaryota → Sar570Open in IMG/M
3300030670|Ga0307401_10512917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata546Open in IMG/M
3300030670|Ga0307401_10535905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata533Open in IMG/M
3300030670|Ga0307401_10571300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300030670|Ga0307401_10572456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii513Open in IMG/M
3300030670|Ga0307401_10586541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300030670|Ga0307401_10587200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300030670|Ga0307401_10587251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300030670|Ga0307401_10591741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300030671|Ga0307403_10528672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata638Open in IMG/M
3300030671|Ga0307403_10538668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata632Open in IMG/M
3300030671|Ga0307403_10559566All Organisms → cellular organisms → Eukaryota → Sar619Open in IMG/M
3300030671|Ga0307403_10617801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata588Open in IMG/M
3300030671|Ga0307403_10644778All Organisms → cellular organisms → Eukaryota → Sar575Open in IMG/M
3300030671|Ga0307403_10646921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300030671|Ga0307403_10668493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300030671|Ga0307403_10694278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300030671|Ga0307403_10705681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300030671|Ga0307403_10750489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300030671|Ga0307403_10756708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300030671|Ga0307403_10762880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300030671|Ga0307403_10763182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300030671|Ga0307403_10771304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300030671|Ga0307403_10774205All Organisms → cellular organisms → Eukaryota → Sar522Open in IMG/M
3300030671|Ga0307403_10775150All Organisms → cellular organisms → Eukaryota → Sar522Open in IMG/M
3300030671|Ga0307403_10776884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300030671|Ga0307403_10790720All Organisms → cellular organisms → Eukaryota → Sar516Open in IMG/M
3300030671|Ga0307403_10797334All Organisms → cellular organisms → Eukaryota → Sar513Open in IMG/M
3300030671|Ga0307403_10798684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300030671|Ga0307403_10805775All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300030671|Ga0307403_10816383All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300030671|Ga0307403_10823468All Organisms → cellular organisms → Eukaryota → Sar504Open in IMG/M
3300030671|Ga0307403_10833034All Organisms → cellular organisms → Eukaryota → Sar500Open in IMG/M
3300030699|Ga0307398_10588470All Organisms → cellular organisms → Eukaryota → Sar615Open in IMG/M
3300030699|Ga0307398_10720581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300030699|Ga0307398_10729173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300030699|Ga0307398_10732256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300030699|Ga0307398_10751655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300030699|Ga0307398_10762756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300030699|Ga0307398_10769861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata533Open in IMG/M
3300030699|Ga0307398_10781279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300030699|Ga0307398_10822006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii512Open in IMG/M
3300030699|Ga0307398_10825535All Organisms → cellular organisms → Eukaryota → Sar511Open in IMG/M
3300030699|Ga0307398_10828778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300030699|Ga0307398_10831062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300030699|Ga0307398_10843463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300030699|Ga0307398_10855717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300030702|Ga0307399_10591410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata548Open in IMG/M
3300030702|Ga0307399_10592683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300030702|Ga0307399_10592695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300030702|Ga0307399_10596025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata546Open in IMG/M
3300030702|Ga0307399_10606755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300030702|Ga0307399_10614464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300030702|Ga0307399_10616572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300030702|Ga0307399_10636597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300030702|Ga0307399_10640834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300030702|Ga0307399_10645386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300030702|Ga0307399_10656174All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300030702|Ga0307399_10676838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300030702|Ga0307399_10677551All Organisms → cellular organisms → Eukaryota → Sar511Open in IMG/M
3300030702|Ga0307399_10684702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300030702|Ga0307399_10686581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300030709|Ga0307400_10724203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata617Open in IMG/M
3300030709|Ga0307400_10831902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300030709|Ga0307400_10874643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300030709|Ga0307400_10880245All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300030709|Ga0307400_10894231All Organisms → cellular organisms → Eukaryota → Sar545Open in IMG/M
3300030709|Ga0307400_10908023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300030709|Ga0307400_10927575All Organisms → cellular organisms → Eukaryota → Sar532Open in IMG/M
3300030709|Ga0307400_10937304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300030709|Ga0307400_10938955All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300030709|Ga0307400_10939550All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300030709|Ga0307400_10961869All Organisms → cellular organisms → Eukaryota → Sar520Open in IMG/M
3300030709|Ga0307400_10994724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300030709|Ga0307400_11006294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300030720|Ga0308139_1071359All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300030722|Ga0308137_1096013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300030728|Ga0308136_1135801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata558Open in IMG/M
3300030728|Ga0308136_1148414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300030750|Ga0073967_11803922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300030756|Ga0073968_11842641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300030786|Ga0073966_11529413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300030786|Ga0073966_11720556All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata603Open in IMG/M
3300030788|Ga0073964_11575664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300030788|Ga0073964_11637407All Organisms → cellular organisms → Eukaryota → Sar522Open in IMG/M
3300030788|Ga0073964_11677711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata940Open in IMG/M
3300030788|Ga0073964_11723489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300030859|Ga0073963_11430188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300030952|Ga0073938_11979397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300030957|Ga0073976_11605463All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300031062|Ga0073989_13380889All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300031062|Ga0073989_13427478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300031063|Ga0073961_11646655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300031063|Ga0073961_12115133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300031113|Ga0138347_10052101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300031113|Ga0138347_10687173All Organisms → cellular organisms → Eukaryota → Sar529Open in IMG/M
3300031113|Ga0138347_11336562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata523Open in IMG/M
3300031121|Ga0138345_10826339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300031121|Ga0138345_11050625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata548Open in IMG/M
3300031445|Ga0073952_10912422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300031459|Ga0073950_11149976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300031459|Ga0073950_11338465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300031465|Ga0073954_10650567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300031522|Ga0307388_10920310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata590Open in IMG/M
3300031522|Ga0307388_10922357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata589Open in IMG/M
3300031522|Ga0307388_10963106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata576Open in IMG/M
3300031522|Ga0307388_11054962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300031522|Ga0307388_11120517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300031522|Ga0307388_11129334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300031522|Ga0307388_11149949All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300031522|Ga0307388_11161144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300031522|Ga0307388_11174460All Organisms → cellular organisms → Eukaryota → Sar522Open in IMG/M
3300031522|Ga0307388_11196231All Organisms → cellular organisms → Eukaryota → Sar517Open in IMG/M
3300031522|Ga0307388_11232747All Organisms → cellular organisms → Eukaryota → Sar510Open in IMG/M
3300031522|Ga0307388_11236034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300031579|Ga0308134_1160365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300031580|Ga0308132_1126866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300031580|Ga0308132_1131122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata515Open in IMG/M
3300031580|Ga0308132_1137494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300031674|Ga0307393_1118266All Organisms → cellular organisms → Eukaryota → Sar585Open in IMG/M
3300031674|Ga0307393_1150143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300031709|Ga0307385_10404283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300031710|Ga0307386_10507398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata631Open in IMG/M
3300031710|Ga0307386_10544171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300031710|Ga0307386_10560882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300031710|Ga0307386_10563524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata600Open in IMG/M
3300031710|Ga0307386_10614079All Organisms → cellular organisms → Eukaryota → Sar577Open in IMG/M
3300031710|Ga0307386_10619618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300031710|Ga0307386_10669668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300031710|Ga0307386_10718091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300031710|Ga0307386_10732805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300031710|Ga0307386_10733435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300031710|Ga0307386_10739084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300031710|Ga0307386_10770263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata518Open in IMG/M
3300031710|Ga0307386_10781439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii514Open in IMG/M
3300031710|Ga0307386_10783510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300031710|Ga0307386_10785071All Organisms → cellular organisms → Eukaryota → Sar513Open in IMG/M
3300031710|Ga0307386_10806273All Organisms → cellular organisms → Eukaryota → Sar507Open in IMG/M
3300031710|Ga0307386_10807366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300031717|Ga0307396_10451318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata617Open in IMG/M
3300031717|Ga0307396_10482551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300031717|Ga0307396_10543595All Organisms → cellular organisms → Eukaryota → Sar558Open in IMG/M
3300031717|Ga0307396_10635716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300031725|Ga0307381_10256893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata621Open in IMG/M
3300031725|Ga0307381_10302296All Organisms → cellular organisms → Eukaryota → Sar576Open in IMG/M
3300031725|Ga0307381_10341546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300031725|Ga0307381_10351763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300031729|Ga0307391_10755275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300031729|Ga0307391_10759599All Organisms → cellular organisms → Eukaryota → Sar554Open in IMG/M
3300031729|Ga0307391_10772100All Organisms → cellular organisms → Eukaryota → Sar550Open in IMG/M
3300031729|Ga0307391_10847604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300031729|Ga0307391_10897710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300031729|Ga0307391_10909940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300031729|Ga0307391_10915274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300031734|Ga0307397_10517864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata558Open in IMG/M
3300031734|Ga0307397_10543688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300031734|Ga0307397_10549688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300031734|Ga0307397_10562813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata535Open in IMG/M
3300031734|Ga0307397_10570532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300031734|Ga0307397_10572699All Organisms → cellular organisms → Eukaryota → Sar530Open in IMG/M
3300031734|Ga0307397_10590894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300031734|Ga0307397_10599099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300031734|Ga0307397_10602141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300031734|Ga0307397_10616137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300031734|Ga0307397_10620733All Organisms → cellular organisms → Eukaryota → Sar507Open in IMG/M
3300031735|Ga0307394_10316256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata621Open in IMG/M
3300031735|Ga0307394_10395300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300031735|Ga0307394_10395918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300031735|Ga0307394_10437446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300031735|Ga0307394_10456775All Organisms → cellular organisms → Eukaryota → Sar513Open in IMG/M
3300031735|Ga0307394_10464258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300031735|Ga0307394_10465450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300031735|Ga0307394_10479537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300031737|Ga0307387_10668866All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata652Open in IMG/M
3300031737|Ga0307387_10904201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300031737|Ga0307387_10936099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300031737|Ga0307387_11025453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300031737|Ga0307387_11091170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300031737|Ga0307387_11104393All Organisms → cellular organisms → Eukaryota → Sar508Open in IMG/M
3300031737|Ga0307387_11106130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300031737|Ga0307387_11114150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300031737|Ga0307387_11124714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii503Open in IMG/M
3300031738|Ga0307384_10458947All Organisms → cellular organisms → Eukaryota → Sar599Open in IMG/M
3300031738|Ga0307384_10535992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300031738|Ga0307384_10536181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300031738|Ga0307384_10573171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300031738|Ga0307384_10577952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300031738|Ga0307384_10597284All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300031738|Ga0307384_10606568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300031738|Ga0307384_10620886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata519Open in IMG/M
3300031738|Ga0307384_10649244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300031738|Ga0307384_10654295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300031738|Ga0307384_10662345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300031738|Ga0307384_10664557All Organisms → cellular organisms → Eukaryota → Sar503Open in IMG/M
3300031738|Ga0307384_10665765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300031738|Ga0307384_10673873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300031739|Ga0307383_10673278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300031739|Ga0307383_10674631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300031739|Ga0307383_10678862All Organisms → cellular organisms → Eukaryota → Sar524Open in IMG/M
3300031739|Ga0307383_10678943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300031739|Ga0307383_10681374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata523Open in IMG/M
3300031739|Ga0307383_10691712All Organisms → cellular organisms → Eukaryota → Sar519Open in IMG/M
3300031739|Ga0307383_10729610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300031739|Ga0307383_10745589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300031742|Ga0307395_10389974All Organisms → cellular organisms → Eukaryota → Sar605Open in IMG/M
3300031742|Ga0307395_10424264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300031742|Ga0307395_10457633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata557Open in IMG/M
3300031742|Ga0307395_10478019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300031742|Ga0307395_10483042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300031742|Ga0307395_10491864All Organisms → cellular organisms → Eukaryota → Sar536Open in IMG/M
3300031742|Ga0307395_10493903All Organisms → cellular organisms → Eukaryota → Sar535Open in IMG/M
3300031742|Ga0307395_10499020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300031742|Ga0307395_10505374All Organisms → cellular organisms → Eukaryota → Sar529Open in IMG/M
3300031742|Ga0307395_10518924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300031743|Ga0307382_10393883All Organisms → cellular organisms → Eukaryota → Sar628Open in IMG/M
3300031743|Ga0307382_10394255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata628Open in IMG/M
3300031743|Ga0307382_10482332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300031743|Ga0307382_10503930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300031743|Ga0307382_10570931All Organisms → cellular organisms → Eukaryota → Sar521Open in IMG/M
3300031743|Ga0307382_10587355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300031750|Ga0307389_10613688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata705Open in IMG/M
3300031750|Ga0307389_10797102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata619Open in IMG/M
3300031750|Ga0307389_10840849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata604Open in IMG/M
3300031750|Ga0307389_10912537All Organisms → cellular organisms → Eukaryota → Sar580Open in IMG/M
3300031750|Ga0307389_11151272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata518Open in IMG/M
3300031750|Ga0307389_11194636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata508Open in IMG/M
3300031750|Ga0307389_11207707All Organisms → cellular organisms → Eukaryota → Sar506Open in IMG/M
3300031750|Ga0307389_11214564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata504Open in IMG/M
3300031752|Ga0307404_10310755All Organisms → cellular organisms → Eukaryota → Sar655Open in IMG/M
3300031752|Ga0307404_10364265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata603Open in IMG/M
3300031752|Ga0307404_10443299All Organisms → cellular organisms → Eukaryota → Sar545Open in IMG/M
3300031752|Ga0307404_10445003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300031752|Ga0307404_10464710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300031752|Ga0307404_10470874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300031752|Ga0307404_10490006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300031752|Ga0307404_10511062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium andersonii506Open in IMG/M
3300032463|Ga0314684_10860110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300032463|Ga0314684_10871691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300032463|Ga0314684_10872633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300032463|Ga0314684_10880423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300032470|Ga0314670_10544839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata603Open in IMG/M
3300032481|Ga0314668_10419981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata689Open in IMG/M
3300032481|Ga0314668_10637021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300032491|Ga0314675_10390237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata695Open in IMG/M
3300032491|Ga0314675_10556662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300032491|Ga0314675_10656922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata510Open in IMG/M
3300032492|Ga0314679_10486609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300032492|Ga0314679_10531386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300032492|Ga0314679_10536366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300032517|Ga0314688_10453015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata697Open in IMG/M
3300032517|Ga0314688_10692064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300032517|Ga0314688_10716788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300032517|Ga0314688_10723360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata533Open in IMG/M
3300032517|Ga0314688_10743861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300032518|Ga0314689_10619027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300032518|Ga0314689_10619490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300032518|Ga0314689_10639308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300032518|Ga0314689_10684550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300032518|Ga0314689_10715136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300032519|Ga0314676_10561998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata675Open in IMG/M
3300032519|Ga0314676_10730016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata576Open in IMG/M
3300032519|Ga0314676_10769843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata557Open in IMG/M
3300032520|Ga0314667_10715431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300032520|Ga0314667_10763221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300032521|Ga0314680_10617249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata685Open in IMG/M
3300032521|Ga0314680_10877357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata564Open in IMG/M
3300032521|Ga0314680_11007010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300032521|Ga0314680_11068640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300032522|Ga0314677_10637347All Organisms → cellular organisms → Eukaryota → Sar559Open in IMG/M
3300032522|Ga0314677_10681197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300032540|Ga0314682_10546520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata636Open in IMG/M
3300032540|Ga0314682_10673789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata562Open in IMG/M
3300032540|Ga0314682_10741359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300032615|Ga0314674_10699111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300032615|Ga0314674_10720108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300032616|Ga0314671_10688044All Organisms → cellular organisms → Eukaryota → Sar549Open in IMG/M
3300032616|Ga0314671_10695554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300032616|Ga0314671_10751629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata521Open in IMG/M
3300032616|Ga0314671_10798711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300032617|Ga0314683_10837393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300032617|Ga0314683_10856007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300032617|Ga0314683_10899369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300032617|Ga0314683_10940843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300032650|Ga0314673_10416529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata691Open in IMG/M
3300032650|Ga0314673_10571306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata583Open in IMG/M
3300032650|Ga0314673_10646396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300032650|Ga0314673_10649110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300032650|Ga0314673_10659905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata537Open in IMG/M
3300032650|Ga0314673_10690651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300032651|Ga0314685_10619206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata588Open in IMG/M
3300032651|Ga0314685_10689693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300032666|Ga0314678_10491028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300032666|Ga0314678_10556778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300032707|Ga0314687_10423574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300032707|Ga0314687_10609413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata608Open in IMG/M
3300032707|Ga0314687_10714540All Organisms → cellular organisms → Eukaryota → Sar556Open in IMG/M
3300032707|Ga0314687_10751169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300032707|Ga0314687_10777148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300032708|Ga0314669_10455656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata703Open in IMG/M
3300032708|Ga0314669_10689572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300032708|Ga0314669_10736932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300032708|Ga0314669_10776043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata524Open in IMG/M
3300032711|Ga0314681_10698348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300032713|Ga0314690_10577821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300032713|Ga0314690_10599851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300032713|Ga0314690_10626714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300032714|Ga0314686_10606335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300032714|Ga0314686_10611539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata529Open in IMG/M
3300032723|Ga0314703_10330783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata629Open in IMG/M
3300032724|Ga0314695_1426340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300032727|Ga0314693_10611268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata591Open in IMG/M
3300032727|Ga0314693_10675816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata557Open in IMG/M
3300032727|Ga0314693_10805880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300032729|Ga0314697_10531799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300032730|Ga0314699_10531895All Organisms → cellular organisms → Eukaryota → Sar528Open in IMG/M
3300032732|Ga0314711_10492148All Organisms → cellular organisms → Eukaryota → Sar630Open in IMG/M
3300032732|Ga0314711_10628643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300032733|Ga0314714_10592370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata614Open in IMG/M
3300032733|Ga0314714_10758029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata527Open in IMG/M
3300032742|Ga0314710_10431426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300032743|Ga0314707_10379024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata739Open in IMG/M
3300032743|Ga0314707_10579162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata579Open in IMG/M
3300032744|Ga0314705_10685979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300032745|Ga0314704_10521654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata653Open in IMG/M
3300032745|Ga0314704_10714255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300032745|Ga0314704_10775485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata509Open in IMG/M
3300032745|Ga0314704_10795041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300032747|Ga0314712_10510529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300032747|Ga0314712_10604863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300032748|Ga0314713_10453270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300032750|Ga0314708_10389825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata681Open in IMG/M
3300032751|Ga0314694_10426828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300032752|Ga0314700_10647088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata558Open in IMG/M
3300032752|Ga0314700_10725853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata522Open in IMG/M
3300032755|Ga0314709_10619637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata653Open in IMG/M
3300032755|Ga0314709_10795960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300032755|Ga0314709_10835677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M
3300033572|Ga0307390_10650271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata660Open in IMG/M
3300033572|Ga0307390_10657013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata656Open in IMG/M
3300033572|Ga0307390_10668497All Organisms → cellular organisms → Eukaryota → Sar651Open in IMG/M
3300033572|Ga0307390_10813734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata589Open in IMG/M
3300033572|Ga0307390_10853115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300033572|Ga0307390_10864086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata571Open in IMG/M
3300033572|Ga0307390_10913214All Organisms → cellular organisms → Eukaryota → Sar555Open in IMG/M
3300033572|Ga0307390_10949770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300033572|Ga0307390_10951342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300033572|Ga0307390_11010657All Organisms → cellular organisms → Eukaryota → Sar527Open in IMG/M
3300033572|Ga0307390_11019943All Organisms → cellular organisms → Eukaryota → Sar525Open in IMG/M
3300033572|Ga0307390_11038994All Organisms → cellular organisms → Eukaryota → Sar520Open in IMG/M
3300033572|Ga0307390_11051585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300033572|Ga0307390_11069413All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300033572|Ga0307390_11071747All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300033572|Ga0307390_11075997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300033572|Ga0307390_11089871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine65.28%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater20.04%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.14%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine5.16%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.59%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.40%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.40%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010986Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 9)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018732Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789574-ERR1719298)EnvironmentalOpen in IMG/M
3300018755Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000720 (ERX1789582-ERR1719407)EnvironmentalOpen in IMG/M
3300018773Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002037 (ERX1789391-ERR1719301)EnvironmentalOpen in IMG/M
3300018781Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789655-ERR1719256)EnvironmentalOpen in IMG/M
3300018810Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002291 (ERX1789538-ERR1719380)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018849Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002287 (ERX1789411-ERR1719439)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018864Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789379-ERR1719364)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018889Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000728 (ERX1789501-ERR1719269)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018945Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001608 (ERX1789687-ERR1719388)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021936Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-15M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030728Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_940_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030750Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030786Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030952Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030957Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031063Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031121Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S15_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031445Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031459Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031465Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103708_10008497923300009028Ocean WaterMTKLALSALMLSVANAAFLRTAPLANSTLQSPIQNEVMNLAGRQFMEVDLGPFASAAEACDYCFGSFTKKGQPPAGPVAPFCVCMSYPQGAKHNMFCATPPSAAEYIASKKGCRCKAKDMEAMGKTTCKPI*
Ga0103708_10029375813300009028Ocean WaterETNQYAQPATKLVQGRSHSLLTMNSAVVCALMLSTASASFLRTVPAATLVNSTMQVETMNLAKKQFMEVKLGPFDSAADACDYCFGSYTKEGDSPAGPVAPFCVCMAYPDGGKYKMFCATPPSAAEYIAEKKGCRCKPRDMEAMGATTCKPIE*
Ga0115102_1071620413300009606MarineMTTVALVIMAAGGAQAANLRFENTTSVAATSMHLSAKTDMTVDLGPFASAADACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI*
Ga0115100_1000226613300009608MarineSSSSLSDLLHSSHDLSIPPKPNVVLTMAKFAAAIFALAATSADAIAVRTTNSTAATESMHLSSRQFMEVNLGPFNSAAEACDYCFSSFTKEGQSPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAEYIQKKNGCRCKAKDMEAMGKTTCKKI*
Ga0115100_1015789213300009608MarineLKLGFRSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTVVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPACGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI*
Ga0115100_1097537613300009608MarineFTSAHFPSNEVQSANNTMASSMTMALFFLCAAGAQAANLRMMNSTSSVVSHESMNIGAKADMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKAI*
Ga0138316_1022669313300010981MarineMVRLATVAPFMLFAIASAVSLRAANSTVNALESMHVSARQFMEVNLGPFASAAEACDYCFGSFTKEGQPPAGPVAPFCVCMAYPKDGKYNMFCATPPSAAEYIAKNDGCRCKAKDMEAMGQTTCKPI*
Ga0138316_1047079213300010981MarineMNSTAVFFVACIFTAQAASLRTTNSTSNLVQHESMHISQKAGMTMTVNLGPFDSAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPDGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAIE*
Ga0138316_1080032813300010981MarineMAMNTAVLCAVMLSGANGASLRTAPAAAFTNATMQSESMSLASRQFMEVNLGPFASAEAACDYCFGSFTKKGDSPAGPVAPFCVCMAYPKGTEYNMFCATPPSAAEYIAEKKGCRCKAKDMEAMGKTTCKPI*
Ga0138316_1098117123300010981MarineMASKVLAAALLMAACTIITDAASLRTAPVTLTNSSAQHESMHLASRQFMKVDLGPFDSAAAACDYCFSSFTKEGQAPAGPVAPFCVCMAYPDGGGKHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGQTTCKPI*
Ga0138316_1132226413300010981MarineMNAKVAATAILMLVCTGADAASLRSTNSTGVTTQATMNLAKKAFMKVELGPFDDAAKACDYCFGSYTKKGDEPAGPVAPFCVCMAYPDAGGYNMFCATPPSAAGYIAEKEGCRCKEKNMEQMGQTTCEPIS*
Ga0138316_1145144813300010981MarineMAKTAAILILACCLGADASLLRHSNSTVAQHESMKLASKEHMEVDLGPFGSAAEACDYCFSSFTKEGQSPAGPVAPFCVCMAYPEGGKYNMFCATPPSAAGYIAKKNGCRCKAKDMEAMGKTTCAPISA*
Ga0138316_1163713813300010981MarineIVAMNSAVAVLLGCVFTAQAASLRTTNSSSNLVQHETMQISQKAGMSMKVDLGPFDSAPEACDYCFSSFTKTGQPPAGPVAPFCVCMAYPDGGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAIA*
Ga0138316_1164083813300010981MarineMAVTAFIMAMLAVADATSLRFANSTVSETKAQSMHLAARQFMEVELGPFGSAAEACDYCFGSFTKEGQSPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPISA*
Ga0138326_1082856113300010985MarineMNAQAAAFLMLVCTGANAASLRTANSTVSSSGVTMNLGTKAFMEVELGPFDSAAEACDYCFSSFTKKGDPPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKNGCRCKERNMEQMGQTTCAPIK*
Ga0138326_1150410313300010985MarineMAKFAAAVLITVACALSVEAAVLRATPLTNSSVSHETMNLDSRQFMEVDLGPFDSAAEACDYCFESFTKKGQEPAGPVAPFCVCMSYPGKGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGQTTCKAI*
Ga0138327_1123745513300010986MarineMVRLATVAPFMLFAIASAVSLRAANSTVNALESMHVSARQFMEVNLGPFASAAEACDYCFGSFTKEGQPPAGPVAPFCVCMAYPKDGKYNMFCATPPSAAEYIAKNKGCRCKAKDMEAMGQTTCKPI*
Ga0138324_1068311613300010987MarineVLSAMNSSVAVFLACVFTAQAASLRTTNSSSNLVQHETMQISQKAGMSMKVDLGPFDSAPEACDYCFSSFTKTGQPPAGPVAPFCVCMAYPDGGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAIA*
Ga0138324_1070205813300010987MarineMARLAFIAPFALLAVASAANLRTAVDSPATNSTMHFAARQFMEVNLGPFDSAAAACDYCFSSFTKEGQPPAGPVAPYCVCMAYPEGAKYNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCAPI*
Ga0138324_1070519513300010987MarineMASKVVATVLLIATCTITTQAASLRTAPVPLTNSSAQHETMSFAAKTDMEVDLGPFASAAEACDYCFGSFTKEGQPPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKNMEALGQTTCEPIA*
Ga0138324_1071820713300010987MarineMAVSRVALLLLACSFTAQAVNLRSPIANASNAFDGESMNLVAKQDMTVDLGPFASAAEACDYCFSSFTKEGQAPAGPVAPFCVCMAYPEGGKYNMFCATPPSAAEYIAEKNGCRCKEKDMEAMGKTTCKKI*
Ga0138324_1072216913300010987MarineMVSAVSVATLFVFAVGAHAVNLRTANTTSSASASMSLGKRQFMEVDLGPFGSAAEACDYCFSSFTKEGQPPAGPVAPFCVCMAYPASGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI*
Ga0138264_107784813300012414Polar MarineMAATMALIFLTCAFGAQAASLRNAPVAPLTNSSIEIMHLASKANMQVDLGPFADAAAACDYCFGSFTKDGEKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI*
Ga0138264_169974313300012414Polar MarineSSFFDASTGNVVRLTFLRAMASTMALIFVACAFSAEAASLRNAPAAPLTSSSNEVMHLAYKANMTVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCLCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI*
Ga0138263_107505213300012415Polar MarineMAKLAAVFVLMTACSFTADAASLRAAPLTNSSTDEAMSLARSTFMKVDLGPFASSEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPASGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEALGKTTCQPI*
Ga0138263_178342613300012415Polar MarineMAKVAAAIVLLVACSSTADATALRATNSSNDNMNLASKQFMEVDLGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI*
Ga0138263_184538513300012415Polar MarineMAFTKTLIFLACYATTQAASLRTTNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI*
Ga0138259_118957813300012416Polar MarineMASTMALIFLTCAVGAQAASLRTAPVAPLTNSSNEIMHLASKANMQVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPFCMCMAYPTKGGHNMFCATPPSAAAHFLSEKNGCMCQAKDMEAMGQTTCKPI*
Ga0138259_120001613300012416Polar MarineRPGSSSVVPHPRQRSARVERSYSQQMASFTNVAVLFLLCASGAQAAILRGSNSTSSVVQHESMHLKATTDMTVDLGPFDTAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPDGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI*
Ga0138259_144433513300012416Polar MarineMASTMALILMCSVLGAQASFLRFANTTHDEVKVGSMHLTAKTDMTVDLGPFADAAAACDYCFGSFTKTGDAPAGPVAPFCVCMAYPTAGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGQTTCKAI*
Ga0138259_151972213300012416Polar MarineMTTVALVLMCTIGAHASSLRFANTTVDAVQTATSMNLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI*
Ga0138259_157685613300012416Polar MarineMTTVALVLMGSLGAHASNLRFENTTSVAAASMHLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI*
Ga0138259_169429213300012416Polar MarineLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI*
Ga0138262_130355213300012417Polar MarineMASSMTTVALVLMCAVSAQASFLRFANTTKAEVQTSSMHLSAKTDMTVDLGPFADAAAACDYCFGSFTKTGDAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGQTTCKAI*
Ga0138262_149331313300012417Polar MarineCNTDNVGKATDTMNTVAVVLMCAFGAHASNLRFENSTSAVVSTGTSMSLSAKTDMTVDLGPFASAADACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI*
Ga0138261_148209313300012418Polar MarineMAATMALIFLTCAFGAQAASLRNAPAAPLTNSSNEIMHLASKANMQVDLGPFQDAAAACDYCFGSFTKDGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI*
Ga0138260_1018623013300012419Polar MarineMANKIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI*
Ga0138260_1027394313300012419Polar MarineMCSIGAHASSLRFANTTVDAVQTATSMNLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0138260_1028044813300012419Polar MarineMASTMTTVAVFLMCSFSAGATSLRLANTTGAVAQSGSSMHLSAMTDMTVDLGPFKDAPAACDYCFGSFTKTGQPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGQTTCKAI*
Ga0138260_1038612413300012419Polar MarineMALVLLLCASGAQAAVLRQANSTSTVVQHESMNFAAKTNMTLDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI*
Ga0138260_1048436313300012419Polar MarineMTSATVALVLMCAVSAQASFLRFANTTKAEVQTSSMHLSAKTDMTVDLGPFADAAAACDYCFGSFTKTGDAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGQTTCKAI*
Ga0138260_1086820813300012419Polar MarineMARTTALVLLACFSAADAANLRVTPLTAAENAFPNTMQLAARADMEVDLGPFATAADACDYCFGSFTKKGDKPAGPVAPFCVCMSYPKGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKPI*
Ga0138260_1092443713300012419Polar MarineMALIFLTCAFGAQAASLRNAPVAPLTNSSIEVMHLASKANMQVDLGPFSDAAAACDYCFGSFTKDGEKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI*
Ga0138268_114323613300012782Polar MarineMAATMALIFLTCAFFAQAASLRNAPVAPLTNSSIEIMHLASKANMQVDLGPFTDAAAACDYCFGSFTKDGEKPAGPVAPFCVCMAYPTSGGHNMFCSTPPSAAAYIAEKKGCRCKAKDMEAMGQTTCKPI*
Ga0138268_143577313300012782Polar MarineMASSTTVAVVLLLCASGAQAAVLRQANSTSSVVQHESMNFAAKTNMTLDLGPFATAADACDYCFGSFTKEGDKPAGPFAPFCVCMAYPTSGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPISL*
Ga0138257_138268213300012935Polar MarineMTTIAMVLMCSFTAHATSLRMTNSTGGVAQAGTSMELSAMTDMTVDLGPFKDAPAACDYCFGSFTKTGQPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGQTTCKAI*
Ga0138257_166753813300012935Polar MarineMAGLALIVLLAIPALGNAMSLRSANTTGAVVETGTSMDLSAMTDMTVDLGPFKDAPAACDYCFGSFTKTGQPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI*
Ga0138257_168037113300012935Polar MarineMTTVALVLMCSIGAHASSLRFANTTVDAVQTATSMNLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI*
Ga0193381_106191413300018732MarineAQVCKATPTRFSRQRSIPHSAHLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFGSAAEACDYCFGSFTKKGDPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0192896_107123513300018755MarineSSLQSDPNQVLQATQHTHSAHLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFGSAAEACDYCFGSFTKKGDAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0192896_107250113300018755MarineMVSAVSVATLFVFAVGAHAVNLRTANTTSSASASMSLGKRQFMEVDLGPFGSAAEACDYCFSSFTKEGQPPAGPVAPFCVCMAYPASGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0193396_107712513300018773MarineCKATPTRFSRQRSIPHSAHLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFGSAAEACDYCFGSFTKKGDPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0193380_107519913300018781MarineQVCKATPTRFSRQRSIPHSAHLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFGSAAEACDYCFGSFTKKGDPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0193422_108429913300018810MarineCKATPTRFSRQRSIPHSAHLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFDSAAAACDYCFGSFTKKGDPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0192949_108537313300018831MarineMNTVAVVLMCAFGAHASNLRFENSTSAVVSTGTSMSLSAKTDMTVDLGPFASAADACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0192949_109958313300018831MarineMTTLALVLMCSFGAHASNLRFANASVDLKFVDAVQTATSMDLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0192949_110385813300018831MarineMASTMTTVALVLMGSLGAHASNLRFENTTSVAAASMHLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0192870_109268613300018836MarineMVSAVSIATLFVFAVGAHAVNLRTANTTSSASASMSLGARQFMEVDLGPFGSAAEACDYCFSSFTKEGQPPAGPVAPFCVCMAYPASGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0193219_107174813300018842MarineMAKTAAILVLACCLGADASLLRHSNSTVAQHESMKLASKEHMEVDLGPFGSAAEACDYCFSSFTKEGQSPAGPVAPFCVCMAYPEGGKYNMFCATPPSAAGYIAKKNGCRCKAKDMEAMGKTTCAPISA
Ga0193253_110518013300018846MarineFRSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTVVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0193253_111047913300018846MarineMAPAMTTVALVLMCSIGAHASSLRFANTTVDAAQTATSMTLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0193253_111390813300018846MarineMTTVALILMGSLGAHASNLRFENTTSVAAASMHLTAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0193005_106992013300018849MarineQVCKATPTRFSRQRSIPHSAHLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFDSAAAACDYCFGSFTKKGDPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0193308_108236513300018862MarineVHSLPIMAFAKIVIALCVSGASGAALRHTNSTSSIVSAQSSMHLSAKENLQVELGPFDSAADACDYCFGSFTKQGDAPAGPVAPFCVCMAYPEGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGQTTCKAIDA
Ga0193308_108458013300018862MarineWLKRLESHPISSTRQRSIKTSTMAQRFAVIAIAMMAFITTGNAVNLRSTNSSTVGESMSLSARQFMEVDLGPFGSAAEACDYCFSSFTKEGQPPAGPVAPFCVCMAYPASGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0193421_112259913300018864MarineMVSAVSVATLFVFAVGAHAVNLRTANTTSSASASMSLGARQFMEVDLGPFGSAAEACDYCFSSFTKEGQPPAGPVAPFCVCMAYPASGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0192977_110597213300018874MarineMALIFLTCAFGAQAASLRNAPVAPLTNSSIEIMHLASKANMQVDLGPFADAAAACDYCFGSFTKDGEKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0192901_113393313300018889MarineSSLQSDPNQVLQATQHTHSAQLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFGSAAEACDYCFGSFTKKGDAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0193090_108848313300018899MarineMNTVAVVLMCAFGAHASNLRFENSTSAVVSTGTSMSLSAKTDMTVDLGPFASAADACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAVGKTTCKAI
Ga0193090_113790613300018899MarineMASTKAMILLACVVAAQATMLRTANTTNAVAQVGSMHLDSKAMMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0193090_114014713300018899MarineMAATKAMILLACVAAAQATMLRTANTTNAVAQVGSMNLNSKAMMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0193028_111084313300018905MarineIKFSDVHHLFRQRSNTISRMVSAVSVAALLVFAVGTQAVNLRTANTTSSVVSSASGSMNLAARQFMEVDLGPFASAAEACDYCFSSFTKEGQPPAGPVAPFCVCMAYPASGKYNMFCATPPSAAGYIAKKKGCRCKAKDMEAMGKTTCSPIA
Ga0193028_111628313300018905MarineFGSSLQSDPNQVLQATQHTHSAHLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFGSAAEACDYCFGSFTKKGDAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0192989_1016351113300018926MarineMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCKPI
Ga0193260_1014752413300018928MarineVHSLPTMAFAKIVIALCVSGASGAALRHTNSTSSIVSAQSSMHLSAKENLQVELGPFDSAADACDYCFGSFTKQGDAPAGPVAPFCVCMAYPEGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGQTTCKAIDA
Ga0193287_114077213300018945MarineLESHPISSTRQRSIKTSTMAQRFAVIAIAMMAFITTGNAVNLRSTNSSTVGESMSLSARQFMEVDLGPFGSAAEACDYCFSSFTKEGQPPAGPVAPFCVCMAYPASGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0193379_1020512813300018955MarineSSLQSDPNQVLQATQHTHSAHLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFGSAAEACDYCFGSFTKKGDPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0193379_1022036413300018955MarineMARLAFIAPFAIFAVASAANFRTAVDAPATNQTMHFAARQFMEVNLGPFASAAEACDYCFSSFTKEGQPPAGPVAPFCVCMAYPDGGKYNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0193379_1022522813300018955MarineMARLAFIAPFALLAVASAANLRTAVDSPATNSTMHFAARQFMEVNLGPFDSAAAACDYCFSSFTKEGQPPAGPVAPYCVCMAYPDGGKYNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0193033_1021360213300019003MarineSDPNQVLQATQHTHSAHLQMAKILALILLSCSSVDAANLRTEPVANKFDGETMNLMAKANMTVDLGPFGSAAEACDYCFGSFTKKGDAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0206687_107157213300021169SeawaterMFSMKFSFGALLFLAGEASLLRHSNSTSSIVQHESMHLMSKANMKVELGPFSSAEDACNYCFDSFTKTGDAPAGPVAPFCVCMAYPEGSEYNMFCATPPSAAGYIADKKGCTCKGRDMEAMGKTTCEAI
Ga0206688_1020733613300021345SeawaterMASSMTTVALLLACSFAAEAANLRLANTTSSTAQQGASMTLSAKTDMKVDLGPFDTAAAACDYCFSSFTKEGQSPAGPVAPFCVCMAYPSDGGHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGQTTCKSI
Ga0206688_1039849113300021345SeawaterMAALLFLCVSGAQATSLRLANSTSSVVQQGTSMNLAAKSHMTVDLGPFATAAEACDYCFSSFTKEGQKPAGPVAPFCVCMSYPDAGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCAPISQ
Ga0206692_155355013300021350SeawaterMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0206693_133683013300021353SeawaterMTSAVAIFLACAFTAQAVNLRTTNSSSNLVQHESMQISQKAGMTMTVDLGPFDSAAAACDYCFGSFTKTGQPPAGPVAPFCVCMAYPDGAGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0206693_142923113300021353SeawaterSTFQSQRRQTQQTLCTMAPNTALFLLACCSMADAANLRVTPLTNAQNALPNSMQLAAKADMEVDLGPFASAEEACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKAI
Ga0206689_1023264013300021359SeawaterLKHISEQPSQRRQTQQTLCTMAPNTALFLLACCSMADAANLRVTPLTNAEKALPNTMQLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKAI
Ga0206689_1054501013300021359SeawaterMVSNTALFLLACCSMADAANLRVTPLTNAQNALPNSMQLAAKADMEVDLGPFASAEEACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKAI
Ga0063147_11900013300021874MarineMAALIFVACAFSAEAASLRNAPAAPLTSSSNEVMHLAYKANMTVDLGPFKDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCSPI
Ga0063105_106741213300021887MarineVKTFRQRSRLDLSAFLTMAFTKTLIFLACCATTQAVSLRATNATDVQVASMHLSAMTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0063097_104259813300021898MarineKQQFGTTLKLLKTVRQRSRHKFPAPLAMAFTKTLIFLACCATTQAVSLRATNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0063086_102604413300021902MarineMNSVVAVFLACVFTVQAASLRTTNSSSNLAQQESMQISQKAGMTMTVDLGPFDSAAAACDYCFSSFTKTGQPPAGPVAPFCVCMAYPDGAGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKAI
Ga0063086_105584813300021902MarineMTSAVAIFLACVFTAQAANLRTTNSSSNLVQHESMQISQKAGMTMTVDLGPFDSAAEACDYCFGSFTKTGQPPAGPVAPFCVCMAYPDGAGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCAPIA
Ga0063100_101128013300021910MarineLKLKACEHQTSFRQRSKRNCPVRTMASNMALIFLACCVTAQATMLRTANSTQDVAQVSSMNLNSKAMMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0063100_102628313300021910MarineLKQQFGTTLKLLKTVRQRSRHKFPAPLAMAFTKTLIFLACCATTQAVSLRATNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0063100_104554213300021910MarineQAQRLWKLFSQRSRRNFPGFLAMASAKALILLTCSVAAQAAFLRTSNSTNDLAQAGSMHFEAKAVMQVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0063106_100865513300021911MarineAQALKVFTFLNALQPIRQRSSNMAKVAAAIMLLVACADATALRATNSSDDNMNLASKQFMEVDLGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKGGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCKKI
Ga0063106_101509313300021911MarineMACTKTLIFLACCATTQAVSLRATNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0063106_104514013300021911MarineSSSALCHHRDIVEAHSCAMASKIVFAALLVVVADAVSLRNTPLTNSSAMPETMNLKASEDMEVDLGPFASAAAACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGQTTCKAI
Ga0063106_105278813300021911MarineMNSQVAAVLILACAFGGDATSLRAMNTSTADIMHESMDLASRSFMKVDLGPFASAAEACDYCFGSFTKKGDAPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCEPI
Ga0063106_105364713300021911MarineLFAASSIRHNRSIAPFSRMASKFAVAAVLLLACSFSADATALRAAPANATLPEHETMNLASRNFMKVDLGPFSSAAEACDYCFSSFTKQGQDPAGPVAPFCVCMAYPDGAKHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCKPI
Ga0063103_105503413300021927MarineMAALIFVACAFSAEAASLRNAPAVELKSSSNEVMHLAYKANMTVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCSPI
Ga0063103_106603613300021927MarineMASSTAMLALLFLCAFSAQAANLRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCSPISL
Ga0063103_106678313300021927MarineMAPSTAVAMVLLVCASGAQAVNLRLSNSTSTGGQHESMHITAKTNMTVDLGPFATAAEACDYCFGSFTKDGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGQTTCAPISL
Ga0063103_106788913300021927MarineMTMALFFLCASGAQATNLRMMNSTSSVVSHESMKFGAKADMQVDLGPFTTAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0063103_107600313300021927MarineGSRRLQTRQRSGCPDLSKQQTMASSTTVAAVLLLWACGAQAANLRLANSTSAVVQHESMKLAAKTDMTLDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPISL
Ga0063103_117197513300021927MarineDRSFPAITKQRSSIIKPGNMAKFAAALMLACAFGADATSLRAAPLTNATAAHESMNLASSQYMKVDLGPFSSAEQACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCQPI
Ga0063145_109192313300021930MarineMLAVLALCASGAQAANLRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPISL
Ga0063145_113152513300021930MarineRLQTRQRSGCPDLSKQQTMASSTTVAAVLLLWACGAQAANLRLANSTSAVVQHESMKLAAKTDMTLDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPISL
Ga0063092_118814413300021936MarineMAALIFVACAFSAEAASLRNAPAVPLTSSSSEVMHLSYKANMTVDLGPFKDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCSPI
Ga0063095_112581513300021939MarineFGTTLKLLKNVRQRSRHKFPALLAMAFTKTLIFLACCATTQAVSLRATNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0063108_106457313300021940MarineMNSQVAAVLLLACAFSADATSLRAANTTTVELGSMDLASRAFMKVDLGPFASAAEACDYCFGSFTKKGDAPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCEPI
Ga0063102_105690713300021941MarineMASSMVLILLACSVGAQAANLRVEPAAVLTNSSMHLAARENMQVDLGPFATAADACDYCFGSFTKDGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCQPI
Ga0063102_106039613300021941MarineMAKVSAVAFLMAACVFTADATSLRAVPLTNATLQHESMNLASRFSDNMKVDLGPFASAEDACNYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0063102_108947713300021941MarineRISQSTKQVPRALRATNNTMASSMTRVLFFLCAAGAQAANLRMMNSTSSVVQHESMKFGAKADMQVDLGPFTTAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAKYIADKKGCRCTAKDMEAMGKTTCKAI
Ga0063102_112611813300021941MarineMASKIAMTALVACVFTAEATHLRKDASVAPITNSSTQHEKMNLASRQFMEVDLGPFATAADACDYCFGSFTKAGDKPAGPVAPFCVCMAYPEGNKYNMFCATPPSAAAYIQKKNGCRCKAKDMEAMGKTTCQPI
Ga0063094_111871913300021943MarineHHRDIVEAHSCAMASKIVFAALLVVVADAVSLRNTPLTNSSAMPETMNLKASEDMEVDLGPFASAAAACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGQTTCKAI
Ga0247596_116443413300028106SeawaterMKFSFGALLFLTGEASLLRHSNSTSSIVQHESMHLMSKANMKVELGPFSSAEDACNYCFDSFTKTGDAPAGPVAPFCVCMAYPEGSEYNMFCATPPSAAGYIADKKGCTCKGRDMEAMGKTTCEAV
Ga0247582_118169713300028109SeawaterMKFSFGALLFLTGEASLLRHSNSTSSIVQHESMHLMSKANMKVELGPFSSAEDACNYCFDSFTKTGDAPAGPVAPFCVCMAYPEGSEYNMFCATPPSAAGYIADKKGCTCKGRDMEAMGKTTCEAI
Ga0304731_1003227413300028575MarineMAMNTAVLCAVMLSGANGASLRTAPAAAFTNATMQSESMSLASRQFMEVNLGPFASAEAACDYCFGSFTKKGDSPAGPVAPFCVCMAYPKGTEYNMFCATPPSAAEYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0304731_1048777213300028575MarineIVAMNSAVAVLLGCVFTAQAASLRTTNSSSNLVQHETMQISQKAGMSMKVDLGPFDSAPEACDYCFSSFTKTGQPPAGPVAPFCVCMAYPDGGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAIA
Ga0304731_1078400623300028575MarineVRHFSHFTRQRRSKHCTMASKVLAAALLMAACTIITDAASLRTAPVTLTNSSAQHESMHLASRQFMKVDLGPFDSAAAACDYCFSSFTKEGQAPAGPVAPFCVCMAYPDGGGKHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGQTTCKPI
Ga0304731_1081110513300028575MarineMVRLATVAPFMLFAIASAVSLRAANSTVNALESMHVSARQFMEVNLGPFASAAEACDYCFGSFTKEGQPPAGPVAPFCVCMAYPKDGKYNMFCATPPSAAEYIAKNDGCRCKAKDMEAMGQTTCKPI
Ga0304731_1133808013300028575MarineMNSTAVFFVACIFTAQAASLRTTNSTSNLVQHESMHISQKAGMTMTVNLGPFDSAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPDGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAIE
Ga0304731_1146603113300028575MarineMAKTAAILILACCLGADASLLRHSNSTVAQHESMKLASKEHMEVDLGPFGSAAEACDYCFSSFTKEGQSPAGPVAPFCVCMAYPEGGKYNMFCATPPSAAGYIAKKNGCRCKAKDMEAMGKTTCAPISA
Ga0307402_1065628513300030653MarineVICHHRDIVEAHSDAMASKIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307402_1071327413300030653MarineMANKIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307402_1071546213300030653MarineFWLKHISEQPSQRRQTQQTSCTMAPNTALFLLACCSMADAANLRVTPLTNAENAFPNTMQLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKPI
Ga0307402_1078081613300030653MarineAILAQVLDRALCAITQYRSTFKPGQMAKVAAAALIVIACAVTVDATRLAGPLTNSTTEHESMNLASRDFMKVDLGPFASAEAACDHCFGFFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGQTTCQPI
Ga0307402_1078229013300030653MarineSSSFFDASKGNVVRLTFLRTMASTMALIFVACAFSAEAASLRNAPAVPLTSSSNEVMHLAYKANMTVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307402_1078611913300030653MarineMVLILLACSVGAQAANLRVEPAAAVTNSTMHLASRENMQVDLGPFASAEAACDYCFGSFTKDGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKPI
Ga0307402_1079905113300030653MarineMAPSTAMALVLLLCASGAQAAVLRQANSTSTVVQHESMNFAAKTNMTLDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307402_1080341213300030653MarineHFPTSDIVATHFPRKMAFKVAALLTVACIFSADAASLRSAPATPLTNASMVPEMMNLASRQFMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEGAKYNMFCATPPSAAGYIAKKKGCRCKAKDMEAMGKTTCSPI
Ga0307402_1081969713300030653MarineMALIVLSCLVGAQAANLRTEPAAPMTNSSLETMHFAFKENMKVDLGPFASAEEACDYCFGSFTKSGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYVAEKNGCRCKAKDMEAMGKTTCKKI
Ga0307402_1083865413300030653MarineFASQQSTSQLTKEQQRTLNTMASTMTTVALVLMCAVSAEASSLRFANTTKGEVQAGSMHLSAKTDMTVDLGPFADAAAACDYCFGSFTKTGDAPAGPVAPFCVCMAYPTAGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGQTTCKAI
Ga0307402_1084016213300030653MarineFGSSVGQIFSAITQQRSKHIKPGIMAKFAAVLMLACAFGADATSLRAAPLTNATVAHESMNLASSQYMKVDLGPFSSAEEACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCQKI
Ga0307402_1084502213300030653MarineMASTKAMILLACVVAAQATMLRTANTTNAVAQVGSMHLDSKAMMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKPI
Ga0307402_1088899113300030653MarineMTMALFFLCASGAQAANLRMMNSTSSLVSHESMKFGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKAI
Ga0307402_1089113513300030653MarineMASSMTMALFLFCAAGAQAANLRMMNSTGSVVQHESMKFGAKADMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0307402_1089844113300030653MarineMALIFLACAFGAQAAVLRNAPAAPLTNSSNEIMHLASKANMQVDLGPFQDAAAACDYCFGSFTKDGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307402_1090295213300030653MarineMTTVALVLMGAFSAQATNLRFANTTNNEVQTSSMHLSAKADMTVDLGPFADAPAACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTAGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGQTTCKAI
Ga0307402_1090312513300030653MarineMLALLFLCASGAQAANLRLANSTSSVVQHESMHLAAKTNMTVDLGPFATAADACDYCFGSFTKDGDKPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307402_1091316823300030653MarineVSSSTSDIVAAQFPHKMAMKVAALLMVACIFSADAASLRNAPATPLTNSSMNLASRQYMEVDLGPFASAADACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307402_1091641113300030653MarineMARTTALVLLACFSAADAANLRVTPLTAAENAFPNTMQLAARADMEVDLGPFATAADACDYCFGSFTKKGDKPAGPVAPFCVCMSYPKGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKPI
Ga0307402_1092054913300030653MarineMAALIFVACAFSAEAASLRNAPAAPLTSSSNEVMHLAYKENMTVDLGPFKDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGQTTCSPI
Ga0307402_1092830813300030653MarineMAARTFALLAVMASPCWALVLSNSTSESVSQGVMHFVAKANMEVTLGPFPTAADACDYCFGSFTKQGDPPAGPIATACVCMAYPDGAQHNMFCATPASAAGYVASKDGCRCKARDMEAMGKTTCAKIS
Ga0307402_1093109313300030653MarineKPILAHATHASQRRPSQQALCNMAPTAALVLLVCSSVAHAANLRVAPLTNAQNALPNTINLAARADMEVDLGPFASAAEACDYCFGSFTKQGDKPAGPVAPFCVCMSYPKGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307401_1042496913300030670MarineHRDIVEAHSYAMASKIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307401_1046876113300030670MarineMTTLALVLMCSAGAHASNLRFANASVDLKFVDAVQTATSMDLSAKTDMTVDLGPFASAADACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307401_1047323513300030670MarineSRPGSSSVVSHPRQRSARVERSYSQKMASFTNVAVLFLVCASGAQAAILRGSNSTSSVVQHESMHLKATTDMTVDLGPFDTAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307401_1051291713300030670MarineMTMALFFLCASGAQAANLRMMNSTSSLVSHESMKFGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGQTTCEPI
Ga0307401_1053590513300030670MarineMMTLMMLSFSVTAQAASLRTEPTTPLTNSSKTVVQQESMHLMAKADMRVDLGPFASAAEACDYCFGSFTKKGDAPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCEPIS
Ga0307401_1057130013300030670MarineMASTMTTVALVLMGSLGAHASNLRFENTTSVAAASMHLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAIGKTTCKPI
Ga0307401_1057245613300030670MarineLKPILAHATHASQRRPSQQALYKMAPTAALVLLVCSSVAHAANLRVAPLTNAQNALPNTINLAARADMEVDLGPFASAAEACDYCFGSFTKQGDKPAGPVAPFCVCMSYPKGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307401_1058654113300030670MarineMANVAAVTVLMLACSFTADASSLRTTNATQHEVMNLAFKSDMKVDLGPFASAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307401_1058720013300030670MarineLKHISEQPSQRRQTQQTHCTMAPNTALFLLACCSVADAANLRVTPLTNAENAFPNTMQLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGQTTCKPI
Ga0307401_1058725113300030670MarineFGSSTFHFQRRQTLQTLCTMAPNTALFLLACCSMAHGANLRVTPLTNAENALPNSMNLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKPI
Ga0307401_1059174113300030670MarineAILAQVSTSSEQRSRTITLNTMSCTKVFLLLACSGAAQAANLRMTNSTQDMVQHESMNLAAKAHMSVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCAPISA
Ga0307403_1052867213300030671MarineLVCFSTSDIVATHFPRKMAFKVAALLTVACIFSADAASLRSAPATPLTNSSMVPEMMNLASRQFMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEGAKYNMFCATPPSAAGYIAKKKGCTCKAKDMEAMGKTTCSPI
Ga0307403_1053866813300030671MarineMASKIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307403_1055956613300030671MarineMALIFLICAFGAQATNLRNAPVAPLTNSSNEIMHLASKANMQVDLGPFKDAAAACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCQPI
Ga0307403_1061780113300030671MarineMVSTKALIVLACSVTAQATNLRTEPAALLTNSSTQFESMHLMAKADMRVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCAPISA
Ga0307403_1064477813300030671MarineMASTMALILMCSVLGAQASFLRFANTTHDEVKVGSMHLTAKTDMTVDLGPFADAAAACDYCFGSFTKTGDAPAGPVAPFCVCMAYPTAGGHNMFCATPPSAAKYIADKKGCRCKSKDMEAMGQTTCKAI
Ga0307403_1064692113300030671MarineMAFTKTLIFLACCATTQAASLRATNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAEKKCCRCKAKDMEAMGQTTCKPI
Ga0307403_1066849313300030671MarineMTTLALVLMCSVGAHASNLRFANASVDLKFVDAVQTATSMDLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307403_1069427813300030671MarineMALIVLSCLVGAQAANLRTEPAAPMTNSSLETMHFAFKENMKVDLGPFASAEEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKKI
Ga0307403_1070568113300030671MarineMVLVLLACSVGAQAANLRVEPAAVLTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKDGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKPI
Ga0307403_1075048913300030671MarineMAPSTTMALVLLLCASGAQAAVLRQANSTSTVVQHESMNFAAKTNMTLDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307403_1075670813300030671MarineMLALLFLCASGAQAANLRLANSTSSVVQHESMHLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307403_1076288013300030671MarineMNTVAVVLMCAFGAHASNLRFENSTSAVVSTGTSMSLSAKTDMTVDLGPFASAADACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKPI
Ga0307403_1076318213300030671MarineMNSQVAAVLILACAFGGDATSLRATNTSTADIMHESMDLASRSFMKVDLGPFASAAEACDYCFGSFTKKGDAPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCEPI
Ga0307403_1077130413300030671MarineMASTVAFVLMCVVGAQATSLRLSNSTAAVVEQANAMELSAKADMTVDLGPFTDAAAACDYCFGSFTKTGQPPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAKYIADKNGCRCKAKDMEAMGQTTCKAI
Ga0307403_1077420513300030671MarineMALIFLTCAFGAQAASLRNAPVAPLTNSSNEIMHLASKADMQVDLGPFTDAAAACDYCFGSFTKDGEKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307403_1077515013300030671MarineMMACSMTMAAMLFLCASGAQAANLRFTNSTSSVVQHESMNFAAKANMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307403_1077688413300030671MarineLKHISEQPSQRRQTQQTHCTMAPNTALFLLACCSMADAANLRVTPLTNAENALPNTMQLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGQTTCKPI
Ga0307403_1079072013300030671MarineMAKVSAVVFLLAACIFSADATSLRAAPLTNATLQHESMNLASRFADNMTVDLGPFASAEEACDYCFGSFTKSGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKAI
Ga0307403_1079733413300030671MarineMASITALIFLACSVGAKASTLRTAPAAPLTNSSSKSEQNEVMHLAMKQRMQVDLGPFAGAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEALGKTTCSPI
Ga0307403_1079868413300030671MarineLKTLQPFTSAHFPSNEVQSANNTMASSMTMALFFLCAAGAQAANLRMMNSTSSVVSHESMNIGAKADMQVDLGPFSSAAEACDYCFGSFTKAGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0307403_1080577513300030671MarineMASAMTTVALVLMCSIGAQASSLRFANTTVDAAQTATSMNLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307403_1081638323300030671MarineVVIALASQASALRTPVNSTLAVNSTEKMSFAARQFMEVTLGPFDTTALACDYCAGSFTKTGDGAAGPVAPACVCMAYPDAGKFNMFCATPASAAGYIADKNGCRCKPRDMEAQGATTCTPIS
Ga0307403_1082346813300030671MarineMTTVALVLMCAVSAQAVSLRFANTTKGEVQTASSMNLAAKADMTVDLGPFADAAAACDYCFGSFTKTGDAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGQTTCKAI
Ga0307403_1083303413300030671MarineMTTVALVLMCAVSAQASSLRFANTTKGEVQTASSMNLAAKADMTVDLGPFADAAAACDYCFGSFTKTGDAPAGPVAPFCVCMAYPTAGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGQTTCNAI
Ga0307398_1058847013300030699MarineMALIFLACSVGAQASVLRTAPAAPLTNSSSKSEQNEVMHLAMKQRMQVDLGPFADAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEALGKTTCSPI
Ga0307398_1072058113300030699MarineQDQVLVCFSTSDIVATHFPRKMAFKVAALLTVACIFSADAASLRSAPATPLTNSSMLPEMMNLASRQFMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEGAKYNMFCATPPSAAGYIAKKKGCRCKAKDMEAMGKTTCSPI
Ga0307398_1072917313300030699MarineLKTWNIASQPTQRSRRPDPSDRQVMASSTTVAALLLLCASGAQAANLRLTNSTSSVVQHESMNLAGMADMKVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKEGCRCKAKDMEAMGKTTCTPI
Ga0307398_1073225613300030699MarineSSVVSHPRQRSARVERSYSQKMASFTNVAVLFLLCASGAQAAILRGANATSSVVQHESMKLKAKTDMTVDLGPFDTAAAACDYCFGSFTKDGEPPAGPVAPFCVCMAYPSGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307398_1075165513300030699MarineMTSTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLSAKQDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307398_1076275613300030699MarineQAMASVAALLFLCVSGAQASNLRLTNSTSSVVQHESMHLAAKADMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307398_1076986113300030699MarineLKTLQPFTSAHFPSNEVQSANNTMASSMTMALFFLCAAGAQAANLRMMNSTSSVVSHESMNIGAKADMQVDLGPFSSAAEACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKAI
Ga0307398_1078127913300030699MarineMASSNTMLALLFLCASSAQAANLRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIADKKGCRCKAKDMEALGKTTCSPISA
Ga0307398_1082200613300030699MarineLKPILAHATHASQRRPSQQALCNMAPTAALVLLVCSSVAHAANLRVAPLTNAQNALPNTINLAARADMEVDLGPFASAAEACDYCFGSFTKQGDKPAGPVAPFCVCMSYPKGGKHNMFCATPPSAAGYIATKNGCRCKAKDMEAMGKTTCKAI
Ga0307398_1082553513300030699MarineMASTMALIFLACAFGAQAAYLRNAPAAPLTNSSNGVMHLAYKANMQVDLGPFKDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307398_1082877813300030699MarineSSFLTATTSQQPSDNVVSHLAHCLGKMASTIAASALLMVAFSITAEAANLRSAPVAHLTNSSAQVESMNLVGRQFMEVDLGPFSSAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGQTTCKPISQ
Ga0307398_1083106213300030699MarineLKHISEQPSQRRQTQQTSCTMAPNTALFLLACCSMADAANLRVTPLTNAENAFPNTMQLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGQTTCKPI
Ga0307398_1084346313300030699MarineMASSATVAAVLLLCASGAQAANLRLANSTSTVIQHESMNLAAKTDMTVDLGPFATAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIADKNGCRCKAKDMEAMGKTTCAPISS
Ga0307398_1085571713300030699MarineSSLSVICHHRDIVEAHSCAMANKIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307399_1059141013300030702MarineMASSTTVAALLLLCASGAQAANLRLTNSTSSVVQHESMNFAAKANMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307399_1059268313300030702MarineWKQFYSLTSQTTKSAHRSLLLQEMASSMNVAVLFLLCASGAQAAILRGANSTSSMVQHESMKLKAKTDMTVDLGPFDTAAAACDYCFGSFTKDGEPPAGPVAPFCVCMAYPSGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307399_1059269513300030702MarineMASSTTMLALLFLCVSGAQAANLRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIADKKGCRCKAKDMEALGKTTCSPISA
Ga0307399_1059602513300030702MarineMASAMTTVALVLMCSIGAHASSLRFANTTVDTVQAATSMDLSAKTDMTVDLGPFASAADACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307399_1060675513300030702MarineMASSTTVAVVLLLCASGAQAANLRLANSTSIVVQHGSMNLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCTPISL
Ga0307399_1061446413300030702MarineMASGMTMAALFFLCASGAQAANLRFANSTSSVVQHESMNLAGMADMKVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTSCTPI
Ga0307399_1061657213300030702MarineMANVAAVTVLMLACSFTADASSLRTTNATQHESMNLAFKSDMKVDLGPFASAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307399_1063659713300030702MarineFGSSTIAAFAVSLTSDIEASLVLRKMALKALVIAVCIVGACAANLRTPATNSSLVTHEMMNLASRQFMEVDLGPFDTAADACDYCFSSFTKAGDKPAGPVAPFCVCMAYPEAGKHNMFCATPPSAAGYIAKKNGCRCKAKDMEAMGQTTCSPISA
Ga0307399_1064083413300030702MarineMASSTTVAAVLLLCASGAQAANLRLANSTSTVVQHESMNLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIADKNGCRCKAKDMEAMGKTTCTPISS
Ga0307399_1064538613300030702MarineMAFTKTLIFLACCATTQAASLRTTNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307399_1065617413300030702MarineMAFSKTLILLTCCVAAQAAFLRTSNSTNDLAQAGSMHFEAKAVMQVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0307399_1067683823300030702MarineMASTMALILMACSFGAQAVNLRNAPLANSSSTVDETMHLAAKEKFQVDLGPFASAADACDYCFGSFTKSGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307399_1067755113300030702MarineMAKLAAVFVLMAACSFTADAASLRAAPLTNSSTDEGMSLARSTFMKVDLGPFASSEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPSSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEALGKTTCQPI
Ga0307399_1068470213300030702MarineMASSATVAAILLLCASGAQAANLRLANSTSTVIQHESMNLAAKTNMTVDLGPFATAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPISS
Ga0307399_1068658113300030702MarineMASSNTMLALLFLCASSAQAANLRLANSTSSVVQHETMHLAAKANLTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPSGSQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307400_1072420313300030709MarineVICHHRDIVEAHSYAMASKIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307400_1083190213300030709MarineMASTMTTVALVLMCSIGAHASSLRFANTTVDAVQAATSMDLSAKTDMTVDLGPFASAADACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307400_1087464313300030709MarineSQPRQRSRRPEPSARQVMGSSTTVAALLLLCASGAQAANLRFTNSTSSVVQHESMNFAAKANMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307400_1088024523300030709MarineMVLILLACSVGAQAANLRVEPAAAVTNSTMHFAARENMQVDLGPFASAEAACDYCFGSFTKDGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKPI
Ga0307400_1089423113300030709MarineMASSMNVAVLFLLCASGAQAAILRGSNSTSSVVQHESMHLKATTDMTVDLGPFDTAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307400_1090802313300030709MarineMASIAALLFLCVSGAQAANLRLMNSTSSVVQHESMHLAAKADMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307400_1092757513300030709MarineMALIFLICAFGAQAANLRNAPVAPLTNSSAEIMHLASKANMQVDLGPFKDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307400_1093730413300030709MarineLKRQAMASVAAMLFLCLSGAQAANLRMMNSTSSVVQHESMHLDSKADMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVSPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307400_1093895513300030709MarineMAKVSAVVFLLAACISTAGATSLRAAPLTNATLQHESMNLASRFADSMKVDLGPFASAEAACDYCFGSFTKQGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAKGKTTCKAI
Ga0307400_1093955013300030709MarineMALIFLTCAFGAQAASLRNAPVAPLTNSSIEIMHLASKANMQVDLGPFTDAAAACDYCFGSFTKDGDKPAGPVAPFCMCMAYPTKGGHNMFCATPPSAAAHFLSEKNGCMCKAKDMEAMGQTTCKPI
Ga0307400_1096186913300030709MarineMAKVAAVFFLMAACSFSADAALLRAAPPAPVSNSSMHESMNLARSTFMKVDLGPFAGAAEACDYCFESFTKDGTAPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKANDQEAMGKTTCKSI
Ga0307400_1099472413300030709MarineMACSMTMAAMLFLCAFGAQAANLRLANSTSSVVQYESMNFAATADMKVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307400_1100629413300030709MarineLQPFTSAHFPSNEVQSANNTMASSMTMALFFLCAAGAQAANLRMMNSTSSVVSHESMNIGAKADMQVDLGPFSSAAEACDYCFGSFTKAGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0308139_107135913300030720MarineLKSCIPATFYTTDNEGSLANTRVTMASTMTTVAMVLMCAVSAQASSLRFANTTKGEVEVASSMHLSAKTDMTVDLGPFKDAPAACDYCFGSFTKTGDAPAGPVAPFCVCMAYPTAGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGQTTCKAI
Ga0308137_109601313300030722MarineHDSAQPQQRRQAQQSLRTMAPNAALFLLACCSMAHAANLRVTPLTNAEIALPNTMQLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKPI
Ga0308136_113580113300030728MarineMASNMALIFLACCVTAQAASLRTSNSTSNTVQVATSMNLNAKADMQVELGPFDSAAEACDYCFGSFTKQGDAPAGPVAPFCVCMAYPDNGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKAISVF
Ga0308136_114841413300030728MarineKLKALLTPLCSQIIRQRSDSMAKFAALIMLACSFGADATSLRAAPLTNSSVDHENMHLAARNFMKVDLGPFGSAEEACDYCFGSFTKEGQSPAGPVAPFCVCMAYPEGGKYNMFCATPPSAADYVQKKKGCTCKAKDMEAMGKTTCTPI
Ga0073967_1180392213300030750MarineLALTGANAVNLRNTNTTSATAASTAAMHLQSRQFMEVNLGPFDSAADACDYCFQSFTKEGQPPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKNMEQLGQTTCEPI
Ga0073968_1184264113300030756MarineMASTMTLIFMACAFGAQAVNLRNAPAAPLANSTMHLAAMEKVEVDLGPFGSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPVSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0073966_1152941313300030786MarineFRQRSYQSHTMALKLAVAIVAASAIACDAASLRTAPLTNSSDVEIMNLASRQFMKVDLGPFDTAEQACDYCFGSFTKKGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAGYIAEKKGCRCKEKDMEAMGKTTCKAISE
Ga0073966_1172055623300030786MarineMASTMTLIFMACAFGAQAVNLRNAPAAPLANSTMHLAAMEKVEVDLGPFGSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPVSGGHNMFCATPPSAAAYIAEKMVR
Ga0073964_1157566413300030788MarineAAFANCSTPDIVASDSSSQMALKVTALLLVAGISSADAASLRSAPATPLTNSSAVPQHEMMNLAARQFMEVDLGPFASAAEACDYCAGSFTKEGDKPAGPVAPFCVCMAYPTGGKYNMFCATPPSAAGYIAEKKGCRCKFKDMEAMGKTTCSAIN
Ga0073964_1163740713300030788MarineMTLIFMACAFGAQAVNLRSAPAAPLANSTMHLVAKEKVQVDLGPFGSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPVSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0073964_1167771113300030788MarineMVATLADATSLRTQSAATNATALHETMNIAARQFMEVNLGPFDSAADACDYCFQSFTKEGQPPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKNMEQLGQTTCEPI
Ga0073964_1172348913300030788MarineTQTTKKTRRTKTMASSMKMATMVMLCAFGAQAANLRFANSTAAVVQQGSMKLGATTDMKVDLGPFASAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPIDA
Ga0073963_1143018813300030859MarineMAAYTTFLLLACCVTAQASNLRTAPTASLTSPAMPETMVLAARANMTVDLGPFASAAEACDYCAGSFTKKGDEPAGPVAPFCVCMAYPNGGKYNMFCATPPSAAEYIAEKKGCRCKFKDMEAMGKTTCAKISL
Ga0073938_1197939713300030952MarineNKLPVSDIEAALHTCKMVMKATALLVLACSVSVDAASNLRTAPAKLEAALVNSSATEMMNLASRQYMEVELGPFKDAAAACDYCFGSFTKKGDKPAGPVAPFCVCMAYPADGGHNMFCATPPSAAKYIAEKQGCRCKAKDMEAMGQTTCKAI
Ga0073976_1160546313300030957MarineMAAYTTFLLMACCVTAQASNLRTAPTASLTSPAMPETMVLAARANMTVDLGPFGSAAEACDYCAGSFTKQGDKPAGPVAPFCVCMAYPDGGKYNMFCATPPSAAEYIAEKKGCRCKFKDMEAMGKTTCAKISL
Ga0073989_1338088913300031062MarineSSLLKTQIPLLKYKPPVIVAPSVRKMSAKVAATAILMLVCTGADAASLRSTNTTGATTQATMNLAKKAFMKVELGPFGSAEEACDYCFGSYTKEGDSPAGPVAPFCVCMAYPEDGGHNMFCATPPSAAKYIQEKNGCRCKEKDMEAMGKTTCEPIA
Ga0073989_1342747813300031062MarineMASKAFLVALAMVAIGADAANLRTTNATALHETMNLAARQFMEVNLGPFDSAADACDYCFQSFTKEGQPPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKNMEALGQTTCEPIS
Ga0073961_1164665513300031063MarineQVCSNLEPLLSAFQSGIVASSTSFRMNSKVAALILLACGFSAEAATLRASNSTAAAVTSHATMNLASKSFMKVDLGPFDSAADACDYCFQSFTKEGQPPAGPVAPFCVCMSYPDGGKHNMFCATPPSAAGYIAEKNGCRCKAKNMEQLGQTTCEPISA
Ga0073961_1211513323300031063MarineMKMATMVMLCAFGAQAANLRFANSTAAVVQQGSMKLGATTDMKVDLGPFASAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPIDA
Ga0138347_1005210113300031113MarineRSLKFCIMALKLVVAIVAASAIMSSATNLRTAPLANSSATETLSLDARQFMEVSLGPFTSAAKACDYCFGSFTKKGDKPAGPVAPFCVCMAYDDGGWNMFCATPPSAAKYVAEKGGCRCKAKDMEAMGQTTCKPI
Ga0138347_1068717313300031113MarineMALKLAVAIVAASAIMSGATNLRTAPLTNSSATETLTLDARQFMEVTLGPFRDAEQACDYCFGSFTKKGDKPAGPVAPYCVCMAYNEGGWNMFCATPPSAAKYVAEKNGCRCKEKDMENMGKTSCKPI
Ga0138347_1133656213300031113MarineAGLLSAHPPHVYNAVNEVDSSSSRAMAIAKAVIALACCISAQAVNLRSSNSTMAVMQHETMHLMAKANVQVELGPFASAAEACDYCFGSFTKEGQPPAGPVAPFCVCMAYPDGGDHKMFCATPPSAASYVASKKGCRCKAKDMENMGKTTCKPISE
Ga0138345_1082633913300031121MarineMAFNKALVLALCCTAHAVILRSANSTANEVEQGTMHLTAKAGMNMRMELGPFQDSAAACNYCFGSFTKKGDKPAGPVAPFCVCMAYPTQGMYNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCKPISA
Ga0138345_1105062513300031121MarineMASRVVAAFVAISCVLTAHGANLRVANSTEALATSNMFAHEAMNLESRQFMEVNLGPFADAAAACDYCFGSFTKTGDPPAGPVAPFCVCMAYPDGGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGATTCKPIEA
Ga0073952_1091242213300031445MarineMVSKAFVALMIAACANGAMLRTAELADPVTNSSVAGETMNLAAREFMKVELGPFASAAEACDYCFGSFTKQGQPPAGPVAPHCVCMSYPEGGQHNMFCATPTSASKYIAEKGGCRCVPRDMEAMGQTTCEPIH
Ga0073950_1114997613300031459MarineKACGIIFCASPQTTKLQSCTMAMKLLVAVMVASASAANLRLANSTGTETMNLASRQFMEVDLGPFKDAAAACDYCFGSFTKKGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCSPIS
Ga0073950_1133846513300031459MarinePLSDIVAVLFAYKMAMQIAALLVLACSVGVDASSLRTAPAKPEATLTNSSGTETMNLASRQFMEVDLGPFKDAAAACDYCFGSFTKKGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGQTTCKSI
Ga0073954_1065056713300031465MarineCHIAHLFGQRSYQSHTMALKLAVAIIAASAVAADATNLRTLPLVNSSDVETMNLASRQFMKVDLGPFGSAEEACDYCFGSFTKKGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKEKDMEAMGKTTCKSI
Ga0307388_1092031013300031522MarineEAHSYAMASKIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307388_1092235713300031522MarineMASTMTTVALVLMGSLGAHASNLRFENTTSVAAASMHLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKAI
Ga0307388_1096310623300031522MarineVISAMNSAVAVFFVACVFTAQAASLRTTNSSSNLVQHESMQISQKAGMTMTVDLGPFGSAAEACDYCFGSFTKTGQPPAGPVAPFCVCMAYPDGAGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAIA
Ga0307388_1105496213300031522MarineMNSAVAIFFGACVFTAQAASLRTTNSSTDMVQHESMQIGQKAGMTMTVDLGPFGSAAEACDYCFGSFTKTGQPPAGPVAPFCVCMAYPDGGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPIA
Ga0307388_1112051713300031522MarineMASTMALIFLTCAVGAQAASLRTAPVAPLTNSSNEIMHLASKANMQVDLGPFKDAAAACDYCFGSFTKDGEKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307388_1112933413300031522MarineMNTVAVVAFILACSGADAASLRMSNTTASTSQATMDLAAKTFMKVDLGPFDSAAEACDYCFGSFTKTGQPPAGPVAPFCVCMAYPDGGKHNMFCATPPSAAGYIAEKKGCRCKAKNMEAMGQTTCEPIE
Ga0307388_1114994913300031522MarineMALIFVACAFSAEAASLRNAPAAPLTSSSNEVMHLAYKANMTVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307388_1116114413300031522MarineMTTVALVLMGSLGAHATNLRFENTTSVAAASMHLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307388_1117446013300031522MarineLAQVLDRFSRTTNNQRSSIRPAIMANFAAVALLMLAGSFTADATSLRAAPLTNSTQGESMHLASQQGMSMKVDLGPFSSAADACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307388_1119623113300031522MarinePGSSSVVSHPRQRSARVERSNQQQMASFTNVAVLFLLCASGAQAAILRGSNSTSSVVQHESMHLKATTDMTVDLGPFDTAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307388_1123274713300031522MarineMASTMALIFLACFVSAQGSMLRTAPAAPLTNSSSKSEQNEVMHLAMKQRMQVDLGPFADAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKSGCRCKSKDMEALGKTTCSPI
Ga0307388_1123603413300031522MarineMASTMALLMMACAVTAQAANLRTDPVATLTNSTNDESMNLIAKADMRVDLGPFASAAEACDYCFGSFTKKGDAPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCAPIS
Ga0308134_116036513300031579MarineMASSMTALTMLLMCSYAANALKVTNSTSDMVQSGVSMSLGAKADMTVDLGPFADAAAACDYCFGSFTKTGQPPAGPVAPFCVCMAYPNGGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKAI
Ga0308134_116348113300031579MarineMAFRLFVACILGAVAYPTTATRSLRNSTEVQSSATMHISAQQFMEVNLGPFASSEEACNYCFESFTKEGQAPAGPIATACVCMAYPQDGGHNMFCATPPSAAGWVAEKKGCRCKPRDMEAMGKTTCTPIS
Ga0308132_112686613300031580MarineKHISAQPSQRRHTQQTLCTMAPNTALVLLACCSMAYAANLRVTPLTNAENAFPNTMQLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKPI
Ga0308132_113112213300031580MarineMASSMTMALFFLCASGAQAVNLRMMNSTSSVVSHESMNIGAKADMQVDLGPFSTAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0308132_113749413300031580MarineMVLILLACSVGAQAANLRVEPAAALTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTQGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307393_111826613300031674MarineFGSSSFFDASTGIVERLTFLRAMASTMALIFVACAFSAEAASLRNAPAAPLTSSSNEVMHLAYKANMTVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307393_115014313300031674MarineMLALLFLCASGAQAANLRLANSTSSVVQHESMHLAAKADMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307385_1040428313300031709MarineMASTMTTVALVLMVSLGAHATNLRFENTTSVAAASMHLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCQKIS
Ga0307386_1050739813300031710MarineMLALLFLCASSAQAANLRVANSTSSVVQHGTMHLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPSGGKHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCSPISL
Ga0307386_1054417113300031710MarineCHHRDIVEAHSYAMASKIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307386_1056088213300031710MarineMASVAALLFLCLSGAQASNLRLTNSTSSVVQHESMHLAAKADMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307386_1056352413300031710MarineMAAFVMVSCGYSADATSLRSAPAATLTNSSALHETMHLAARQFMEVDLGPFADAAAACDYCFSSFTKQGDKPAGPVAPFCVCMAYPEGGKYNMFCATPPSAAGYIAKKKGCRCKAKDMEAMGKTTCSPI
Ga0307386_1061407913300031710MarineMASATALIFLACSVGAQASVLRTAPAAPLTNSSSKAEKNEVMHLAMKQRMQVDLGPFADAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCSPI
Ga0307386_1061961813300031710MarineMNSAVAVFFVACVFTVQAASLRTTNSSSNLVQHESMQIGQKAGMTMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMAYPDGGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPIA
Ga0307386_1066966813300031710MarineWLKTWKQFYSLTSRATKWPHRSLLLQEMASSMNVAVLFLLCASGAQAAILRGANSTSSMVQHESMKLEAKTDMTVDLGPFDTAAAACDYCFGSFTKDGEPPAGPVAPFCVCMAYPSGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307386_1071809113300031710MarineMANVAAVTVLMLACSFTADASSLRTTNATQHESMNLAFKSDMKVDLGPFKSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307386_1073280513300031710MarineMASSTTVAAVLLLCASGAQAANLRLANSTSIVVQHESMNLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIADKNGCRCKAKDMEAMGKTTCTPISS
Ga0307386_1073343513300031710MarineSASIASQPTQRSRRPEPSDRQVMASSTTVAALLLLCASGAQAANLRLTNATSSVVQHESMNLAAKANMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCAPIS
Ga0307386_1073908413300031710MarineMASTMTTVALVLMVSLGAHATNLRFENTTSVAAASMHLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307386_1077026313300031710MarineFHFQRRQTLQPRCTMAPNTALFLLACCSMAHGANLRVTPLTNAENALPNSMNLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKPI
Ga0307386_1078143913300031710MarineWLKPILAHATHASQRRPSQQALCKMAPTAALVLLVCSSVAHAANLRVAPLTNAQNALPNTINLAARADMEVDLGPFASAAEACDYCFGSFTKQGDKPAGPVAPFCVCMSYPKGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307386_1078351013300031710MarineMTTLALVLMCSVGAHASNLRFANASVDLKFVDAVQTATSMDLSAKTDMTVDLGPFASAADACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307386_1078507113300031710MarineMASTMVFVLLACSSGAQAAFLRNAPVPPAPVTNSSTEIMHLAMKANMQVDLGPFQDAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCQGI
Ga0307386_1080627313300031710MarineMALIFVACAFGAQAAVLRTAPAVPLKKTEPAAPLTNSSNGVMHLAYKANMQVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTSGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCSPI
Ga0307386_1080736613300031710MarineMASGMTMAALFFLCASGAQAANLRLANSTSSVVQHESMNLAGMADMKVDLGPFATAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307396_1045131813300031717MarineVICHHRDIVEAHSYAMASKIVFAALLVVVADAASLRTTPLTNSSAMPETMSLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307396_1048255113300031717MarineMLALLFLCASSAQAANLRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKDGDKPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307396_1054359513300031717MarineASTGNVVRLTSLRAMASTMALIFVACACGAEAASLRNAPAAPLTSSSNEVMHLAYKANMTVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307396_1063571613300031717MarineDNVVSHLARCLGKMASTIAASALLMVALSITAEAANLRSAPVAHLTNSSALGESMNLVGRQFMEVDLGPFSSAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDGGKYNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGQTTCTPISQ
Ga0307381_1025689313300031725MarineGICHHRDIVEAHSFAMANNIVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307381_1030229613300031725MarineMASTMIFILLACVSGAQAASLRNAPAAPAPMTNSSSEIMHLAMKANMQVDLGPFKDAAAACDYCFGSFTKDGEAPAGPVSPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307381_1034154613300031725MarineMASTKAMIFLACCVTAQAAVLRSANATNAVAQVGATMNLGAKTDMRVELGPFASAADACDYCFSSFTKTGQPPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAKKNGCRCKAKDMEAMGKTTCKDI
Ga0307381_1035176313300031725MarineMASVAALLFLCVSGAQAANLRLMNSTRSVVQHESMNLAAKADMKVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307391_1075527513300031729MarineMNSQVAAVLILACAFGGDATSLRAMNTSTADIMHESMDLASRSFMKVDLGPFASAAEACDYCFGSFTKKGDAPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307391_1075959913300031729MarineMASTMALIFLVCFVSAQASMLRTAPAAPLTNSSSKSEQNEVMHLAMKQRMQVDLGPFAGAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEALGKTTCSPI
Ga0307391_1077210013300031729MarineMIFILLACVSGAQAAVLRTAPAPPAPEIMHLAMKANMTVDLGPFQDAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307391_1084760413300031729MarineMASSATVAAVLLLCASGAQAANLRLANSTSTMIQHESMNLAAKTNMTVDLGPFATAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPISQ
Ga0307391_1089771013300031729MarineQVFVHFPTSDIVATHFPRKMAFKVAALLTVACIFSADAASLRSAPATPLTNASMVPEMMNLASRQFMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEGAKYNMFCATPPSAAGYIAKKKGCRCKAKDMEAMGQTTCSPI
Ga0307391_1090994013300031729MarineMASSTTMLVLLFFCVSGAQAANLRLANSTSSVVQHESMQLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307391_1091527413300031729MarineSIVLTSRTTKWPHRSLLLQEMASSMNVAVLFLLCASGAQAAILRDANSTSSMVQHESMKLEAKTDMTVDLGPFDTAAAACDYCFGSFTKDGEPPAGPVAPFCVCMAYPSGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307397_1051786413300031734MarineLAQTCKQFYSLTSQTTKSAHRSLLLQEMASSMNVAVLFLLCASGAQAAILRGANSTSSMVQHESMKLKAKTDMTVDLGPFDTAAAACDYCFGSFTKDGEPPAGPVAPFCVCMAYPSGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307397_1054368813300031734MarineMASTMALILLACSFSAQAASLNLRAAPAAPLTNSSKEVMHLAMKERMQVDLGPFGDAAAACDYCFDSFTKDGTPPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCKPI
Ga0307397_1054968813300031734MarineMASSATVAAVLLLCASGAQAANLRLANSTSTVIQHESMNLAAKTNMTVDLGPFATAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCAPISS
Ga0307397_1056281313300031734MarineMASGMTMAALFFLCAFGAQAANLRFANSTSSVVQHESMNLAGMADMKVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307397_1057053213300031734MarineLKTWKQFHNSHTRQRSRRPDPSERQTMASTVAAVFFLCVTGAQAASLRLTNSTSSVVQQGTMNLASKAHMTVDLGPFATAAAACDYCFGSFTKAGDKPAGPVAPFCVCMAYPDAGQHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGQTTCAPIS
Ga0307397_1057269913300031734MarineMASTMALIFLACFVSAQASMLRTAPAAPLTNSSSKSEQNEVMHLAMKQRMQVDLGPFAGAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEALGKTTCSPI
Ga0307397_1059089413300031734MarineFFFSYRAHLSRQRSNRPRTMVSKIAALLVVACSLSAEATLLRSSPAPAAKLTNSSTQLETMDLAARQFMEVDLGPFNTAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGKHNMFCATPPSAAGYIAKKNGCRCKAKDMEAMGQTTCKPIA
Ga0307397_1059909913300031734MarineFTSAHFPSNEVQSANNTMASSMTMALFFLCAAGAQAANLRMMNSTSSVVSHESMNIGAKADMQVDLGPFSSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKAI
Ga0307397_1060214113300031734MarineMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLSAKQDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0307397_1061613713300031734MarineMASSDTMLALLFLCASSAQAANLRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIADKKGCRCKAKDMEALGKTTCSPISA
Ga0307397_1062073313300031734MarineMALIFVACAFGAQAAVLRTAPAVPLNRTEPAAPLTNLSNGVMHLAYKANMQVDLGPFKDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEALGKTTCSPI
Ga0307394_1031625613300031735MarineMASVAALLFLCVSGAQASNLRLTNSTSSVVQHESMHLAAKADMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307394_1039530013300031735MarineSLHKLITFRHRSSAAHRFLQMMALKVTALLLVACISSTDAASLRSAPAAPKAPLTNSSAAPMESMNLASRQFMEVDLGPFDSAAAACDYCFGSFTKKGDAPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307394_1039591813300031735MarineLAQVFVHFPTSDIVATHFPRKMAFKVAALLTVACIFSADAASLRSAPATPLTNASMVPEMMNLASRQFMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEGAKYNMFCATPPSAAGYIAKKKGCRCKAKDMEAMGKTTCSPI
Ga0307394_1043744613300031735MarineSEQPSQRRQTQQTHCTMAPNTALFLLACCSMADAANLRVTPLTNAENALPNTMQLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGQTTCKPI
Ga0307394_1045677513300031735MarineMALIFLTCAFGAQAASLRNAPVAPLTNSSAEIMHLASKANMQVDLGPFTDAAAACDYCFGSFTKDGEKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307394_1046425813300031735MarineTFHFQRRQTLQTLCTMAPNTALFLLACCSMAHGANLRVTPLTNAENALPNSMNLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKPI
Ga0307394_1046545013300031735MarineMLALLFLCASGAQAANLRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKDGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCSPISQ
Ga0307394_1047953713300031735MarineVSSSTSDIVAVQIPHKMAMKVAALLMVACIFSADAASLRIAPPTPLTNSSMNLASRQYMEVDLGPFASAADACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307387_1066886613300031737MarineMNSAVVVFFGACVFTAQAASLRTTNSSTDMVQHESMQIGQKAGMTMTVDLGPFGSAAEACDYCFGSFTKTGQPPAGPVAPFCVCMAYPDGGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPIA
Ga0307387_1090420113300031737MarineGSSTFHFQRRQTLQTLCTMAPNTALFLLACCSMAHGANLRVTPLTNAENALPNSMNLAARADMEVDLGPFASAAEACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKPI
Ga0307387_1093609913300031737MarineAALLVVAADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKA
Ga0307387_1102545313300031737MarineMLALLFLCASGAQAANLRLANSTSSVVQHESMQLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307387_1109117013300031737MarineMTTLALVLMCSFGAHASNLRFANASVDLKFVDAVQTATSMDLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKT
Ga0307387_1110439323300031737MarineMCAFSAQASMLRFANTTKGEVQTASSMHLSAKADMTVDLGPFKDAPAACDYCFGSFTKEGQSPAGPVAPFCVCMAYPTAGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGQTTCKAI
Ga0307387_1110613013300031737MarineMASTMTTVALVLMCAVAADASSLRFANATKGEVQTASSMHLAAKADMTVDLGPFANAAEACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0307387_1111415013300031737MarineMASSTTVALVLLLCAAGAQAAVLRQANSTSAVVQHESMNFAAKTNMTVDLGPFATAADACDYCFGSFTKDGDKPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307387_1112471413300031737MarinePILAHATHASQRRPSQQALCKMAPTAALVLLVCSSVAHAANLRVAPLTNAQNALPNTINLAARADMEVDLGPFASAAEACDYCFGSFTKQGDKPAGPVAPFCVCMSYPKGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307384_1045894713300031738MarineMASTMALIFLACSVGAQAAVLRTAPAAPLTNSSSKSEKNEVMHLAMKQRMQVDLGPFADAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSEAAYIAEKNGCRCKAKDMEAMGKTTCSPI
Ga0307384_1053599213300031738MarineMLACSVTAQATNLRTEPAASLTNSSTQFESMHLMAKADMRVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCAPISA
Ga0307384_1053618113300031738MarineSSLDRLSCAPNRERSILRPANMANFAAVALMMAACSFTADATSLRAAPLSNATQHESMNLASREFMKVDLGPFKSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307384_1057317113300031738MarineMTLTPALVLLVCSSVAQAANLRVAPLTNAEKALPNTFQLAAKADMEVDLGPFASAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307384_1057795213300031738MarineMASTMVFVLLACSSGAQAAFLRNAPVPPAPVTNSSTEIMHLAMKANMQVDLGPFTSAAEACDYCFGSFTKDGTPPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCKPI
Ga0307384_1059728413300031738MarineMALIFLTCAFGAQAASLRNAPVAPLTNSSNEIMHLASKANMQVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPFCMCMAYPTKGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGQTTCKPI
Ga0307384_1060656813300031738MarineMASSTTVAAVLLLCASGAQAANLRLANSTSTVVQHESMNLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIADKNGCRCKAKDMEAMGKTTCTPISS
Ga0307384_1062088613300031738MarineMASAMTTVALVLMCSIGAQASSLRFANTTVDAAQTATSMNLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPL
Ga0307384_1064924413300031738MarineMLALLFLCASSAQAANLRVANSTSSVVQHGTMHLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPSGGKHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCTPI
Ga0307384_1065429513300031738MarineLKTRELCCNLASQTTKCERHTMASSMTMAALLLLCASGAQAVNLRNATASVVQHESMKLAAKADMQVDLGPFKSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307384_1066234513300031738MarineMAKIAAVAFVMAACIFTADATSLRAAPLTNATQHESMNLAFKSDMKVDLGPFASAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGRNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307384_1066455713300031738MarineWLKTLAVQITKTRLELSKRQAMASIATLLFLCVSGAQASNLRLTNPTSSVVLHESMHLAAKANMTVDLGPFADAAAACDYCFGSFTKTGQPPAGPVAPFCVCMAYPSDGGYNMFCSTPPSSAGYIADKSGCRCVPKDMEAMGQTTCTPIG
Ga0307384_1066576513300031738MarineMASGMTMAALFFLFASGAQAANLRFANSTSSVVQHESMNLAGMADMKVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGQTTCSPISL
Ga0307384_1067387313300031738MarineSFRQRSRSTILLAMASTMVLILLACSVGAQAANLRAEPAALVTNSSSMHLAARENMQVDLGPFASAADACDYCFGSFTKDGDKPAGPVAPFCVCMAYPTKGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKPI
Ga0307383_1067327813300031739MarineMNSSVAVFLACVFTAQAASLRTTNSSSNLVQHESMQISQKAGMTMTVDLGPFDSAAAACDYCFSSFTKTGQPPAGPVAPFCVCMAYPDGAGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKAIA
Ga0307383_1067463113300031739MarineMASSTTVAAVLLLCASGAQAANLRLANSTSTVVQHESMNLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCTPISQ
Ga0307383_1067886213300031739MarineIVSHPRQRSARVERSNQQQMASFTNVAVLFLLCASGAQAAILRGSNSTSSVVQHESMHLKATTDMTVDLGPFDTAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307383_1067894313300031739MarineKTRELCCNLASQTTKCERQTMASSMTMAALLLLCASGAQAVNLRNATASVVQHESMKLAAKADMQVDLGPFKSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCTPI
Ga0307383_1068137413300031739MarineMASAMTTVALVLMCSIGAHASSLRFANTTVDAVHSATSMNLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGSAHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307383_1069171213300031739MarineMAATMALIFLTCAFGAQAASLRNAPVAPLTNSSNEIMHLASKANMQVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAFIAEKNGCMCKAKDMEAMGQTTCKPI
Ga0307383_1072961013300031739MarineGSSTFHFQRRQTLQTLCTMAPNTALVLLACCSMAHGANLRVTPLTNAENALPNSMNLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKPI
Ga0307383_1074558913300031739MarineSEQTSQRRQTQQTPCTMAPNTALFLLACCSMADAANLRATPLTNAENAFPNTMQLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKGGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGQTTCKPI
Ga0307395_1038997413300031742MarineMASTMALIILACSVGAQASVLRTAPAAPLTNSSSKSEQSEVMHLAMKTRMQVDLGPFADAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEALGKTTCSPI
Ga0307395_1042426413300031742MarineFANFSTPDIVATHFPSKMAFKVAALLTVACIFSADAASLRSAPATPLTNSSMLPQNEMMNLASRQFMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEGAKYNMFCATPPSAAGYIAKKKGCRCKAKDMEAMGKTTCSPI
Ga0307395_1045763313300031742MarineMASKMAMAALVVVACGVAAEATSLRAAPLTNSSAQHESMDLNPSKFMEVDLGPFASAADACDYCFSSFTKKGDNPAGPVAPFCVCMAYPEGAKHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCSPI
Ga0307395_1047801913300031742MarineMAMKVAALLMVACIFSADAASQRNAPATPLTNSSMNLASRQYMEVDLGPFASAADACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307395_1048304213300031742MarineSVAALLFLCVSGAQASNLRLTNSTSSVVQHESMHLAAKADMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307395_1049186413300031742MarineMAATMALIFVTCAFGAQAASLRNAPAASWTNSSNEIMHLASKANMQVDLGPFTDVAAACDYCFGSFTKDGEKPAGPVAPFCMCMAYPTKGGHNMFCATPPSAAAYIAEKKGCMCEAKDMEAMGQTTCKPI
Ga0307395_1049390313300031742MarineMALIFLACFVSAQASMLRTAPAAPLTNSSSKSEQNGVMHLAMKQRMQVDLGPFADAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEALGKTTCSPI
Ga0307395_1049902013300031742MarineMAPSTTVALVLLLCAAGAQAAVLRQANSTSTVVQHESMNFAAKTNMTLDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307395_1050537413300031742MarineKPGSSSEVSHPRQRSARVERSNQQQMASFTNVAVLFLLCASGAQAAILRGSNSTSSVVQHESMHLKAATDMTVDLGPFDTAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307395_1051892413300031742MarineMASTMMALLLLCASGAQAANLRLMNSTSSEFQHESMKLTATTDMRVDLGPFASAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGNTTCSPI
Ga0307382_1039388313300031743MarineMASTMALIFLACFVGAQASMLRTAPAAPLTNSSSNSEKSGVMHLAMKQRMQVDLGPFADAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307382_1039425513300031743MarineMNTVAVVLMCAFGAHASNLRFENSTSAVVSTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307382_1048233213300031743MarineTFHFQRRQTLQTLCTMAPNTALFLLACCSMAHGANLRVTPLTNAEKALPNSMNLAARADMEVDLGPFASAADACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGQTTCKPI
Ga0307382_1050393013300031743MarineMASVAALLFLCVSGAQASNLRLTNPTSSVVLHESMHLAAKADMKVDLGPFATAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307382_1057093113300031743MarineMALIFLTCAFGAQAASLRNAPVAPLTNSSNEIMHLASKANMQVDLGPFTDAAAACNYCFGSFTKDGEKPAGPVAPFCMCMAYPTKGGHNMFCATPPSAAAYIAEKKGCMCQAKDMEAMGQTTCKPI
Ga0307382_1058735513300031743MarineMLALLFLCASSAQAANLRVANSTSSVVQHGTMHLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCSPISL
Ga0307389_1061368813300031750MarineMNSAVAVFLACVFTAQAASLRTTNSSTDVVQHESMQIGQKAGMTMTVDLGPFGSAAEACDYCFGSFTKTGQPPAGPVAPFCVCMAYPDGGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKQI
Ga0307389_1079710213300031750MarineMNSQVAAVLLLACAFSADATSLRAVNTTTVELGSMDLASRAFMKVDLGPFASAAEACDYCFGSFTKKGDAPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKAI
Ga0307389_1084084913300031750MarineMANKILFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307389_1091253713300031750MarineSSSFFDASTGNVVRLTFLRAMASTMALIFVACAFSAEAASLRNAPAVPLTSSSNEVMHLAYKANMTVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307389_1115127213300031750MarineFAQAILAQVSTSSEQRSRTRTLNTMSCTKVFLLLACCGAAQAANLRMTNSTQDMVQHESMNLAAKAHMSVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPEGGQHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCAPISA
Ga0307389_1119463613300031750MarineFGSSTFHFQRRQTLQTLCTMAPNTALFLLACCSMAHGANLRVTPLTNAENALPNSMNLAARADMEVDLGPFASAAEACDYCFGSFTKKGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKKGCRCKAKDMEAMGKTTCKPI
Ga0307389_1120770713300031750MarineMTTIALVLMCSFTAHATSLRMTNSTGGVAQAGTSMELSAMTDMTVDLGPFKDAPAACDYCFGSFTKTGQPPAGPVAPFCVCMAYPTAGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGQTTCKAI
Ga0307389_1121456413300031750MarineATDTMNTVAVVLMCAFGAHASNLRFENSTSAVVSTGTSMSLSAKTDMTVDLGPFASAADACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307404_1031075513300031752MarineMAALIFVACAFSAEAASLRNAPAVPLTSSSNEVMHLAYKANMTVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307404_1036426513300031752MarineLKSVICHHRDIVEAHSYAMASKVVFAALLVVVADAASLRTTPLTNSSAMPETMNLKASSDMEVDLGPFASAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPKAGKYNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0307404_1044329913300031752MarineSSSVVSHPRQRSARVERSYSQKMASFTNVAVLFLLCASGAQAAILRGSNSTSSVVQHESMHLKATTDMTVDLGPFDTAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307404_1044500313300031752MarineMASSTAMLALLFLCASSAQAANLRLANSTSSVVQHESMQLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307404_1046471013300031752MarineMAPSTTVALVLLLCAAGAQAAVLRQANSTSVVVQHESMNFAAKTNMTLDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307404_1047087413300031752MarineMAKVSAVVFLLAACIFTAGATSLRAAPLTNATLQHESMNLASRFADNMKVDLGPFASAEEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKAI
Ga0307404_1049000613300031752MarineSSVGQIFSAITQQRSKHIKPGIMAKFAAVLMLACAFGADATSLRAAPLTNATVAHESMNLASSQYMKVDLGPFSSAEEACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCQKI
Ga0307404_1051106213300031752MarineQANLAHATHASQRRPSQQALCNMAPTAALVLLVCSSVAHAANLRVAPLTNAQNALPNTINLAARADMEVDLGPFASAAEACDYCFGSFTKQGDKPAGPVAPFCVCMSYPKGGKHNMFCATPPSAAGYIASKNGCRCKAKDMEAMGKTTCKAI
Ga0314684_1086011013300032463SeawaterFNQVRITGKRRGTTANFCKMASTTAALVLMCAFTAQASFLRFENTTSNAVTTCTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314684_1087169113300032463SeawaterMASNMALIFLVCCVTAQATMLRTANSTQEVAQASSMNLNSKAMMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0314684_1087263313300032463SeawaterMASKMMLIIAALAIGAEAINVRSTNATLATESMNLATRQFMEVNLGPFGSAAEACDYCFSSFTKEGQSPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAEYIQKKNGCRCKAKDMEAMGKTTCKPI
Ga0314684_1088042313300032463SeawaterFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTVVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314670_1054483913300032470SeawaterLKLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314668_1041998113300032481SeawaterGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314668_1063702113300032481SeawaterMAPSMTTVALVLMAAGGAQAANLRFENTTSVAATSMHLSAKTDMTVDLGPFASAADACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314675_1039023713300032491SeawaterKLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314675_1055666213300032491SeawaterMACTKTLIFLACCATTQAVSLRATNATDVQVASMHLSAMTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314675_1065692213300032491SeawaterMASTKAMILLACVVAAQATMLRTANTTNAVAQVGSMHLDSKAMMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0314679_1048660913300032492SeawaterMAKFAAAIFALAATGADAIALRTDNSTAATESMHLSSRQFMEVNLGPFNSAAEACDYCFSSFTKEGQSPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAEYIQKKKGCRCKAKDMEAMGKTTCKPI
Ga0314679_1053138613300032492SeawaterMAPAMTAVALVLMCSIGTNASSLRFANTTVDAAQTATSMTLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314679_1053636613300032492SeawaterFWLKLWFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTVVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314688_1045301513300032517SeawaterLKLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTVVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314688_1069206413300032517SeawaterMASKMTMALFFLCASGAQATNLRMMNSTSSVVSHESMKIGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314688_1071678813300032517SeawaterMVLVLLACSVGAQAANLRVEPAPVLTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKSI
Ga0314688_1072336013300032517SeawaterMAFTKTLIFLACCATTQAISLRATNSTDVQVASMHLSAMTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAAKKGCRCKAKDMEAMGKTTCKPI
Ga0314688_1074386113300032517SeawaterMALIVLSCLVGAQAANLRTEPAAPMTNSSLETMHFAFKENMKVDLGPFASAEEACDYCFGSFTKEGQSPAGPVAPFCVCMAYPNGGNYNMFCATPPSAAGYIAKKNGCRCKAKDMEAMGKTTCKDI
Ga0314689_1061902713300032518SeawaterMVLVLLACSVGAQAANLRVEPAPVLTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTKGGHNMFCATPPSAAKYIAEKNGCRCKAKDM
Ga0314689_1061949013300032518SeawaterMAFTKTLIFLACCATTQAISLRATNSTDVQVASMHLNAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAAKKGCRCKAKDMEAMGKTTCKPI
Ga0314689_1063930813300032518SeawaterLKLKACEHQTSFRQRSKRNCPVRTMASNMALIFLVCCVTAQATMLRTANSTQEVAQASSMNLNSKAMMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCSPIA
Ga0314689_1068455013300032518SeawaterGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314689_1071513613300032518SeawaterQPFTSAHFLSNEVQSTNNTMASSMTMALFFLCAAGAQAANLRMMNSTVSHESMNIGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314676_1056199813300032519SeawaterLKLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314676_1073001613300032519SeawaterMAFTKTLIFLACCATTQAISLRATNSTDVQVASMHLSAMTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314676_1076984313300032519SeawaterMTTLSMVLMWSFGAHASNLRFANASVGLKFVDAVQTASSMELSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314667_1071543113300032520SeawaterFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314667_1076322113300032520SeawaterMAKVAAILLIAAFASADAVALRSANTTVAQVESMNLASKKFMKVELGPFASAAEACDYCFSSFTKEGQSPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCQKI
Ga0314680_1061724913300032521SeawaterMNTLAVVLMCAFGAHASNLRFENSTSTVVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314680_1087735713300032521SeawaterMACTKTLIFLACCATTQAVSLRATNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAAKKGCRCKAKDMEAMGQTTCKPI
Ga0314680_1100701013300032521SeawaterMAMKVAAILLFACSFTADATSLRAAPLSNATTVSETMHLASGKTMKVDLGPFASAEEACDYCFGSFTKDGDKPAGPVAPFCVCMSYPDAGGHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCSPISA
Ga0314680_1106864013300032521SeawaterMARLAFIAPFAILAVASAANLRTAVDSPATNQTMNFAARQFMEVNLGPFDSAAAACDYCFGSFTKEGQPPAGPVAPFCVCMAYPEGAKYNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCAPI
Ga0314677_1063734723300032522SeawaterMTALTMLLMCSFSANALKLTNSTSDMVQSGASMSFGAKTDMTVDLGPFADAAAACDYCFGSFTKTGQPPAGPVAPFCVCMAYPNAGKYNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314677_1068119713300032522SeawaterLGLRSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTVVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314682_1054652013300032540SeawaterMAFTKTLIFLACCATTQVVSLRATNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314682_1067378913300032540SeawaterLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314682_1074135913300032540SeawaterMVLILLACSVGAQAANLRVEPAAAVTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKSI
Ga0314674_1069911113300032615SeawaterLFTNAHFLSNEVQSTNNTMASSMTMALFFLCAAGAQAANLRMMNSTVSHESMNIGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314674_1072010813300032615SeawaterMAPAMTTVALVLMCSIGAHASSLRFANTTVDVAQTATSMTLAAKTDMTVDLGPFASAADACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314671_1068804413300032616SeawaterALVTMAPSMTTVALILMGSLGAHASNLRFENTTSVAAASMHLTAKTDMTVGLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314671_1069555413300032616SeawaterQAFWHSAKAFGTVRQRSRREFPALLAMAFTKTLIFLACCATTQAVSLRATNTTDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314671_1075162913300032616SeawaterCNTDNVGKATDTMNTLAVVLMCAFGAHASNLRFENSTSTVVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314671_1079871113300032616SeawaterSSPFNQVRITGKRRGTTANFCKMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314683_1083739313300032617SeawaterMVLILLACSVGAQAANLRVEPAAAVTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTKGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKSI
Ga0314683_1085600713300032617SeawaterMASNMALIFLVCCVTAQATMLRTANSTQEVAQASSMNLNSKAMMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKPI
Ga0314683_1089936913300032617SeawaterLGFRSFQHLCNTDNVGKTTDTMNTIACVLMCVVGTHASNLRFENSTSTVVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314683_1094084313300032617SeawaterMASAMTTLALVLMCSIGAHASSLRFANTTVDAAQTATSMNLVAKSDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314673_1041652913300032650SeawaterLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314673_1057130613300032650SeawaterMVLVLLACSVGAQAANLRVEPAAVLTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKSI
Ga0314673_1064639613300032650SeawaterMAFNMTTMALLLLCPAAAINLRSANSTFDMAMQGSMHLANAADRQMKVDLGPFDSAADACDYCFGSFTKAGDKPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGQTTCKPISV
Ga0314673_1064911013300032650SeawaterMALIVLSCLVGAQAANLRTEPAAPMTNSSLETMHFAFKENMKVDLGPFASAEEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAVKYIAEKNGCRCKAKDMEAMGKTTCKKI
Ga0314673_1065990513300032650SeawaterMASKMTMALFFLCASGAQATNLRMMNSTSSVVSHESMKIGAQTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314673_1069065113300032650SeawaterLKNLQPFTSAHFLSNEVQSTNNTMASSMTMALFFLCAAGAQAANLRMMNSTVSHESMNIGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314685_1061920613300032651SeawaterMAPAMTAVALVLMCSIGTNASSLRFANTTVDAAQTATSMNLVAKSDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314685_1068969313300032651SeawaterQHLGTALKLLKTVRQRRRRTFATLLEMAFTKTLIFLACCATTQAISLRATNSTDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314678_1049102813300032666SeawaterLKLKACEHQTSFRQRSKRNCPVRTMASNMALIFLVCCVTAQATMLRTANSTQEVAQASSMNLNSKAMMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKPI
Ga0314678_1055677813300032666SeawaterPFNQVRITGKRRGTTANFCKMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314687_1042357413300032707SeawaterMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314687_1060941323300032707SeawaterMAPAMTAVALVLMCSIGTNASSLRFANTTVDAAQTATSMTLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314687_1071454013300032707SeawaterLKPFWLKLWSAFRTIPRQRSSIKVGIMAKVSAVVFLLAACIFTAGATSLRAAPLTNATLQHESMNLASRFADNMKVDLGPFASAEEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCSPI
Ga0314687_1075116913300032707SeawaterSSPFNQVRITGKRRGTTANFCKMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCAPISA
Ga0314687_1077714813300032707SeawaterFWLKNLQLFTSAHFLSNEVQSTNNTMASSMTMALFFLCAAGAQAANLRMMNSTVSHESMNIGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314669_1045565613300032708SeawaterFWLKLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314669_1068957213300032708SeawaterMACTKTLIFLACCATTQAVSLRATNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0314669_1073693213300032708SeawaterMVLILLACSVGAQAANLRIEPAAAVTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTNGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKSI
Ga0314669_1077604313300032708SeawaterKNLQPFTSAHFLSNEVQSTNNTMASSMTMALFFLCAAGAQAANLRMMNSTVSHESMNIGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314681_1069834813300032711SeawaterMVLVLLACSVGAQAANLRVEPAAVLTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTKGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKSI
Ga0314690_1057782113300032713SeawaterKLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314690_1059985113300032713SeawaterQDSAALLRSRISQGTKQVPRALRKANKTMASSMTMALFFLCAAGAQAANLRMMNSTVSHESMNIGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314690_1062671413300032713SeawaterMASNMALIFLACCVTAQATMLRTANATQAVAEASSMNLNSKAMMRVELGPFGSAAEACDYCFGSFTKEGQSPAGPVAPFCVCMAYPNGGNYNMFCATPPSAAGYIAKKNGCRCKAKDMEAMGKTTCKDI
Ga0314686_1060633513300032714SeawaterGFRSFQHLCNTDNVGKTTDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314686_1061153913300032714SeawaterMAAKTAALLLACLVGTEAVALRAANSTEVAHGASMYLASKQFMEVNLGPFNSAAEACDYCFSSFTKSGQPPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAEYIQKKNGCRCKAKDMEAMGKTTCSPI
Ga0314703_1033078313300032723SeawaterGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314695_142634013300032724SeawaterQLFTSAHFLSNEVQSTNNTMASSMTMALFFLCAAGAQAANLRMMNSTVSHESMNIGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314693_1061126813300032727SeawaterLKQHFGTTLELLKNVRQRSRHKFPALLAMAFTKTLIFLACCATTQAVSLRATNATDVQVASMHLSAKTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314693_1067581613300032727SeawaterMVLVLLACSVGAQAANLRVEPAPVLTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTKGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKSI
Ga0314693_1080588013300032727SeawaterFGSSSPFNQVRITGKRRGTTANFCKMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0314697_1053179913300032729SeawaterMASTKAMILLACVVAAQATMLRTANTTNAVAQVGSMHLGSKAMMRVELGPFGSASEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIADKKGCRCKAKDMEAMGKTTCKAI
Ga0314699_1053189513300032730SeawaterALVTMAPSMTTVALILMGSLGAHASNLRFENTTSVAAASMHLTAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314711_1049214813300032732SeawaterMTTVALILMGSLGAHASNLRFENTTSVAAASMHLTAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAMNYSLNYFKFRHYAIYR
Ga0314711_1062864313300032732SeawaterWLKLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314714_1059237013300032733SeawaterMTTVALILMGSLGAHASNLRFENTTSVAAASMHLTAKIDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314714_1075802913300032733SeawaterKMMLIIAALAIGAEAINVRSTNATLATESMNLATRQFMEVNLGPFGSAAEACDYCFSSFTKEGQSPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAEYIQKKNGCRCKAKDMEAMGKTTCKPI
Ga0314710_1043142613300032742SeawaterFWLKLGFCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314707_1037902413300032743SeawaterMASTKAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314707_1057916213300032743SeawaterLKHFGTTLKLLKNVRQRSRHKFPALLAMAFTKTLIFLACCATTQAISLRATNSTDVQVASMHLSAMTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPDAGGHNMFCATPPSAAGYIAAKKGCRCKAKDMEAMGKTTCKPI
Ga0314705_1068597913300032744SeawaterVNLGSHFASSPFNQVRITGKRRGTTANFCKMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314704_1052165413300032745SeawaterNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314704_1071425513300032745SeawaterVNLGSYFASSPFNQVRITGKRRGTTANFCKMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLTAKQDMTVDLGPFASAAEACDYCFDSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314704_1077548513300032745SeawaterPFTSAHFLSNEVQSTNNTMASSMTMALFFLCAAGAQAANLRMMNSTVSHESMNIGAKTDMQVDLGPFSSAAEACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314704_1079504113300032745SeawaterRSKSIRLSAMASSMVLILLACSVGAQAANLRVEPAAAVTNSTMHLAARENMQVDLGPFASAEAACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTKGGHNMFCATPPSAAKYIAEKNGCRCKAKDMEAMGKTTCKSI
Ga0314712_1051052923300032747SeawaterMTTVALVLMCSIGAHASSLRFANTTVDAAQTATSMTLAAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCSPIS
Ga0314712_1060486313300032747SeawaterSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314713_1045327013300032748SeawaterCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314708_1038982513300032750SeawaterCSFQHLCNTDNVGKATDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314694_1042682813300032751SeawaterGTTLKLLKTVRQRRRRTFAALSAMAFTKTLIFLACCATTQAISLRATNSTDVQVASMHLSAMTDMRVELGPFGSAAEACDYCFGSFTKQGDKPAGPVAPFCVCMAYPEAGGHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0314700_1064708813300032752SeawaterMTTLSMVLMWSFGAHASNLRFANASVGLKFVDAVQTASSMELSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314700_1072585313300032752SeawaterMVSTKALIVLACSVTAQATNLRTEPAALLTNSSTQFESMHLMAKADMRVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKNGCRCKEKDMEAMGKTTCAPISA
Ga0314709_1061963723300032755SeawaterFRSFQHLCNTDNVGKTTDTMNTIACVLMCVVGAHASNLRFENSTSTAVQTGTSMSLSAKTDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPLCVCMSYPAGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKAI
Ga0314709_1079596013300032755SeawaterFGSSSSLSDLLHSSHDLSIPPKLNVVLTMAKFAAAIFALAATSADAIAVRTTNSTAATESMHLSSRQFMEVNLGPFNSAAEACDYCFSSFTKEGQSPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAEYIQKKKGCRCKAKDMEAMGKTTCSPI
Ga0314709_1083567713300032755SeawaterSSRSPTAKLLVTRHRSTDSFVHMAPKVAALFLLACASSVEGALLRTSNSTQVAHGASMNLASKQFMEVNLGPFNSAAEACDYCFSSFTKTGQPPAGPVAPFCVCMAYPEGGKHNMFCATPPSAAEYIQKKKGCRCKAKDMEAMGKTTCSPI
Ga0307390_1065027113300033572MarineMSSTTNMLAPLFLCASGAQAAILRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPSGSSYNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCSPISL
Ga0307390_1065701323300033572MarineMALIFLTCAFGAQAASLRNAPVAPLTNSSNEIMHLASKANMQVDLGPFTDAAAACDYCFGSFTKDGEKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGQTTCSPI
Ga0307390_1066849713300033572MarineMASTMALIFLACSVGAQASVLRTAPAAPLTNSSSKSEKSEVMHLAMKQRMQVDLGPFADAEEACNYCFESFTKDGTAPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEALGKTTCSPI
Ga0307390_1081373413300033572MarineMASVAALLFLCVSSAQASNLRLTNSTSSVVQHESMHLAAKADMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGKTTCTPI
Ga0307390_1085311513300033572MarineRSKFLERSELQTMASSNTMLALLFLCASSAQAANLRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKQGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIADKKGCRCKAKDMEALGKTTCSPISA
Ga0307390_1086408613300033572MarineMAPSTTMALVLLLCASGAQAAVLRQANSTSAVVQHESMNFAAKTNMTLDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTSGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307390_1091321413300033572MarineFWLKTWKQFYSLTSQTTKSAHRSLLLQEMASSMNVAVLFLLCASGAQAAILRGANSTSSMVQHESMKLKAKTDMTVDLGPFDTAAAACDYCFGSFTKGSENHYAALHCDGEPPAGPVAPFCVCMAYPSGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGQTTCKPI
Ga0307390_1094977013300033572MarineMAMKVAALLMVACIFSADAASLRAPATPLTNSSMNLASRQYMEVDLGPFASAADACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTTGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEAMGKTTCSPI
Ga0307390_1095134213300033572MarineLAQAKSLLTAATSQQPSDNVVSHLPHCSGKMAPKIAASALLMVAFSFTAEAANLRSAPLTHLTNSSAQGESMNLVGRQFMEVDLGPFSSAAESCDYCFGSFTKQGDKPAGPVAPFCVCMAYPDGGKHNMFCATPPSAAGYIAEKNGCRCKAKDMEAMGQTTCTPI
Ga0307390_1101065713300033572MarineQRSARVERSYRQQMASFTNVAVLFLVCASGAQAAILRGSNSTSSVVQHESMHLKATTDMTVDLGPFDTAAAACDYCFGSFTKDGEAPAGPVAPFCVCMAYPEGGKHNMFCATPPSEAG
Ga0307390_1101994313300033572MarineMSTVALVLMCSVSAQASFLRFANTTEVQASSMHLSAKTDMTVDLGPFADAAAACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTAGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGQTTCKAI
Ga0307390_1103899413300033572MarineMASTTALIFLACAFGAQAAYLRNAPAAPLTNSSNGVMHLAYKANMQVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTSGGHNMFCATPPSAAAYIAEKKGCRCKAKDMEALGKTTCSPI
Ga0307390_1105158513300033572MarineMASTTAALVLMCAFTAQASFLRFENTTSNAVTTGTSMSLSAKQDMTVDLGPFASAAEACDYCFGSFTKTGQPPAGPVAPFCVCMSYPDAGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI
Ga0307390_1106941313300033572MarineLKFVATFSPQITKVEQRTLEVMTMTTVALVLMGAFSAQATNLRFANTTNNEVQTSSMHLSAKADMTVDLGPFADAAAACDYCFGSFTKTGDKPAGPVAPFCVCMAYPTSGGHNMFCATPPSAAKYIADKKGCRCKAKDMEAMGKTTCSPI
Ga0307390_1107174713300033572MarineFGSSSFFDASKGNVVRLTFLRTMASTMALIFVACAFSAEAASLRNAPVVPLTSSSNEVMHLAYKANMTVDLGPFQDAAAACDYCFGSFTKDGEKPAGPVAPYCVCMAYPTTGGHNMFCATPPSAAAYIAEKNGCRCKAKDMEAMGKTTCSPI
Ga0307390_1107599713300033572MarineMLALLFLCASGAQAANLRLANSTSSVVQHETMHLAAKTNMTVDLGPFATAADACDYCFGSFTKEGDKPAGPVAPFCVCMAYPTGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCTPI
Ga0307390_1108987113300033572MarineMATLALVLMCSFGAHASNLRFANASVDLKFVDAVQTATSMDLSAKTDMTVDLGPFASAAEACDYCFGSFTKKGDNPAGPVAPFCVCMSYPEGGKHNMFCATPPSAAGYIAEKKGCRCKAKDMEAMGKTTCKPI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.