Basic Information | |
---|---|
Family ID | F002995 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 514 |
Average Sequence Length | 42 residues |
Representative Sequence | GSTEAGARKLYAMMDRIQKARGKTVGKGKVAKNSRSEKYLPA |
Number of Associated Samples | 266 |
Number of Associated Scaffolds | 514 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.41 % |
% of genes near scaffold ends (potentially truncated) | 92.80 % |
% of genes from short scaffolds (< 2000 bps) | 82.49 % |
Associated GOLD sequencing projects | 239 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.62 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (56.809 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (34.241 % of family members) |
Environment Ontology (ENVO) | Unclassified (73.930 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.292 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.29% β-sheet: 0.00% Coil/Unstructured: 65.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 514 Family Scaffolds |
---|---|---|
PF00583 | Acetyltransf_1 | 7.98 |
PF13673 | Acetyltransf_10 | 0.97 |
PF01464 | SLT | 0.78 |
PF08241 | Methyltransf_11 | 0.39 |
PF05838 | Glyco_hydro_108 | 0.39 |
PF05488 | PAAR_motif | 0.19 |
PF00271 | Helicase_C | 0.19 |
PF13508 | Acetyltransf_7 | 0.19 |
COG ID | Name | Functional Category | % Frequency in 514 Family Scaffolds |
---|---|---|---|
COG3926 | Lysozyme family protein | General function prediction only [R] | 0.39 |
COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.19 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.90 % |
Unclassified | root | N/A | 25.10 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000176|TB03JUN2009E_c013472 | Not Available | 1379 | Open in IMG/M |
3300000405|LV_Brine_h2_0102DRAFT_1045920 | Not Available | 755 | Open in IMG/M |
3300001239|Draft_10095996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300001282|B570J14230_10013041 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3135 | Open in IMG/M |
3300001842|RCM30_1013121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2696 | Open in IMG/M |
3300001850|RCM37_1198425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300001851|RCM31_10295120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 560 | Open in IMG/M |
3300001851|RCM31_10430383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300002091|JGI24028J26656_1023696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300002092|JGI24218J26658_1008029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1911 | Open in IMG/M |
3300002092|JGI24218J26658_1016195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
3300002098|JGI24219J26650_1006316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2311 | Open in IMG/M |
3300002212|metazooDRAFT_1358709 | Not Available | 588 | Open in IMG/M |
3300002307|JGI24890J29729_1016763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1853 | Open in IMG/M |
3300002307|JGI24890J29729_1043260 | Not Available | 867 | Open in IMG/M |
3300002408|B570J29032_109343536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300002470|metazooDRAFT_1351208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300003277|JGI25908J49247_10036830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1347 | Open in IMG/M |
3300003277|JGI25908J49247_10086331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
3300003393|JGI25909J50240_1014574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1871 | Open in IMG/M |
3300003393|JGI25909J50240_1070842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300003393|JGI25909J50240_1124849 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300003394|JGI25907J50239_1009419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2308 | Open in IMG/M |
3300003394|JGI25907J50239_1017623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1614 | Open in IMG/M |
3300003394|JGI25907J50239_1100537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300003796|Ga0007865_1027573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300003809|Ga0007869_1013636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300003813|Ga0007879_1026369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300004240|Ga0007787_10220090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300004240|Ga0007787_10290333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. T6-5 | 808 | Open in IMG/M |
3300004448|Ga0065861_1150103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1096 | Open in IMG/M |
3300004460|Ga0066222_1151000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300004461|Ga0066223_1385927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300004461|Ga0066223_1443113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300004481|Ga0069718_14001055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300004481|Ga0069718_15309084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
3300004685|Ga0065177_1000111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12575 | Open in IMG/M |
3300004686|Ga0065173_1000645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6383 | Open in IMG/M |
3300004686|Ga0065173_1042811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300004691|Ga0065176_1030181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300004771|Ga0007797_1083583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300004774|Ga0007794_10236738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300004779|Ga0062380_10353848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300004806|Ga0007854_10257314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300004807|Ga0007809_10126942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
3300005527|Ga0068876_10055075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2420 | Open in IMG/M |
3300005581|Ga0049081_10003236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6134 | Open in IMG/M |
3300005581|Ga0049081_10052112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1548 | Open in IMG/M |
3300005581|Ga0049081_10181834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
3300005581|Ga0049081_10251034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300005582|Ga0049080_10026204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2035 | Open in IMG/M |
3300005582|Ga0049080_10101820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
3300005582|Ga0049080_10114184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
3300005582|Ga0049080_10136975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 824 | Open in IMG/M |
3300005582|Ga0049080_10265806 | Not Available | 557 | Open in IMG/M |
3300005582|Ga0049080_10270321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300005583|Ga0049085_10164212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300005662|Ga0078894_11619079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300006030|Ga0075470_10209811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300006071|Ga0007876_1026729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
3300006072|Ga0007881_1023395 | Not Available | 1708 | Open in IMG/M |
3300006072|Ga0007881_1117084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
3300006101|Ga0007810_1101553 | Not Available | 551 | Open in IMG/M |
3300006104|Ga0007882_10253245 | Not Available | 580 | Open in IMG/M |
3300006105|Ga0007819_1089733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300006112|Ga0007857_1069697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300006115|Ga0007816_1120576 | Not Available | 570 | Open in IMG/M |
3300006116|Ga0007807_1090487 | Not Available | 566 | Open in IMG/M |
3300006118|Ga0007859_1020919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1441 | Open in IMG/M |
3300006118|Ga0007859_1040850 | Not Available | 979 | Open in IMG/M |
3300006120|Ga0007867_1038180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1064 | Open in IMG/M |
3300006128|Ga0007828_1008597 | Not Available | 2184 | Open in IMG/M |
3300006128|Ga0007828_1070329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300006129|Ga0007834_1087764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300006637|Ga0075461_10151560 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300006802|Ga0070749_10053504 | All Organisms → Viruses → Predicted Viral | 2454 | Open in IMG/M |
3300006802|Ga0070749_10249922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
3300006802|Ga0070749_10311901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
3300006863|Ga0075459_1086671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300007622|Ga0102863_1242677 | Not Available | 529 | Open in IMG/M |
3300007973|Ga0105746_1245241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300007973|Ga0105746_1291848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300008055|Ga0108970_10967908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
3300008055|Ga0108970_11804830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1931 | Open in IMG/M |
3300008110|Ga0114343_1170988 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300008113|Ga0114346_1172379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 897 | Open in IMG/M |
3300008114|Ga0114347_1060627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
3300008114|Ga0114347_1163841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 783 | Open in IMG/M |
3300008120|Ga0114355_1135074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
3300008259|Ga0114841_1209066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 694 | Open in IMG/M |
3300008266|Ga0114363_1068571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2088 | Open in IMG/M |
3300008448|Ga0114876_1028878 | All Organisms → Viruses → Predicted Viral | 2744 | Open in IMG/M |
3300008448|Ga0114876_1249452 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300008450|Ga0114880_1011603 | All Organisms → Viruses → Predicted Viral | 4321 | Open in IMG/M |
3300008450|Ga0114880_1087761 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300008450|Ga0114880_1097790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1140 | Open in IMG/M |
3300008450|Ga0114880_1214702 | Not Available | 632 | Open in IMG/M |
3300009009|Ga0105105_10264816 | Not Available | 916 | Open in IMG/M |
3300009009|Ga0105105_11011574 | Not Available | 517 | Open in IMG/M |
3300009037|Ga0105093_10461960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
3300009068|Ga0114973_10189755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
3300009068|Ga0114973_10200786 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
3300009068|Ga0114973_10697582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300009146|Ga0105091_10564792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300009151|Ga0114962_10216246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1110 | Open in IMG/M |
3300009151|Ga0114962_10295560 | Not Available | 906 | Open in IMG/M |
3300009151|Ga0114962_10505130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 639 | Open in IMG/M |
3300009152|Ga0114980_10056857 | All Organisms → Viruses → Predicted Viral | 2364 | Open in IMG/M |
3300009154|Ga0114963_10019563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4520 | Open in IMG/M |
3300009154|Ga0114963_10229240 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
3300009154|Ga0114963_10256470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300009154|Ga0114963_10533497 | Not Available | 621 | Open in IMG/M |
3300009155|Ga0114968_10129706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1514 | Open in IMG/M |
3300009155|Ga0114968_10511082 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300009155|Ga0114968_10721319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300009159|Ga0114978_10306088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
3300009160|Ga0114981_10233155 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
3300009164|Ga0114975_10513992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300009164|Ga0114975_10560023 | Not Available | 612 | Open in IMG/M |
3300009169|Ga0105097_10674918 | Not Available | 584 | Open in IMG/M |
3300009169|Ga0105097_10802722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300009180|Ga0114979_10716108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300009180|Ga0114979_10754802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 548 | Open in IMG/M |
3300009182|Ga0114959_10227511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
3300009182|Ga0114959_10526687 | Not Available | 569 | Open in IMG/M |
3300009182|Ga0114959_10634366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300009183|Ga0114974_10146554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1479 | Open in IMG/M |
3300009183|Ga0114974_10224868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
3300009183|Ga0114974_10232950 | Not Available | 1109 | Open in IMG/M |
3300009183|Ga0114974_10391706 | Not Available | 797 | Open in IMG/M |
3300009183|Ga0114974_10698545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300009184|Ga0114976_10018977 | All Organisms → Viruses → Predicted Viral | 4209 | Open in IMG/M |
3300009184|Ga0114976_10161173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1252 | Open in IMG/M |
3300009184|Ga0114976_10533099 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300009187|Ga0114972_10020301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4747 | Open in IMG/M |
3300009218|Ga0103848_1012506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
3300009223|Ga0103850_1018115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
3300009502|Ga0114951_10123259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1450 | Open in IMG/M |
3300009502|Ga0114951_10649998 | Not Available | 501 | Open in IMG/M |
3300010157|Ga0114964_10108021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1376 | Open in IMG/M |
3300010158|Ga0114960_10253997 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300010158|Ga0114960_10565306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300010160|Ga0114967_10130457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
3300010160|Ga0114967_10490455 | Not Available | 601 | Open in IMG/M |
3300010316|Ga0136655_1191820 | Not Available | 608 | Open in IMG/M |
3300010334|Ga0136644_10025880 | Not Available | 3926 | Open in IMG/M |
3300010334|Ga0136644_10732175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 535 | Open in IMG/M |
3300010354|Ga0129333_10147662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2158 | Open in IMG/M |
3300010354|Ga0129333_11069444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300010354|Ga0129333_11100737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300010354|Ga0129333_11264018 | Not Available | 611 | Open in IMG/M |
3300010354|Ga0129333_11278069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. T6-5 | 607 | Open in IMG/M |
3300010370|Ga0129336_10325432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300010370|Ga0129336_10364370 | Not Available | 793 | Open in IMG/M |
3300010885|Ga0133913_12520155 | All Organisms → Viruses → Predicted Viral | 1252 | Open in IMG/M |
3300011010|Ga0139557_1027133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
3300011010|Ga0139557_1028214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 999 | Open in IMG/M |
3300011113|Ga0151517_1358 | Not Available | 17665 | Open in IMG/M |
3300011918|Ga0120090_123648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300011984|Ga0119931_1031610 | Not Available | 627 | Open in IMG/M |
3300011984|Ga0119931_1052255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300012017|Ga0153801_1060375 | Not Available | 666 | Open in IMG/M |
3300012663|Ga0157203_1049608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300012665|Ga0157210_1034125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300012666|Ga0157498_1005781 | All Organisms → Viruses → Predicted Viral | 2024 | Open in IMG/M |
3300012666|Ga0157498_1044394 | Not Available | 682 | Open in IMG/M |
3300012709|Ga0157608_1031914 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300013005|Ga0164292_10959712 | Not Available | 535 | Open in IMG/M |
3300013014|Ga0164295_10249433 | Not Available | 1331 | Open in IMG/M |
3300013093|Ga0164296_1005093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11672 | Open in IMG/M |
3300013093|Ga0164296_1257932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300013094|Ga0164297_10432651 | Not Available | 504 | Open in IMG/M |
3300013372|Ga0177922_10052917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300013372|Ga0177922_10466248 | Not Available | 631 | Open in IMG/M |
3300013372|Ga0177922_10608474 | Not Available | 966 | Open in IMG/M |
3300013372|Ga0177922_10751612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300013372|Ga0177922_10902362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300013372|Ga0177922_11264386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
3300015050|Ga0181338_1002333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3335 | Open in IMG/M |
3300015050|Ga0181338_1003375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2786 | Open in IMG/M |
3300015050|Ga0181338_1005932 | All Organisms → Viruses → Predicted Viral | 2063 | Open in IMG/M |
3300015050|Ga0181338_1009031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1655 | Open in IMG/M |
3300015050|Ga0181338_1011981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1411 | Open in IMG/M |
3300015050|Ga0181338_1023352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
3300015050|Ga0181338_1023649 | Not Available | 953 | Open in IMG/M |
3300015050|Ga0181338_1038473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300017700|Ga0181339_1012258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 994 | Open in IMG/M |
3300017700|Ga0181339_1017415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300017707|Ga0181363_1002339 | Not Available | 4349 | Open in IMG/M |
3300017707|Ga0181363_1004481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3078 | Open in IMG/M |
3300017707|Ga0181363_1056893 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300017716|Ga0181350_1010322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2669 | Open in IMG/M |
3300017716|Ga0181350_1010943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2586 | Open in IMG/M |
3300017716|Ga0181350_1011558 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2513 | Open in IMG/M |
3300017716|Ga0181350_1015714 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
3300017716|Ga0181350_1033643 | All Organisms → Viruses → Predicted Viral | 1404 | Open in IMG/M |
3300017716|Ga0181350_1058111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
3300017716|Ga0181350_1140190 | Not Available | 569 | Open in IMG/M |
3300017716|Ga0181350_1147002 | Not Available | 551 | Open in IMG/M |
3300017716|Ga0181350_1153058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300017716|Ga0181350_1164745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → unclassified Burkholderia → Burkholderia sp. Bp8990 | 512 | Open in IMG/M |
3300017716|Ga0181350_1168783 | Not Available | 504 | Open in IMG/M |
3300017716|Ga0181350_1171133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae | 500 | Open in IMG/M |
3300017722|Ga0181347_1025010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1874 | Open in IMG/M |
3300017722|Ga0181347_1045833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
3300017722|Ga0181347_1070248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
3300017722|Ga0181347_1070292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
3300017722|Ga0181347_1085956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. T6-5 | 911 | Open in IMG/M |
3300017722|Ga0181347_1149035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
3300017722|Ga0181347_1155913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300017723|Ga0181362_1030559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1146 | Open in IMG/M |
3300017736|Ga0181365_1114025 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300017736|Ga0181365_1128560 | Not Available | 606 | Open in IMG/M |
3300017736|Ga0181365_1159437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300017736|Ga0181365_1171046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300017747|Ga0181352_1016865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2294 | Open in IMG/M |
3300017747|Ga0181352_1033242 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1550 | Open in IMG/M |
3300017747|Ga0181352_1042015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1350 | Open in IMG/M |
3300017747|Ga0181352_1046677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1269 | Open in IMG/M |
3300017747|Ga0181352_1060498 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
3300017747|Ga0181352_1120652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300017747|Ga0181352_1200049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 514 | Open in IMG/M |
3300017754|Ga0181344_1004682 | All Organisms → Viruses → Predicted Viral | 4642 | Open in IMG/M |
3300017754|Ga0181344_1016768 | All Organisms → Viruses → Predicted Viral | 2295 | Open in IMG/M |
3300017754|Ga0181344_1028266 | All Organisms → Viruses → Predicted Viral | 1720 | Open in IMG/M |
3300017754|Ga0181344_1111942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300017754|Ga0181344_1126829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
3300017754|Ga0181344_1131255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300017754|Ga0181344_1157404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300017754|Ga0181344_1222827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
3300017754|Ga0181344_1242218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300017761|Ga0181356_1107857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300017761|Ga0181356_1192893 | Not Available | 607 | Open in IMG/M |
3300017761|Ga0181356_1209645 | Not Available | 572 | Open in IMG/M |
3300017766|Ga0181343_1076227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300017766|Ga0181343_1172712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
3300017774|Ga0181358_1009793 | All Organisms → Viruses → Predicted Viral | 3956 | Open in IMG/M |
3300017774|Ga0181358_1193874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300017777|Ga0181357_1007969 | All Organisms → Viruses → Predicted Viral | 4242 | Open in IMG/M |
3300017777|Ga0181357_1015911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2991 | Open in IMG/M |
3300017777|Ga0181357_1087336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1191 | Open in IMG/M |
3300017777|Ga0181357_1149898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300017777|Ga0181357_1178977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300017777|Ga0181357_1219952 | Not Available | 670 | Open in IMG/M |
3300017777|Ga0181357_1259454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
3300017777|Ga0181357_1280388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300017777|Ga0181357_1283506 | Not Available | 567 | Open in IMG/M |
3300017777|Ga0181357_1295886 | Not Available | 551 | Open in IMG/M |
3300017777|Ga0181357_1300239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
3300017777|Ga0181357_1308224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300017778|Ga0181349_1063041 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
3300017778|Ga0181349_1161865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
3300017778|Ga0181349_1261659 | Not Available | 573 | Open in IMG/M |
3300017778|Ga0181349_1278510 | Not Available | 548 | Open in IMG/M |
3300017780|Ga0181346_1017130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3056 | Open in IMG/M |
3300017780|Ga0181346_1025867 | All Organisms → Viruses → Predicted Viral | 2451 | Open in IMG/M |
3300017780|Ga0181346_1042696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1853 | Open in IMG/M |
3300017780|Ga0181346_1092414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1181 | Open in IMG/M |
3300017784|Ga0181348_1029467 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
3300017784|Ga0181348_1075862 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1339 | Open in IMG/M |
3300017784|Ga0181348_1076680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1331 | Open in IMG/M |
3300017784|Ga0181348_1129383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
3300017784|Ga0181348_1179289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300017784|Ga0181348_1211981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300017784|Ga0181348_1255266 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300017784|Ga0181348_1272701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300017784|Ga0181348_1285805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300017784|Ga0181348_1313269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300017785|Ga0181355_1073975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
3300017785|Ga0181355_1099757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1202 | Open in IMG/M |
3300017785|Ga0181355_1103497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1176 | Open in IMG/M |
3300017785|Ga0181355_1130409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300017785|Ga0181355_1131999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1016 | Open in IMG/M |
3300017785|Ga0181355_1258178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300017785|Ga0181355_1285943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 623 | Open in IMG/M |
3300017785|Ga0181355_1309044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300017785|Ga0181355_1330430 | Not Available | 565 | Open in IMG/M |
3300018416|Ga0181553_10124506 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
3300019781|Ga0181360_102643 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
3300019783|Ga0181361_106749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 882 | Open in IMG/M |
3300019783|Ga0181361_109624 | Not Available | 751 | Open in IMG/M |
3300019783|Ga0181361_118675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300019784|Ga0181359_1001027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7066 | Open in IMG/M |
3300019784|Ga0181359_1019308 | Not Available | 2566 | Open in IMG/M |
3300019784|Ga0181359_1019668 | All Organisms → Viruses → Predicted Viral | 2546 | Open in IMG/M |
3300019784|Ga0181359_1068380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1349 | Open in IMG/M |
3300019784|Ga0181359_1082088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1206 | Open in IMG/M |
3300019784|Ga0181359_1134246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300019784|Ga0181359_1183656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300019784|Ga0181359_1211001 | Not Available | 618 | Open in IMG/M |
3300019784|Ga0181359_1261426 | Not Available | 519 | Open in IMG/M |
3300019784|Ga0181359_1261468 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300019784|Ga0181359_1267986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300020151|Ga0211736_10401188 | Not Available | 598 | Open in IMG/M |
3300020151|Ga0211736_10931596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300020159|Ga0211734_10249803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae | 1002 | Open in IMG/M |
3300020196|Ga0194124_10245957 | Not Available | 892 | Open in IMG/M |
3300020229|Ga0194042_1188688 | Not Available | 559 | Open in IMG/M |
3300020533|Ga0208364_1036736 | Not Available | 655 | Open in IMG/M |
3300020549|Ga0207942_1021369 | Not Available | 826 | Open in IMG/M |
3300020551|Ga0208360_1037272 | Not Available | 623 | Open in IMG/M |
3300021124|Ga0214199_1029843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300021131|Ga0214206_1031557 | Not Available | 609 | Open in IMG/M |
3300021134|Ga0214171_1024943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
3300021139|Ga0214166_1040704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1052 | Open in IMG/M |
3300021960|Ga0222715_10092575 | Not Available | 1969 | Open in IMG/M |
3300021961|Ga0222714_10351983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300021962|Ga0222713_10716058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300021963|Ga0222712_10063364 | Not Available | 2701 | Open in IMG/M |
3300021963|Ga0222712_10678192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300022072|Ga0196889_1051879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 794 | Open in IMG/M |
3300022173|Ga0181337_1004698 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
3300022179|Ga0181353_1027193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1515 | Open in IMG/M |
3300022179|Ga0181353_1068478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
3300022179|Ga0181353_1073892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
3300022179|Ga0181353_1102647 | Not Available | 702 | Open in IMG/M |
3300022179|Ga0181353_1113017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300022179|Ga0181353_1146145 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300022179|Ga0181353_1164815 | Not Available | 502 | Open in IMG/M |
3300022190|Ga0181354_1027362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1848 | Open in IMG/M |
3300022190|Ga0181354_1027580 | All Organisms → Viruses → Predicted Viral | 1841 | Open in IMG/M |
3300022190|Ga0181354_1097090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
3300022190|Ga0181354_1114565 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300022190|Ga0181354_1145940 | Not Available | 744 | Open in IMG/M |
3300022190|Ga0181354_1207293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300022190|Ga0181354_1210980 | Not Available | 573 | Open in IMG/M |
3300022190|Ga0181354_1236438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300022190|Ga0181354_1253909 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300022407|Ga0181351_1002240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6664 | Open in IMG/M |
3300022407|Ga0181351_1005172 | All Organisms → Viruses → Predicted Viral | 4948 | Open in IMG/M |
3300022407|Ga0181351_1039821 | All Organisms → Viruses → Predicted Viral | 1986 | Open in IMG/M |
3300022407|Ga0181351_1044181 | All Organisms → Viruses → Predicted Viral | 1875 | Open in IMG/M |
3300022407|Ga0181351_1045400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1846 | Open in IMG/M |
3300022407|Ga0181351_1083811 | All Organisms → Viruses → Predicted Viral | 1265 | Open in IMG/M |
3300022407|Ga0181351_1087092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1232 | Open in IMG/M |
3300022407|Ga0181351_1091131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
3300022407|Ga0181351_1218304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300022407|Ga0181351_1236917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300022602|Ga0248169_106329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11154 | Open in IMG/M |
3300022925|Ga0255773_10196965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
3300022929|Ga0255752_10227543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300023179|Ga0214923_10384510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300023311|Ga0256681_10724392 | Not Available | 564 | Open in IMG/M |
3300024276|Ga0255205_1044506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 668 | Open in IMG/M |
3300024289|Ga0255147_1076514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300024306|Ga0255148_1052984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300024354|Ga0255171_1056793 | Not Available | 728 | Open in IMG/M |
3300024496|Ga0255151_1047766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300024556|Ga0256341_1053524 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300025358|Ga0208504_1021004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300025358|Ga0208504_1022132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300025382|Ga0208256_1017716 | Not Available | 1080 | Open in IMG/M |
3300025389|Ga0208257_1021872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
3300025389|Ga0208257_1045656 | Not Available | 622 | Open in IMG/M |
3300025401|Ga0207955_1002721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-2 | 4255 | Open in IMG/M |
3300025416|Ga0208877_1058379 | Not Available | 615 | Open in IMG/M |
3300025420|Ga0208111_1028324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 949 | Open in IMG/M |
3300025421|Ga0207958_1042602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300025429|Ga0208500_1008446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1627 | Open in IMG/M |
3300025437|Ga0208742_1017834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
3300025455|Ga0208376_1050526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300025466|Ga0208497_1006166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3485 | Open in IMG/M |
3300025466|Ga0208497_1072528 | Not Available | 656 | Open in IMG/M |
3300025598|Ga0208379_1002332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6866 | Open in IMG/M |
3300025598|Ga0208379_1147864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300025616|Ga0208613_1121448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300025783|Ga0208258_1032402 | Not Available | 757 | Open in IMG/M |
3300025838|Ga0208872_1208809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300025889|Ga0208644_1049003 | All Organisms → Viruses → Predicted Viral | 2358 | Open in IMG/M |
3300025889|Ga0208644_1073721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1777 | Open in IMG/M |
3300025889|Ga0208644_1299336 | Not Available | 640 | Open in IMG/M |
3300027128|Ga0255099_1012960 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
3300027467|Ga0255154_1007400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2623 | Open in IMG/M |
3300027487|Ga0255091_1066332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300027563|Ga0209552_1130279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300027608|Ga0208974_1127990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300027659|Ga0208975_1083857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 940 | Open in IMG/M |
3300027659|Ga0208975_1107775 | Not Available | 804 | Open in IMG/M |
3300027693|Ga0209704_1073147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 956 | Open in IMG/M |
3300027707|Ga0209443_1018141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3185 | Open in IMG/M |
3300027708|Ga0209188_1183066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
3300027712|Ga0209499_1337297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300027721|Ga0209492_1228004 | Not Available | 634 | Open in IMG/M |
3300027732|Ga0209442_1189970 | Not Available | 767 | Open in IMG/M |
3300027733|Ga0209297_1248656 | Not Available | 683 | Open in IMG/M |
3300027734|Ga0209087_1168012 | Not Available | 867 | Open in IMG/M |
3300027736|Ga0209190_1230229 | Not Available | 745 | Open in IMG/M |
3300027741|Ga0209085_1229605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300027741|Ga0209085_1387238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300027747|Ga0209189_1051904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1981 | Open in IMG/M |
3300027749|Ga0209084_1039522 | All Organisms → Viruses → Predicted Viral | 2349 | Open in IMG/M |
3300027756|Ga0209444_10316137 | Not Available | 517 | Open in IMG/M |
3300027756|Ga0209444_10319642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300027763|Ga0209088_10032826 | All Organisms → Viruses → Predicted Viral | 2608 | Open in IMG/M |
3300027777|Ga0209829_10031234 | All Organisms → Viruses → Predicted Viral | 2998 | Open in IMG/M |
3300027777|Ga0209829_10346013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300027782|Ga0209500_10169611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1010 | Open in IMG/M |
3300027782|Ga0209500_10221689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300027782|Ga0209500_10416087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300027785|Ga0209246_10273573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300027785|Ga0209246_10317024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300027785|Ga0209246_10370391 | Not Available | 542 | Open in IMG/M |
3300027797|Ga0209107_10372885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300027798|Ga0209353_10005920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6179 | Open in IMG/M |
3300027798|Ga0209353_10158577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
3300027805|Ga0209229_10065008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1633 | Open in IMG/M |
3300027808|Ga0209354_10050134 | All Organisms → Viruses → Predicted Viral | 1682 | Open in IMG/M |
3300027808|Ga0209354_10201596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
3300027808|Ga0209354_10244160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300027808|Ga0209354_10314148 | Not Available | 621 | Open in IMG/M |
3300027816|Ga0209990_10006905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7441 | Open in IMG/M |
3300027816|Ga0209990_10159679 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
3300027816|Ga0209990_10480698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300027892|Ga0209550_10496925 | Not Available | 733 | Open in IMG/M |
3300027892|Ga0209550_10793675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300027893|Ga0209636_10200350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1834 | Open in IMG/M |
3300027896|Ga0209777_10594109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 802 | Open in IMG/M |
3300027956|Ga0209820_1077631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300027971|Ga0209401_1106887 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
3300027976|Ga0209702_10266920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
(restricted) 3300028044|Ga0247838_1105190 | Not Available | 1173 | Open in IMG/M |
3300028275|Ga0255174_1048785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300028394|Ga0304730_1272488 | Not Available | 598 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1084235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1521 | Open in IMG/M |
3300031236|Ga0302324_102459098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
3300031539|Ga0307380_11293482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
3300031566|Ga0307378_10585566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
3300031566|Ga0307378_11271610 | Not Available | 577 | Open in IMG/M |
3300031673|Ga0307377_10675289 | Not Available | 729 | Open in IMG/M |
3300031707|Ga0315291_10552982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
3300031707|Ga0315291_11344656 | Not Available | 573 | Open in IMG/M |
3300031746|Ga0315293_10868527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300031758|Ga0315907_10982917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
3300031772|Ga0315288_10060846 | All Organisms → Viruses → Predicted Viral | 4455 | Open in IMG/M |
3300031772|Ga0315288_11135827 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300031787|Ga0315900_10628569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 778 | Open in IMG/M |
3300031857|Ga0315909_10379163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1022 | Open in IMG/M |
3300031857|Ga0315909_10770190 | Not Available | 613 | Open in IMG/M |
3300031857|Ga0315909_10922510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300031885|Ga0315285_10395048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 991 | Open in IMG/M |
3300031999|Ga0315274_10570817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1258 | Open in IMG/M |
3300031999|Ga0315274_10887867 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300031999|Ga0315274_10914081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
3300031999|Ga0315274_12106443 | Not Available | 502 | Open in IMG/M |
3300032050|Ga0315906_11019041 | Not Available | 621 | Open in IMG/M |
3300032093|Ga0315902_11236251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300032116|Ga0315903_10169538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1979 | Open in IMG/M |
3300032118|Ga0315277_10258790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1855 | Open in IMG/M |
3300032118|Ga0315277_11683377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 533 | Open in IMG/M |
3300032173|Ga0315268_10572960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
3300032256|Ga0315271_10241073 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
3300032516|Ga0315273_11937256 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300032605|Ga0316232_1263730 | Not Available | 660 | Open in IMG/M |
3300032675|Ga0316225_1063604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1326 | Open in IMG/M |
3300032676|Ga0316229_1127161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
3300033521|Ga0316616_100657954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1244 | Open in IMG/M |
3300033981|Ga0334982_0117187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1387 | Open in IMG/M |
3300033981|Ga0334982_0454571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300033993|Ga0334994_0098029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1727 | Open in IMG/M |
3300033996|Ga0334979_0379034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
3300033996|Ga0334979_0545629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300033996|Ga0334979_0587734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300034012|Ga0334986_0197952 | Not Available | 1125 | Open in IMG/M |
3300034019|Ga0334998_0551853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. T6-5 | 635 | Open in IMG/M |
3300034019|Ga0334998_0590822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300034020|Ga0335002_0685363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
3300034061|Ga0334987_0236508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
3300034082|Ga0335020_0151010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
3300034093|Ga0335012_0486607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300034093|Ga0335012_0500736 | Not Available | 576 | Open in IMG/M |
3300034093|Ga0335012_0584537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300034102|Ga0335029_0173925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1454 | Open in IMG/M |
3300034102|Ga0335029_0484047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
3300034104|Ga0335031_0160029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1551 | Open in IMG/M |
3300034104|Ga0335031_0368850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 912 | Open in IMG/M |
3300034106|Ga0335036_0754529 | Not Available | 569 | Open in IMG/M |
3300034112|Ga0335066_0334881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
3300034118|Ga0335053_0491559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300034120|Ga0335056_0101799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1767 | Open in IMG/M |
3300034120|Ga0335056_0319850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300034122|Ga0335060_0225040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1056 | Open in IMG/M |
3300034283|Ga0335007_0492443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300034283|Ga0335007_0802769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300034374|Ga0348335_054575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1513 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 34.24% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 9.53% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.39% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.89% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.92% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.14% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.95% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.95% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.56% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.56% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.36% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 1.17% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.75% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.97% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.97% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.78% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.78% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.78% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.58% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.58% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.58% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.39% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.39% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.39% |
Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.39% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.39% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.39% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.39% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.39% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.19% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.19% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.19% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.19% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.19% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.19% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.19% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.19% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.19% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.19% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.19% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.19% |
Mine Pit Pond | Environmental → Terrestrial → Geologic → Mine → Unclassified → Mine Pit Pond | 0.19% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.19% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
3300001239 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002470 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - FEB 2013 | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003796 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 | Environmental | Open in IMG/M |
3300003809 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 | Environmental | Open in IMG/M |
3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004685 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2) | Environmental | Open in IMG/M |
3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
3300004691 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (version 2) | Environmental | Open in IMG/M |
3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
3300006112 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 | Environmental | Open in IMG/M |
3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
3300006116 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 | Environmental | Open in IMG/M |
3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
3300006129 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Nov07 | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
3300009223 | Microbial communities of water from Amazon river, Brazil - RCM3 | Environmental | Open in IMG/M |
3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300011918 | Mine pit pond microbial communities from Vermont, USA - 2S | Environmental | Open in IMG/M |
3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020229 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-12m | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
3300021131 | Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion | Environmental | Open in IMG/M |
3300021134 | Freshwater microbial communities from Trout Bog Lake, WI - 02JUL2007 epilimnion | Environmental | Open in IMG/M |
3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
3300022173 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023251 | Saline water microbial communities from Ace Lake, Antarctica - #1073 | Environmental | Open in IMG/M |
3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
3300024276 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8d | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
3300024556 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025358 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025401 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025416 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025420 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025421 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025429 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes) | Environmental | Open in IMG/M |
3300025437 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH28Sep08 (SPAdes) | Environmental | Open in IMG/M |
3300025455 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M (SPAdes) | Environmental | Open in IMG/M |
3300025466 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
3300025783 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025785 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE12Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025838 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027128 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d | Environmental | Open in IMG/M |
3300027467 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h | Environmental | Open in IMG/M |
3300027487 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027594 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
3300028275 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8d | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB03JUN2009E_0134722 | 3300000176 | Freshwater | GARKLYQMMDRIQKNRAHSVGNNKVAVNSHSEKFLPA* |
LV_Brine_h2_0102DRAFT_10459203 | 3300000405 | Hypersaline | ELYKMMDRIQQNRSKTVGKDKVAVDAKSRKLLPA* |
Draft_100959961 | 3300001239 | Hydrocarbon Resource Environments | RIVSEIGNGSTDAGARKLYQMMNRVQKRRGKTVGKGKVAVDSKAYKEVDKL* |
B570J14230_100130413 | 3300001282 | Freshwater | KLYAMMDRVQRARAKTTGKGRVAKNTRADKHLPA* |
RCM30_10131213 | 3300001842 | Marine Plankton | AGARKLYAMMDRIQASRKKSIGKGRVAVDNRADKYLPK* |
RCM37_11984253 | 3300001850 | Marine Plankton | GSTDAGARKLYEMMDKVQASRRKSIGKGKFAVNSKAAKHLPK* |
RCM31_102951202 | 3300001851 | Marine Plankton | ELGNGSTEAGARQLYKMLDRVQQARGKTTGKHKVAKNTNAAKYLPA* |
RCM31_104303832 | 3300001851 | Marine Plankton | GNGSTEAGARKLYAMMDRIQSARSKTVGKGKVAKNTRADKYLPA* |
JGI24028J26656_10236962 | 3300002091 | Lentic | LGNGSTEAGARQLYKMMDRIQHARRKTVGKEAVATNTKANQYLPA* |
JGI24218J26658_10080293 | 3300002092 | Lentic | PARIVSELGNGSTEAGARKLYQMMDRVQNARKKTVGKHQVAANPRAEKYLPA* |
JGI24218J26658_10161952 | 3300002092 | Lentic | RIVSELGNGSTEAGARQLYKMMDRIQHARRKTVGKEAVATNTKANQYLPA* |
JGI24219J26650_10063161 | 3300002098 | Lentic | STEAGARKLYQMMDRVQQARGKTTGKDRVATNSRSDKYLPA* |
metazooDRAFT_13587092 | 3300002212 | Lake | KLYAMMNRIQSARKKSVGKGRVAANTKAEKYLPA* |
JGI24890J29729_10167633 | 3300002307 | Lentic | PARIVSELGNGSTEAGARQLYKMMDRIQHARRKTVGKEAVATNTKANQYLPA* |
JGI24890J29729_10432603 | 3300002307 | Lentic | CKNCSELGNGSTDAGAKRLYAMMERVQAKRKKSMGKGKFAVNSKAEKDLPA* |
B570J29032_1087959062 | 3300002408 | Freshwater | ELGQGSSEAGAKILQDMVNRVQARRKKSIGKGKVAVDSKARKELPA* |
B570J29032_1093435363 | 3300002408 | Freshwater | GARKLYAMLARIQAGRKKSVGRGKVAVNSRMDKHLPA* |
metazooDRAFT_13512082 | 3300002470 | Lake | DAGARRLYDMMDRVQRRRGTTVGKGKVAKNTKAYQELPA* |
JGI25908J49247_100368301 | 3300003277 | Freshwater Lake | VIPARIVSELGNGSTDAGARELYKMMARIQAGRAKTVGKNKTAVNSKSARHLPA* |
JGI25908J49247_100863313 | 3300003277 | Freshwater Lake | LGNGSTEAGARKLYAMMDRIQKARGKTVGKGKVAKNSRSEKYLPA* |
JGI25909J50240_10145743 | 3300003393 | Freshwater Lake | STEAGARKLYAMMDRVQKARGKTVGKGKVAANSRSAKYLPA* |
JGI25909J50240_10708421 | 3300003393 | Freshwater Lake | EAGARKLYAMMDRIQKARKKTVGKGKVAKNSRSEKYLPA* |
JGI25909J50240_11248492 | 3300003393 | Freshwater Lake | FVIPARIVSELGXGSTDAGARALYKMMDRIQAGRRKTVGKNQVAKNSKAVRHLPA* |
JGI25907J50239_10094194 | 3300003394 | Freshwater Lake | IVSELGNGSTEAGARALYKMMDRIQANRRKTTGKNRVAVNSKSHKYLPA* |
JGI25907J50239_10176231 | 3300003394 | Freshwater Lake | TEAGARKLYAMMDRVQKARGKTVGKGKVAANSRSAKYLPA* |
JGI25907J50239_11005372 | 3300003394 | Freshwater Lake | GSTEAGARKLYAMMDRIQKARGKTVGKGKVAANSRSAKYLPA* |
Ga0007865_10275731 | 3300003796 | Freshwater | VSELGNGSTEAGARQLYKMMDRIQQARRKTTGKDAVATNTNASKYLPA* |
Ga0007869_10136363 | 3300003809 | Freshwater | SEIGQGSTEAGARELYKMMDRVQSARKKTVGKSKFAKNSHAEKELIA* |
Ga0007879_10263692 | 3300003813 | Freshwater | GSTEAGARQLYKMMDRIQKARSKTVGKDRVAANTNAHQYLPA* |
Ga0031655_103460761 | 3300003852 | Freshwater Lake Sediment | STDAGAKQLYAMMERVQNGRKKSVGKDKIAVDSKAYKYLPA* |
Ga0031658_10761541 | 3300003860 | Freshwater Lake Sediment | FVFPARIVSEIGNGSTEAGARKLYAVMDKIQKDRGRSLKNVALDSNADRHLQALA* |
Ga0007787_102200901 | 3300004240 | Freshwater Lake | ELGNGSTEAGARKLYAMMDRIQKARGKTVGKGKVAKNSRSDKYLPA* |
Ga0007787_102903333 | 3300004240 | Freshwater Lake | ELGNGSTEAGARKLYAMMDRIQKARGKTVGKGKVAKNSRSEKYLPA* |
Ga0065861_11501033 | 3300004448 | Marine | GSTEAGARKLYAMMDRIQAARSKTVGKGKVAKNTRADKYLPA* |
Ga0066222_11510002 | 3300004460 | Marine | SELGNGSTEAGARQLYKMMDRIQSARKKTTGKNQVAANPRAEQYLPA* |
Ga0066223_13859271 | 3300004461 | Marine | PARIVSELGNGSTEAGARALYKMMDRIQANRRKTTGKNSVAVDSKSRKYLPA* |
Ga0066223_14431131 | 3300004461 | Marine | SELGNGSTEAGARKLYQMMDRIQSARSKTTGKNKVATNSRAEKYLPA* |
Ga0069718_138990771 | 3300004481 | Sediment | IVSELGNGSTEAGARALQAMVDRVQTRRKKSIGKGKVAVDSKARKGLPA* |
Ga0069718_140010551 | 3300004481 | Sediment | EAGARKLYAMMDRVQRTRGKTTGKNKVAKNTRADKYLPA* |
Ga0069718_153090843 | 3300004481 | Sediment | IVSELGNGSTEAGARKLYEMMARIQKARSKTVGKDRVAVNSRADKNLPA* |
Ga0065177_10001115 | 3300004685 | Freshwater | NGSTEAGARQLYKMMDRIQKARSKTVGKNAVATNTNAHQYLPA* |
Ga0065173_10006451 | 3300004686 | Freshwater | VVPARIVSELGNGSTEAGARQLYKMMDRIQKARSKTVGKNAVATNTNAHQYLPA* |
Ga0065173_10428111 | 3300004686 | Freshwater | STEAGARQLYKMMDRIQKARQKTVGKDRVATNTNAHKYLPA* |
Ga0065176_10301812 | 3300004691 | Freshwater | ELGNGSTDAGARKLYAMMDRVQAARGGTVGKGRVAKNTRADRYLPA* |
Ga0007797_10835831 | 3300004771 | Freshwater | VSELGNGSTEAGARRLYQMMDRVQSARKKSIGKDRVATDSRASKYLPA* |
Ga0007794_102367381 | 3300004774 | Freshwater | ELGNGSTEAGARKLYAMMDRVQSARKQTVGKNKIAHNSRADKYLPA* |
Ga0062380_103538482 | 3300004779 | Wetland Sediment | PARIVSELGNGSTDAGAKRLYAMMNRIQQNRGKTVGKGKVAVNSRSDKYLPA* |
Ga0007854_102573142 | 3300004806 | Freshwater | NGSTEAGARQLYKMMDRIQNARRKTTGKDAVATNTNAAKYLPV* |
Ga0007809_101269421 | 3300004807 | Freshwater | EAGARKLYAMMDRIQKARSKTVGKGRVAVNNKADKYLPA* |
Ga0068876_100550751 | 3300005527 | Freshwater Lake | GSTDAGAKKLYAMMDRVQRARRKTTGKNKVAANSRADKYLPA* |
Ga0049081_100032361 | 3300005581 | Freshwater Lentic | KKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA* |
Ga0049081_100521123 | 3300005581 | Freshwater Lentic | TEAGARKLYAMMDRIQKARGKTVGKGKVAANSRSAKYLPA* |
Ga0049081_101818341 | 3300005581 | Freshwater Lentic | AGARKLYAMMDRIQKARGKTVGKGKVAKNSRSEKYLPA* |
Ga0049081_102510341 | 3300005581 | Freshwater Lentic | TEAGARKLYAMMDRIQKARGKTVGKGKVAKNSRSEKYLPA* |
Ga0049080_100262041 | 3300005582 | Freshwater Lentic | SELGNGSTEAGARKLYAMMDRVQAARRSTVGKGKVAKNSRSDKYLPA* |
Ga0049080_101018203 | 3300005582 | Freshwater Lentic | GNGSTEAGARKLYAMMDRIQKARGKTVGKGKVAKNSRSEKYLPA* |
Ga0049080_101141843 | 3300005582 | Freshwater Lentic | EAGARKLYAMMERIQATRGRTVGKNRVATNSRADRYLPA* |
Ga0049080_101369752 | 3300005582 | Freshwater Lentic | TEAGARALYKMMDRIQANRRKTTGKNSVAVNSKSHKYLPA* |
Ga0049080_102658062 | 3300005582 | Freshwater Lentic | GSTDAGARKLYAMMERIQRARNKTVGRNKVAVRSGADKMLPA* |
Ga0049080_102703212 | 3300005582 | Freshwater Lentic | ELGNGSTEAGARKLYAMMDRIQSARKKTVGKGKVAHNSRAVKYLPA* |
Ga0049085_101642122 | 3300005583 | Freshwater Lentic | SELGNGSTEAGARALYKMMDRIQANRRKTTGKNKVAVNSKSHKYLPA* |
Ga0049082_100780052 | 3300005584 | Freshwater Lentic | AGANKLYAMMDRVQKARRKTKNVAADTKAHKYLPA* |
Ga0078894_116190791 | 3300005662 | Freshwater Lake | EAGARKLYAMMDRIQKARSKTVGKDRVAVNSRAEKNLPA* |
Ga0075470_102098112 | 3300006030 | Aqueous | TEAGARKLYAMMDRIQANRKKTMGRGKQFAKDSKADRYLPA* |
Ga0007876_10267293 | 3300006071 | Freshwater | PARIVSELGNGSTEAGARQLYKMMDRIQNARSKTVGKDRVATNTNANQYLPA* |
Ga0007881_10233951 | 3300006072 | Freshwater | QLYKMMDRIQTARRKTTGKDAVATNTNAHQYLPA* |
Ga0007881_11170841 | 3300006072 | Freshwater | TEAGARKLYAMMDRIQKARSNTVGKGRVAVNNKADKYLPA* |
Ga0007810_11015531 | 3300006101 | Freshwater | GAKRLYAMMERVQSGRKKSVGKDNVAVDSKAYKHLPA* |
Ga0007882_102532452 | 3300006104 | Freshwater | RQLYKMMDRIQTARRKTTGKDAVATNTNAHQYLPA* |
Ga0007819_10897332 | 3300006105 | Freshwater | FVVPARIVSELGNGSTEAGARQLYKMMDRIQTARRKTTGKDAVATNTNAHKYLPA* |
Ga0007857_10696972 | 3300006112 | Freshwater | GARKLYAMMDRIQKARSNTVGKGRVAVNNKADKYLPA* |
Ga0007816_11205761 | 3300006115 | Freshwater | GSSDAGARKLYAMMDRIQNARKKTTKNVAANTRAEKYLPG* |
Ga0007807_10904872 | 3300006116 | Freshwater | GARQLYKMMDRIQNARSKTVGKDRVATNTNANQYLPA* |
Ga0007859_10209191 | 3300006118 | Freshwater | IVSELGNGSTEAGARELYKMMARIQQARAKTTGKDAVAVNTNAHKYLPV* |
Ga0007859_10408502 | 3300006118 | Freshwater | KLYGMLDRIQHARRKTVGIGNVAKNSHADKHLPA* |
Ga0007867_10381802 | 3300006120 | Freshwater | AGARKLYAMMDRIQKARSNTVGKGRVAVNNKADKYLPA* |
Ga0007828_10085971 | 3300006128 | Freshwater | KLYAMMDRVQAARGGTVGKGRVAKNTRADRYLPA* |
Ga0007828_10703291 | 3300006128 | Freshwater | ARIVSELGNGSTEAGARKLYAMLDRIQHARSKTVGKGKVARNSHADKYLPA* |
Ga0007834_10877641 | 3300006129 | Freshwater | EAGARQLYKMMDRIQSARRKTTGRDAVATNTNASKYLPV* |
Ga0075461_101515601 | 3300006637 | Aqueous | IVSEIGNGSTEAGARKLYAMMDRIQSSRQKTIGKGKVAVNSRADRYLPA* |
Ga0070749_100535043 | 3300006802 | Aqueous | KLYAMLDRVQSARKKSIGKGKVANNSRADKYLPA* |
Ga0070749_102499221 | 3300006802 | Aqueous | NGSTEAGARKLYAMMDRVQKARGKTVGKDKAAVNTRADRLLPA* |
Ga0070749_103119013 | 3300006802 | Aqueous | LGNGSTEAGARKLYAMMDRIQKARGKTVGKDRVAVNSRADKNLPA* |
Ga0075459_10866712 | 3300006863 | Aqueous | EAGARKLYGMMDRVQRARGKTVGKGRVAKNTRADKYLPA* |
Ga0102863_12426772 | 3300007622 | Estuarine | KLYAMMDRIQATRKHSVGKGNVAKNTRADKYLPA* |
Ga0105746_12452411 | 3300007973 | Estuary Water | AGARKLYAMMDRIQKARGKTVGKGKVAKNSRAEKYLPA* |
Ga0105746_12918482 | 3300007973 | Estuary Water | GAKKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA* |
Ga0108970_109679083 | 3300008055 | Estuary | RKLYAMMDRVQKARGKTTGKGRVAKNTRAEKYLPA* |
Ga0108970_118048303 | 3300008055 | Estuary | LGNGSTEAGARQLYAMMDRVQKARGKTVGKGRVAKNTRANKYLPA* |
Ga0114343_11709881 | 3300008110 | Freshwater, Plankton | GARKLYAMMDRVQKARKKSVGKNKVAVNSKADKYLPA* |
Ga0114346_11723791 | 3300008113 | Freshwater, Plankton | IVSELGNGSTEAGARKLYAMMNRVQAARGKTTGKGRVAKNTRADKYLPA* |
Ga0114347_10606271 | 3300008114 | Freshwater, Plankton | AGAKKLYAMMDRVQKARGKTTGKNKVAANSRADKYLPA* |
Ga0114347_11638411 | 3300008114 | Freshwater, Plankton | TEAGARKLYAMMDRIQKARQGTVGKGKVAKNSRADKHLPA* |
Ga0114355_11350741 | 3300008120 | Freshwater, Plankton | LGNGSTEAGARKLYAMMDRVQKNRSKTVGKNKVAVDSRSEKLLPA* |
Ga0114841_12090661 | 3300008259 | Freshwater, Plankton | IVSELGNGSTEAGARKLYAMMNRVQAASGKTTGKGRVAKNTRAEKYLPA* |
Ga0114363_10685715 | 3300008266 | Freshwater, Plankton | ELGNGSTEAGARKLYAMMDRVQKNRSKTVGKNKVAVDSRSEKLLPA* |
Ga0114876_10288783 | 3300008448 | Freshwater Lake | ARKLYAMMDRIQKARQGTVGKGRVAKNSRSDKHLPA* |
Ga0114876_11767711 | 3300008448 | Freshwater Lake | VSELGNGSTDAGAKRLYAMMNRVQKNRKKSVGKGKVAVDSKAYRHLPA* |
Ga0114876_12494522 | 3300008448 | Freshwater Lake | SEIGNGSTEAGARKLYAMMDRVQKARRKTVGKKQVAVNSKADKYLPA* |
Ga0114880_10116031 | 3300008450 | Freshwater Lake | AGARKLYAMMDRVQKARKKSVGKERVAVDSKAEKLLPA* |
Ga0114880_10877611 | 3300008450 | Freshwater Lake | TEAGARKLYAMMDRIQKQRKKTVGKGKVAVNSKADKHLPA* |
Ga0114880_10977901 | 3300008450 | Freshwater Lake | EAGARKLYAMMDRVQKARRKSVGKGKVAVDSKAEKLLPA* |
Ga0114880_12147022 | 3300008450 | Freshwater Lake | AKKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA* |
Ga0105105_102648163 | 3300009009 | Freshwater Sediment | KQLYAMMDRVQKNRKKTVGKGKVAVDSKSRKLLPA* |
Ga0105105_110115742 | 3300009009 | Freshwater Sediment | GNGSTDAGAKRLYGMMDRVQKNRKKTVGKGKVAVDSKAHRMLPA* |
Ga0105093_104619603 | 3300009037 | Freshwater Sediment | RIVSELGNGSTEAGARKLYAMMDRIQKGRKKSIGKGRVAVNSRADKNLPA* |
Ga0114973_101897552 | 3300009068 | Freshwater Lake | STEAGARKLYAMMDRIQSARGGTVGKGRVAKNSRAEKYLPA* |
Ga0114973_102007861 | 3300009068 | Freshwater Lake | GNGSTDAGARKLYAMMDRIQKARGKTLKNVAANTKADKHLPA* |
Ga0114973_104650472 | 3300009068 | Freshwater Lake | GSTNAGANKLYDMMDRVQKARRQTKNVAADTKAHKYLPS* |
Ga0114973_106975822 | 3300009068 | Freshwater Lake | PARIVSELGNGSTEAGARKLYAMLDRIQAHRGKSVGKGKVAVNSRADKFLPA* |
Ga0105098_107100781 | 3300009081 | Freshwater Sediment | ARKLYAMMDRVAKRRKKSIGKGKIAVDSGAHKELNKL* |
Ga0105091_105647922 | 3300009146 | Freshwater Sediment | GARKLYAMMDRIQKGRRKSVGKGKVAVNSKADKYLPA* |
Ga0114962_102162462 | 3300009151 | Freshwater Lake | NGSTDAGARKLYAMMDRIQAARKQTVGKGKVATNSRAEKYLPR* |
Ga0114962_102955601 | 3300009151 | Freshwater Lake | RKLYAMMERVQQARGKTVGKGKVAKNSRADKYLPV* |
Ga0114962_105051301 | 3300009151 | Freshwater Lake | RIVSELGNGSTEAGARQLYKMMDRVQNARRKTVGSNKVATNTRAGKYLPV* |
Ga0114980_100568571 | 3300009152 | Freshwater Lake | KRLYAMMERVQSGRKKSIGKDKVAVDSKARKHLPV* |
Ga0114963_100195633 | 3300009154 | Freshwater Lake | VPARIVSELGNGSTEAGARKLYQMMDRIQSARSKTVGKGHVAKNSRADKYLPG* |
Ga0114963_102292402 | 3300009154 | Freshwater Lake | SELGNGSTDAGARSLYKMMDRIQHNRRKSIGKGNVAADSRSEQYLPA* |
Ga0114963_102564701 | 3300009154 | Freshwater Lake | SEIGNGSTDAGARELYKMMDRIQAGRAKTVGKDQVARNSKAVRHLPA* |
Ga0114963_105334971 | 3300009154 | Freshwater Lake | RIVSEIGNGSTDAGARKLYAMMERIQKDRKKTIKNVAANTKAEKHLPA* |
Ga0114968_101297062 | 3300009155 | Freshwater Lake | GSTEAGARKLYAMMDRVQHARRHSIGKGNVAKNSRADKYLPA* |
Ga0114968_101784501 | 3300009155 | Freshwater Lake | AKKLYAMMDRIQGARKKSIKNVAANTKADKYLPS* |
Ga0114968_105110822 | 3300009155 | Freshwater Lake | GSTDAGARKLYAMMDRIQKARGKTLKNVAANTKADKHLPA* |
Ga0114968_107213192 | 3300009155 | Freshwater Lake | ARKLYAMMDRVQKARKKTVGKHRVAANTNSDKYLPA* |
Ga0114978_103060882 | 3300009159 | Freshwater Lake | EAGARALYKMMDRIQANRRKTTGRTRVAVDSKSHKYLPA* |
Ga0114981_102331551 | 3300009160 | Freshwater Lake | NGSTEAGARKLYAMLDRVQASRKHTVGKGKVAKNNRADKYLPA* |
Ga0114975_105139921 | 3300009164 | Freshwater Lake | ARKLYAMMDRVQKARRKTVGKDRVAANTRAEKLLPA* |
Ga0114975_105600231 | 3300009164 | Freshwater Lake | GARKLYQMMDRIQAARGKTVGKGRVAKNSRADKHLPA* |
Ga0105097_106749181 | 3300009169 | Freshwater Sediment | KRLYAMMERVQNNRKKTVGKGKVAVDSKARKMLPA* |
Ga0105097_108027221 | 3300009169 | Freshwater Sediment | GARKLYAMMDRVQKARGKTTGKDRVAVNSRAEKLLPA* |
Ga0114979_107161081 | 3300009180 | Freshwater Lake | AGARELYKMMDRIQAGRRKTVGKDQVAKNSKAVRHLPA* |
Ga0114979_107548021 | 3300009180 | Freshwater Lake | AKRLYAMMDRIQKNRGKTVGKGKVAVNSKSSKYLPA* |
Ga0114959_102275111 | 3300009182 | Freshwater Lake | NGSTEAGARQLYKMLDRVQQARAKTTGKSRVAKNTNAAKYLPA* |
Ga0114959_105266871 | 3300009182 | Freshwater Lake | AGARKLYAMMERIQKDRKKSIGKGKVAVNSKADKHLPA* |
Ga0114959_106343661 | 3300009182 | Freshwater Lake | GSTEAGARKLYAMMDRVQKSRSKTVGKDKVAANTRADKYLPA* |
Ga0114974_101465544 | 3300009183 | Freshwater Lake | GNGSTEAGAKRLYAMMDRVQKARKKTIGKGKIAKDSKSSKYLPA* |
Ga0114974_102248681 | 3300009183 | Freshwater Lake | GSTEAGARKLYAMMDRVQKARSKTVGKDKVAANSRADKYLPV* |
Ga0114974_102329501 | 3300009183 | Freshwater Lake | AKKLYAMMDRVQRARGKTTGKDKVAANSRADKYLPA* |
Ga0114974_103917061 | 3300009183 | Freshwater Lake | KQLYKMLDRVQNARGKTTGKDKVAKNTNAAKLLPA* |
Ga0114974_106985451 | 3300009183 | Freshwater Lake | EAGARKLYAMMERIQAARGKTVGKNRVAANSRADRHLPV* |
Ga0114976_100189774 | 3300009184 | Freshwater Lake | EAGARKLYAMMDRVQAARKGSIGKNKVANNSRADKYLPA* |
Ga0114976_101611731 | 3300009184 | Freshwater Lake | AKKLYAMMQRIQQARGRTVGRNKVAVNSRAEKLLPA* |
Ga0114976_105330991 | 3300009184 | Freshwater Lake | IVSELGNGSTDAGARKLYQMMDRIQAARKKTTGKNRVAVNSRTDKMMPV* |
Ga0114972_100203011 | 3300009187 | Freshwater Lake | PELGNGPTEAGARKLHAMMDRTQSARGGTGGKGRVDKNSRAEKYLPV* |
Ga0103848_10125063 | 3300009218 | River Water | RGAKQLYAMMDRVQKARGKTTGKGKMAKNTSAAKYLPA* |
Ga0103850_10181153 | 3300009223 | River Water | RLTIGRHRGAKQLYAMMDRVQKARGKTTGKGKMAKNTSAAKYLPA* |
Ga0114951_101232591 | 3300009502 | Freshwater | AGARQLYKMMDRIQNTRRKTVGKNAVATNTNAHQYLPA* |
Ga0114951_106499982 | 3300009502 | Freshwater | ARQLYKMMDRIQNTRRKTVGKDAVATNTNAHQYLPA* |
Ga0114964_101080213 | 3300010157 | Freshwater Lake | AGARKLYEMMARVQQARGKTVGKNSVAVNSRADRHLPV* |
Ga0114960_102539973 | 3300010158 | Freshwater Lake | GARKLYAMMDRVQASRKKTIGKDKVAHNSKAEKYLPA* |
Ga0114960_105653062 | 3300010158 | Freshwater Lake | ELGNGSTEAGARKLYAMMDRIQSARGKTVGKGKVAKNSRSEKYLPA* |
Ga0114967_101304571 | 3300010160 | Freshwater Lake | KLYAMMDRVQAARRGSIGKGKVAKNTRASKYLPE* |
Ga0114967_104904551 | 3300010160 | Freshwater Lake | KLYKMMDRIQAARKKTVGKGNVAANTKTDKYLPA* |
Ga0136655_11918201 | 3300010316 | Freshwater To Marine Saline Gradient | TEAGARKLYAMMERVQKARGKTVGKGKIATNSRAAKHLPA* |
Ga0136644_100258801 | 3300010334 | Freshwater Lake | RKLYQMMDRVQNARKKTTGKKQVASNPRAEQYLPA* |
Ga0136644_107321752 | 3300010334 | Freshwater Lake | KLYAMMDRIQAGRKKSVGKGKVAVNSRADKYLPA* |
Ga0129333_101476622 | 3300010354 | Freshwater To Marine Saline Gradient | ARQLYAMMDRIQKARKQTVGKGRVAKNTKAHKHLPA* |
Ga0129333_110694443 | 3300010354 | Freshwater To Marine Saline Gradient | FVVPARIVSELGNGSTEAGARKLYAMLDRVQKARGKTTGKGKVAKNTRADKYLPA* |
Ga0129333_111007373 | 3300010354 | Freshwater To Marine Saline Gradient | GSTEAGAKKLYAMLDRIQAARSKTVGKGKVAKDSKAENMLPA* |
Ga0129333_112640182 | 3300010354 | Freshwater To Marine Saline Gradient | ARKLYAMMERVQKARGKTTGKNKVAKNTRADKYLPA* |
Ga0129333_112780692 | 3300010354 | Freshwater To Marine Saline Gradient | IVSELGNGSSEAGARRLYAMMERVQKARQKSVGKGKVAVDSKAEKLLPA* |
Ga0129336_103254321 | 3300010370 | Freshwater To Marine Saline Gradient | AGARKLYAMMDRIQAARRKSIGKGKVAKNSRADKYLPA* |
Ga0129336_103643703 | 3300010370 | Freshwater To Marine Saline Gradient | GARKLYAMMDRIQRARRKSIGKDRVAVDSKAEKLLPA* |
Ga0133913_125201551 | 3300010885 | Freshwater Lake | IVSELGNGSTEAGARALYKMMDRIQANRRKTTGRTRVAVDSKSHKYLPA* |
Ga0133913_129979701 | 3300010885 | Freshwater Lake | AGAKRLYEMMDRVQKARRKTKNVAADTKAAKYLPA* |
Ga0139557_10271332 | 3300011010 | Freshwater | GARKLYAMMDRVQKARRGTVGKGKVAKNSRSDKYLPA* |
Ga0139557_10282141 | 3300011010 | Freshwater | STDAGAKKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA* |
Ga0151517_13581 | 3300011113 | Freshwater | RKLYAMMDRIQAARSKTVGKGKVAVNTRAHKFLPK* |
Ga0120090_1236481 | 3300011918 | Mine Pit Pond | TEPGARKLYAMMDRVQKARRKTVGKDKVANNPRADKYLPA* |
Ga0119931_10316102 | 3300011984 | Drinking Water Treatment Plant | RKLYAMMDRVQRARAKTTGKGKAAKKTSAEKYLPA* |
Ga0119931_10522552 | 3300011984 | Drinking Water Treatment Plant | KLYAMMDRVQRARGKTVGKGRVAKNTRADKYLPA* |
Ga0153801_10603751 | 3300012017 | Freshwater | KLYAMMDRIQSARGKTVGKGKVAKNSRAERLLPA* |
Ga0157203_10496082 | 3300012663 | Freshwater | VSELGNGSTEAGARKLYAMLDRVQSARKKSIGKGKVAKNSRADNLLPA* |
Ga0157210_10341253 | 3300012665 | Freshwater | NGSTDAGARKLYAMMDRVQKQRGKTTGKGKVAVNSKADKHMPV* |
Ga0157498_10057811 | 3300012666 | Freshwater, Surface Ice | TEAGARALYKMMDRIQANRRKTTGKNKVAVNSKSHKYLPA* |
Ga0157498_10443941 | 3300012666 | Freshwater, Surface Ice | AGARKLYAMMDRIQSARGKTVGKGKVAKNSRAERLLPA* |
Ga0157608_10319142 | 3300012709 | Freshwater | NGSTEAGARKLYAMMDRVQKARGKTLKNVAANSKADKHLPA* |
Ga0164292_109597121 | 3300013005 | Freshwater | STEAGARKLYAMMERVQRARSKTVGRGKVAVNSRSEKMLPA* |
Ga0164295_102494333 | 3300013014 | Freshwater | STEAGARKLYAMMNRVQNARKKSVGKSKVAVDSKAERLLPA* |
Ga0164296_10050931 | 3300013093 | Freshwater | AGARQLYKMMDRIQQARTKTTGKDAVATNTNAHKYLPA* |
Ga0164296_12579322 | 3300013093 | Freshwater | GNGSTEAGARQLYKMMDRIQTARRKTTGKDAVATNTNAHQYLPA* |
Ga0164297_104326511 | 3300013094 | Freshwater | AGARQLYKMMDRIQNARSKTVGKDRVATNTNANQYLPA* |
Ga0177922_100529171 | 3300013372 | Freshwater | GSTEAGARKLYAMMDRVQRARRGTVGKGRVAKNSRSEKYLPA* |
Ga0177922_104662481 | 3300013372 | Freshwater | RKLYAMMDRIQSARKKTVGKDKVAHNSRSSKYLPA* |
Ga0177922_106084742 | 3300013372 | Freshwater | LGNGSTEAGARKLYAMMDRIKKARSKSLKNIAANSKADKYLPA* |
Ga0177922_107516122 | 3300013372 | Freshwater | AGARKLYAMMDRIQSARKKTVGKGKVAHNSRAVKYLPA* |
Ga0177922_109023621 | 3300013372 | Freshwater | IVSEIGNGSTEAGARKLYGMMDRVQSARRQTVGKGKVAKNSRADKYLPA* |
Ga0177922_112643861 | 3300013372 | Freshwater | GNGSTEAGARALYKMMDRIQANRRKTTGKNSVAVNSKSHKYLPA* |
Ga0181338_10023331 | 3300015050 | Freshwater Lake | STEAGARQLYAMMDRIQAGRKKTVGKNKTAVNSKSVRHLPA* |
Ga0181338_10033751 | 3300015050 | Freshwater Lake | GARKLYAMMERVQKRRGKTTGKGKVAVNSKADKHLPA* |
Ga0181338_10059321 | 3300015050 | Freshwater Lake | NGSTEAGARKLYAMMDRIQSARKKTVGKGKVAHNSRAVKYLPA* |
Ga0181338_10090313 | 3300015050 | Freshwater Lake | STEAGARQLYAMMDRVQKARKKTVGKDKVATNSRAAKLLPA* |
Ga0181338_10119811 | 3300015050 | Freshwater Lake | EAGARKHYAMMDRVQRARGKTTGKNKVAANSRADKYLPA* |
Ga0181338_10233523 | 3300015050 | Freshwater Lake | AGARALYKMMDRIQANRRKTTGKNSVAVDSKAHKYLPA* |
Ga0181338_10236491 | 3300015050 | Freshwater Lake | ALYKMMDRIQANRRKTTGKNRVAVNSKSHKYLPA* |
Ga0181338_10384731 | 3300015050 | Freshwater Lake | AGAKKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA* |
Ga0181339_10122581 | 3300017700 | Freshwater Lake | ELGNGSTEAGARKLYAMMDRVQSARRGTVGKGRVAKNSRSEKYLPA |
Ga0181339_10174153 | 3300017700 | Freshwater Lake | GSTEAGARKLYAMMDRIQKARGKTVGKNKVAKNSRSEKYLPA |
Ga0181363_10023391 | 3300017707 | Freshwater Lake | ARKLYAMMDRVQKARKKSVGKNKVAVDSKTDKHLPA |
Ga0181363_10044814 | 3300017707 | Freshwater Lake | AGARKLYAMMDRVQKARGKTVGKGKVAANTRADKYLPA |
Ga0181363_10568931 | 3300017707 | Freshwater Lake | GARKLYAMMDRVQKARGKTVGKGKVAKNTRADKYLPA |
Ga0181350_10103221 | 3300017716 | Freshwater Lake | RKLYAMMDRVQAARRGSIGKGRVAKNSRADKYLPA |
Ga0181350_10109431 | 3300017716 | Freshwater Lake | EAGARKLYQMMDRIQAARSKTVGKGRVAKNSRSDKYLPA |
Ga0181350_10115583 | 3300017716 | Freshwater Lake | CGLPIKEAGARQLYAMMDRVQKARKKTVGKDKVATNSRAAKLLPA |
Ga0181350_10157141 | 3300017716 | Freshwater Lake | TEAGARQLYAMMDRVQKARKKTVGKDKVATNSRAAKLLPA |
Ga0181350_10336433 | 3300017716 | Freshwater Lake | ARKLYAMMDRIQKARGKTVGKGKVAANSRSAKYLPA |
Ga0181350_10581113 | 3300017716 | Freshwater Lake | ARRLYAMMDRIQKSRSKTVGKGKVAVNNRAHMHLPA |
Ga0181350_11401901 | 3300017716 | Freshwater Lake | EAGARALYKMMDRIQANRRKTTGKNRVAVNSKSHKYLPA |
Ga0181350_11470022 | 3300017716 | Freshwater Lake | SELGNGSTDAGAKKLYAMLDRVQRARGKTTGKNKVAANSRADKHLPA |
Ga0181350_11530581 | 3300017716 | Freshwater Lake | TEAGARKLYAMMDRIQKARGKTVGQNKVAKNSRSEKYLPA |
Ga0181350_11647451 | 3300017716 | Freshwater Lake | NGSTEAGARQLYAMMDRVQKARKKTVGKDKVATNSRAAKLLPA |
Ga0181350_11687831 | 3300017716 | Freshwater Lake | STDAGAKKLYAMLDRVQRARGKTTGKNKVAANSRSDKYLPA |
Ga0181350_11711331 | 3300017716 | Freshwater Lake | TEAGARKLYAMMDRIQKARGKTVGKNKVAKNSRSEKYLPA |
Ga0181347_10250101 | 3300017722 | Freshwater Lake | VPARIVSELGNGSTDAGAKKLYAMFDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0181347_10458333 | 3300017722 | Freshwater Lake | GNGSTEAGARKLYAMMDRIQKARGKTVGKNKVAKNSRSEKYLPA |
Ga0181347_10702481 | 3300017722 | Freshwater Lake | GARALYKMMDRIQANRRKTTGKNSVAVNSKSHKYLPA |
Ga0181347_10702921 | 3300017722 | Freshwater Lake | IVSELGNGSTEAGARALYKMMDRIQANRRKTTGKNRVAVNSKSHKHLPA |
Ga0181347_10859561 | 3300017722 | Freshwater Lake | AGARKLYAMMDRIQKARGKTVGKGKVAKNSRSEKYLPA |
Ga0181347_11490351 | 3300017722 | Freshwater Lake | GSTDAGAKKLYAMMDRVQRARGKTTGKNKVAANPRADKYLPA |
Ga0181347_11559131 | 3300017722 | Freshwater Lake | GNGSTEAGARALYKMMDRIQANRRKTTGKNSVAVNSKSHKYLPA |
Ga0181362_10305591 | 3300017723 | Freshwater Lake | IVSELGNGSTDAGARALYKMMDRIQAGRRKTVGKDQVAKNSKSARHLPA |
Ga0181365_11140253 | 3300017736 | Freshwater Lake | ARKLYQMMDRIQAARKKTTGKNRVAVNSRADKMMPV |
Ga0181365_11285601 | 3300017736 | Freshwater Lake | ELGNGSTDAGAKNLYAMMQRIQQARGKTVGNGKVAVNSRAEKLLPA |
Ga0181365_11594371 | 3300017736 | Freshwater Lake | DAGARKLYAMMDRIQASRKKTVGKGKVAKNTRAEKYLPR |
Ga0181365_11710462 | 3300017736 | Freshwater Lake | LGNGSTEAGARKLYAMMDRVQSARRSTVGKGRVAKNSRSDKYLPA |
Ga0181352_10168651 | 3300017747 | Freshwater Lake | LGNGSTEAGARKLYAMMNRVQRARGKTTGKGKVAKNTRAEKYLPA |
Ga0181352_10332421 | 3300017747 | Freshwater Lake | ETEAGARKLYAMMDRVQAARRGSIGKGKVAKNSRADKYLPA |
Ga0181352_10420151 | 3300017747 | Freshwater Lake | TEAGARKLYAMMDRVQKARSKTVGKDRVAANSRADKYLPS |
Ga0181352_10466773 | 3300017747 | Freshwater Lake | LGNGSTEAGARKLYAMMDRIQKNRRKTVGKGKVAVNSRSDKLLPA |
Ga0181352_10604983 | 3300017747 | Freshwater Lake | STEAGARKLYAMMDRIQKSRGKTVGKKKVAVNSRADKHLPA |
Ga0181352_11206522 | 3300017747 | Freshwater Lake | LGNGSTEAGARALYKMMDRIQANRRKTTGKNRVAVNSKSHKYLPA |
Ga0181352_12000491 | 3300017747 | Freshwater Lake | LGNGSTEAGARKLYAMMNRVQRARGKTTGKGKVAKNTRAEKDLPA |
Ga0181344_10046824 | 3300017754 | Freshwater Lake | GARKLYAMMDRVQATRKKSIGKNKVAKNSRADKFLPA |
Ga0181344_10167681 | 3300017754 | Freshwater Lake | EAGAKQLYKMLDRVQNARGKTTAKGKVAKNTNAAKLLPA |
Ga0181344_10282661 | 3300017754 | Freshwater Lake | TEAGARRLYAMMDRIQAARGKTTGKGKVAKNTRADKYLPA |
Ga0181344_10720751 | 3300017754 | Freshwater Lake | AGAQKLYSMMDRVQNARRKTKNVAADTKAHKYLPS |
Ga0181344_11119422 | 3300017754 | Freshwater Lake | VLPARIVSEIGNGSTDAGARELYKMMDRIQQGRAKTVGKNKVAFDAKARNKLPA |
Ga0181344_11268291 | 3300017754 | Freshwater Lake | LGNGSTEAGARKLYQMLARVQNARKKSIGQGRVAVNSRADKMLPA |
Ga0181344_11312552 | 3300017754 | Freshwater Lake | SELGNGSTEAGARKLYKMMDRIQAARGKTVGKGRVAKNSRAEKHLPA |
Ga0181344_11574042 | 3300017754 | Freshwater Lake | PARIVSELGNGSTDAGARKLYAMMNRIQQARGKTVGNGKVAVNSRAEKLLPA |
Ga0181344_12228271 | 3300017754 | Freshwater Lake | ARKLYAMRDRIQENRKKTIGEDNVAVDSRSERFLPA |
Ga0181344_12422182 | 3300017754 | Freshwater Lake | ARIVSELGNGSTEAGARKLYAMMERVQATRKKSIGKRKVAVNSKADKHLPA |
Ga0181356_11078571 | 3300017761 | Freshwater Lake | GSTEAGARALYKMMDRIQANRRKTTGKNKVAVNSKSHKYLPA |
Ga0181356_11928932 | 3300017761 | Freshwater Lake | AGAKKLYAMMDRVQRARGKTTGKNKVAANSRSDKYLPA |
Ga0181356_12096451 | 3300017761 | Freshwater Lake | ARKLYAMMDRIQKARGKTVGKNKVAKNSRSEKYLPA |
Ga0181343_10762271 | 3300017766 | Freshwater Lake | GARKLYAMLDRIQAGRKKSIGKKKVAVNSRADKNLPA |
Ga0181343_11727121 | 3300017766 | Freshwater Lake | STEAGARKLYAMMDRVQKARRKTVGKGQVAANTNAEKLLPA |
Ga0181358_10097931 | 3300017774 | Freshwater Lake | RIVSELGNGSTEAGARALYKMMDRIQANRRKTTGRTRVAVDSKAHKYLPA |
Ga0181358_11938742 | 3300017774 | Freshwater Lake | KKLYAMLDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0181357_10079691 | 3300017777 | Freshwater Lake | NGSTEAGARQLYAMMERIQKNRKKSVGKGKVAVDSKAKKHLPA |
Ga0181357_10159111 | 3300017777 | Freshwater Lake | STEAGARQLYAMMDRIQKGRRKTVGKNKVAANTRSAKHLPA |
Ga0181357_10873361 | 3300017777 | Freshwater Lake | AGARALYKMMDRIQAARGRTTGKNQVAVNSNATKYLPA |
Ga0181357_11498981 | 3300017777 | Freshwater Lake | NGSTEAGARALYKMMDRIQANRRKTTGKNSVAVNSKSHKYLPA |
Ga0181357_11555442 | 3300017777 | Freshwater Lake | GSTEAGAKKLYAMMDRVQNVRKKSFKNVAANTKADKYLPR |
Ga0181357_11789773 | 3300017777 | Freshwater Lake | GNGSTEAGARKLYSMMDRVQSARRQTVGKGKVAKNSRADKYLPA |
Ga0181357_12199522 | 3300017777 | Freshwater Lake | EAGARALYKMMDRIQANRRKTTGKNKVAVNSKSHKYLPA |
Ga0181357_12594541 | 3300017777 | Freshwater Lake | IVSELGNGSTEPGARKLYAMMERIQKARGKTVGKGKVAKNSRSEKYLPA |
Ga0181357_12803882 | 3300017777 | Freshwater Lake | VPARIVSELGNGSTDAGAKKLYAMLDRVQRARGKTTGKNKVAANSRADTYLPA |
Ga0181357_12835061 | 3300017777 | Freshwater Lake | AGARALYKMMDRIQANRRKTTGKNRVAVNSKSHKYLPA |
Ga0181357_12958861 | 3300017777 | Freshwater Lake | AGAKKLYAMMQRVQQARGRTVGRGKVAVNSRAEKLLPA |
Ga0181357_13002391 | 3300017777 | Freshwater Lake | AGARKLYAMMDRVQKARKKTVGKGKVAANSRSAKYLPA |
Ga0181357_13082242 | 3300017777 | Freshwater Lake | LGNGSTEAGARQLYAMMDRVQKKRRSTVGKGKVAVNSKAHQVMPA |
Ga0181349_10454861 | 3300017778 | Freshwater Lake | ISACIVSELGNGATDAGAKKLYDMMDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0181349_10630411 | 3300017778 | Freshwater Lake | GARKLYAMMDRIQKARKKTVGKGKVAANSRSAKYLPA |
Ga0181349_11618651 | 3300017778 | Freshwater Lake | ARIVSEIGNGSTEAGARKLYSMMDRVQSARRQTVGKGKVAKNSRADKYLPA |
Ga0181349_12616591 | 3300017778 | Freshwater Lake | GAKKLYAMMQRIQQARGKTVGNGKVAVNSRAEKLLPA |
Ga0181349_12785102 | 3300017778 | Freshwater Lake | AKKLYAMMDRVQKARGKTTGKNKVAANSRADKYLPS |
Ga0181346_10171304 | 3300017780 | Freshwater Lake | ARKLYAMMDRVQAARRGSIGKGRVAKNSRADKYLPA |
Ga0181346_10258673 | 3300017780 | Freshwater Lake | RKLYAMMDRIQASRKKTVGKGKVAKNTRAEKYLPR |
Ga0181346_10426961 | 3300017780 | Freshwater Lake | RKLYAMMDRIQKARGKTVGKGKVAKNSRSEKYLPA |
Ga0181346_10924141 | 3300017780 | Freshwater Lake | RKLYAMMDRVQKARRGTVGKGRVAKNSRSDKYLPA |
Ga0181348_10294671 | 3300017784 | Freshwater Lake | TDAGAKRLYAMMDRVQKNRRKSVGKGKVAVDSKAYKHLPA |
Ga0181348_10758621 | 3300017784 | Freshwater Lake | EAGARKLYAMMDRVQKARKKTVGKGKVAANSRSAKYLPA |
Ga0181348_10766802 | 3300017784 | Freshwater Lake | VSELGNGSTEAGARALYKMMDRIQANRRKTTGKNRVAVNSKSHKHLPA |
Ga0181348_11293831 | 3300017784 | Freshwater Lake | TEAGARKLYAMLARIQAGRSKSMGKNNVATNSRMDKNLPA |
Ga0181348_11792891 | 3300017784 | Freshwater Lake | ELGNGSTEAGARKLYAMMDRVQAARRGSIGKGKVAKNSRADKYLPA |
Ga0181348_12119811 | 3300017784 | Freshwater Lake | IVSELGNGSTDAGAKKLYAMMERVQRARGKTTGKNKVAANSRSDKYLPA |
Ga0181348_12552662 | 3300017784 | Freshwater Lake | SELGNGSTEAGARKLYAMMDRIQKARGKTVGKGRVAKNSRSEKYLPA |
Ga0181348_12727012 | 3300017784 | Freshwater Lake | GNGSTEAGARKLYAMMDRVQKARRGTVGKGRVAKNSRSEKYLPA |
Ga0181348_12858052 | 3300017784 | Freshwater Lake | GNGSTEAGARKLYAMMDRVQAARRQTVGKGRVAKNSRADKYLPA |
Ga0181348_13132691 | 3300017784 | Freshwater Lake | ARIVSELGNGSTEAGARKLYAMMERVQKARKKTVGKGKVAANSRSAKYLPA |
Ga0181355_10739751 | 3300017785 | Freshwater Lake | PARIVSELGNGSTEAGARALYKMMDRIQANRRKTTGKNKVAVNSKSHKYLPA |
Ga0181355_10997572 | 3300017785 | Freshwater Lake | GNGSTEAGARKLYAMMDRVQRARRGSIGKGKVAKNSRADKYLPA |
Ga0181355_11034971 | 3300017785 | Freshwater Lake | RKLYKMMDRIQAARSKTVGKGRVAKNSRAEKHLPA |
Ga0181355_11304091 | 3300017785 | Freshwater Lake | TDAGARRLYAMMDRIQKSRSKTVGKGKVAVNNRAHMHLPA |
Ga0181355_11319992 | 3300017785 | Freshwater Lake | VSELGNGSTEAGARQLYAMMDRIQAGRKKTVGKNKTAVNSRSVRHLPA |
Ga0181355_12581782 | 3300017785 | Freshwater Lake | PARIVSELGNGSTEAGARKLYGMMDRVQASRKNTVGKDKVAKNNRADKYLPA |
Ga0181355_12859432 | 3300017785 | Freshwater Lake | STEAGARKLYAMMDRIQAGRKKSVGKGKVAVNSRADKYLPA |
Ga0181355_13090441 | 3300017785 | Freshwater Lake | KRLYAMMDRVQKARQKTTGKDKVAVNTNPNRLLPA |
Ga0181355_13304302 | 3300017785 | Freshwater Lake | AGAKKLYAMMDRVQRARGKTTGENKVAANSRSDKYLPA |
Ga0181553_101245063 | 3300018416 | Salt Marsh | GNGSTEAGARKLYAMMDRIQKARGKTVGKGKVAKNSQAEKHLPA |
Ga0181360_1026431 | 3300019781 | Freshwater Lake | RKLYAMMERVQKSRKKSIGKNKVAVNSKADKHLPA |
Ga0181361_1067491 | 3300019783 | Freshwater Lake | LGNGSTEAGARKLYAMMDRVQKARGKTVGKGKVAANSRSAKYLPA |
Ga0181361_1096241 | 3300019783 | Freshwater Lake | LPIWEERKECSTEAGAKQLYAMMDRIQRARRKTTGKKQVAKNTKAHKLMPA |
Ga0181361_1186752 | 3300019783 | Freshwater Lake | DGNGSTEAGARKLYAMMDRVQKARGETLKNVAANSRADKYLPA |
Ga0181359_10010274 | 3300019784 | Freshwater Lake | GARKLYAMMDRIQKARGKTVGKNKVAKNSRSEKYLPA |
Ga0181359_10193081 | 3300019784 | Freshwater Lake | RRLYAMMDRVQKARRKTVGKGKVAVNSKADKHLPA |
Ga0181359_10196682 | 3300019784 | Freshwater Lake | AGARALYKMMDRIQANRRKTTGRTRVAVDSKAHKYLPA |
Ga0181359_10683801 | 3300019784 | Freshwater Lake | GSTEAGAKKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0181359_10820883 | 3300019784 | Freshwater Lake | VSELGNGSTEAGARKLYAMMDRVQKARKKTVGKGKVAANSRSAKYLPA |
Ga0181359_11342461 | 3300019784 | Freshwater Lake | TDAGAKKLYAMMDRVQRARGKTTGKNKVAANSRSDKYLPA |
Ga0181359_11836561 | 3300019784 | Freshwater Lake | IVSEIGNGSTDAGARALYKMMDRIQAGRRKTVGKNQVAKNSKAVRHLPA |
Ga0181359_12110011 | 3300019784 | Freshwater Lake | RKLYSMMDRVQSARRQTVGKGKVAKNSRADKYLPA |
Ga0181359_12614262 | 3300019784 | Freshwater Lake | STDAGAKKLYAMLDRVQRARGKTIGKNKVAANSRSDKYLPA |
Ga0181359_12614682 | 3300019784 | Freshwater Lake | EKRKLYAMMDRIQKSRGKTVGKKKVAVNSRADKHLPV |
Ga0181359_12679862 | 3300019784 | Freshwater Lake | DAGAKKLYAMLDRVQRARGKTTGKNKVAANSRSDKYLPA |
Ga0211736_104011881 | 3300020151 | Freshwater | TDAGAKRLYAMMDRVQKNRKKSVGKGKVAVDSKAYKNLPA |
Ga0211736_109315962 | 3300020151 | Freshwater | SEIGNGSTDAGARALYKMMDRVQQRRSKTVGRGKVAVNSKAYKELDKL |
Ga0211734_102498033 | 3300020159 | Freshwater | TEAGARKLYAMMDRVQKARGKTTGKDRVAVNSRAEKLLPA |
Ga0211734_107671662 | 3300020159 | Freshwater | TEAGAQKLYSMMDRVQKARRKTKNVAADTKAHKYLPA |
Ga0194124_102459573 | 3300020196 | Freshwater Lake | AGARKLYAMMDRVQKARKKSVGKNKVAVNSRADKHLPA |
Ga0194042_11886881 | 3300020229 | Anoxic Zone Freshwater | GQLYAMMDRIQSGRKKTVGKNKVAANTRAAKHLPA |
Ga0208364_10367362 | 3300020533 | Freshwater | VSELGNGSTDAGAKKLYAMLDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0207942_10213692 | 3300020549 | Freshwater | GAKKLYAMMARVQRARGKTTGKNKVAANSRADKYLPA |
Ga0208360_10163172 | 3300020551 | Freshwater | TEAGAKKLYAMMDRVQKARRKTKNVAADTKAHKYLPA |
Ga0208360_10372723 | 3300020551 | Freshwater | TDAGARRLYAMMDRIQKARRKTTGKHKIAVNSKAEKYLPA |
Ga0214199_10298431 | 3300021124 | Freshwater | GARQLYAMLDRIQNGRRKSIGKGNVAVDTNAAKHLPA |
Ga0214206_10315571 | 3300021131 | Freshwater | ARKLYAMMDRIQASRKKTVGRDRIAYNNKTDRHLPA |
Ga0214171_10249432 | 3300021134 | Freshwater | GNGSTDAGARKLYAMMDRVQAARGGTVGKGRVAKNTRADRYLPA |
Ga0214166_10407041 | 3300021139 | Freshwater | GSTEAGARKLYAMMERVQKVRGKTTGKDKVATNTHADKHLPA |
Ga0222715_100925751 | 3300021960 | Estuarine Water | STDAGARKLYAMMERIQSARKKSVGKGRVATNTKSEKYLPA |
Ga0222714_103519831 | 3300021961 | Estuarine Water | NGSTDAGARKLYAMMDRVQKARGKTTGKNRVAANTRSEKYLPA |
Ga0222713_107160582 | 3300021962 | Estuarine Water | VPARIVSELGNGSTEAGARKLYAMLDRVQAARKKSIGKGKVAKNSRADKLLPA |
Ga0222712_100633643 | 3300021963 | Estuarine Water | NGSTEAGARKLYAMMDRVQKNRRKSIGRNKVAVNSRSDKYLPA |
Ga0222712_106781922 | 3300021963 | Estuarine Water | ELGNGSTEAGARKLYAMMDRIQKARGKTVGKGKIAKNSRAEKHLPA |
Ga0196889_10518793 | 3300022072 | Aqueous | GNGSTEAGARKLYAMMDKIQKARGKTTGKNQVAKNTRADKFLPA |
Ga0181337_10046983 | 3300022173 | Freshwater Lake | GRKLYAMMDRIQKVRGKTTGKDAVAKNSRAEKHLPA |
Ga0181353_10271931 | 3300022179 | Freshwater Lake | SGARKLYAMMNRVQAARGKTTGKGRVAKNTRADKYLPA |
Ga0181353_10684783 | 3300022179 | Freshwater Lake | RRKLYAMMDRIQKARGKTVGKGKVAKNSRADKYLPA |
Ga0181353_10738921 | 3300022179 | Freshwater Lake | TEAGARKLYAMMDRVQKARKKTVGKGKVAANSRSAKYLPA |
Ga0181353_11026471 | 3300022179 | Freshwater Lake | GSTQAGARKLYAMMDKVQRARRATVGKGKVAKNTRADKYLPA |
Ga0181353_11130171 | 3300022179 | Freshwater Lake | TEAGARKLYAMMDRIQSARGKTTGKGKVAKNTRSEKYLPA |
Ga0181353_11461451 | 3300022179 | Freshwater Lake | ELGNGSTEAGARKLYAMMDRIQKARGKTVGKDRVAVNSRADKNLPA |
Ga0181353_11648152 | 3300022179 | Freshwater Lake | GSTEAGARKLYAMMDRVQKARGKTTGKNKVAANTRADKYLPA |
Ga0181354_10273621 | 3300022190 | Freshwater Lake | GNGSTEAGARKLYAMMDRVQKGRGKSVGKGKVAVNSKADKYLPA |
Ga0181354_10275803 | 3300022190 | Freshwater Lake | AGARKLYAMMERVQKRRGKTTGKGKVAVNSKADKHLPA |
Ga0181354_10970903 | 3300022190 | Freshwater Lake | GARKLYAMMDRIQASRKKTVGKGKVAKNTRAEKYLPR |
Ga0181354_11145653 | 3300022190 | Freshwater Lake | ARKLYAMMDRVQKARRKTVGKGKVAVNSKAENTLPA |
Ga0181354_11459402 | 3300022190 | Freshwater Lake | ARKLYAMMDRVQRARAKTTGKGKVAKNTKSEQYLPA |
Ga0181354_12072931 | 3300022190 | Freshwater Lake | LGNGSTEAGARKLYAMMDRVQKARKKTVGKGKVAANSRSSKYLPA |
Ga0181354_12109802 | 3300022190 | Freshwater Lake | AGAKKLYAMLDRVQRARGKTTGRNKVAANSRADKYLPA |
Ga0181354_12364382 | 3300022190 | Freshwater Lake | NGSTEAGAKKLYAMMDRVQKARGKTTGKNKVAANSRADKYLPA |
Ga0181354_12539092 | 3300022190 | Freshwater Lake | LGNGSTEAGARKLYAMMDRVQASRKKTVGKNKVAHNNKAEKYLPA |
Ga0181351_10022401 | 3300022407 | Freshwater Lake | KKLYDMMDRVQRARGKTTGKNKVAANSRSDKYLPA |
Ga0181351_10051721 | 3300022407 | Freshwater Lake | EAGARKLYAMMDRIQKVRGKTTGKDAVAKNSRAEKHLPA |
Ga0181351_10398211 | 3300022407 | Freshwater Lake | IGNGSTDAGARKLYAMMDRIQKGRRKTVGRGKVAVNSRADRYLPA |
Ga0181351_10441813 | 3300022407 | Freshwater Lake | IGNGSTEAGARKLYAMMDRIQTGRKKTVGRGKVAVNSRADRYLPA |
Ga0181351_10454001 | 3300022407 | Freshwater Lake | ELGNGSTEAGARKLYAMMDRVQKARKKTVGKGKVAANSRSAKYLPA |
Ga0181351_10838111 | 3300022407 | Freshwater Lake | RIVSELGNGSTDAGAKKLYAMLDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0181351_10870921 | 3300022407 | Freshwater Lake | AGAKKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0181351_10911312 | 3300022407 | Freshwater Lake | DAGAKKLYAMMDRVQRARGKTTGKNKVAANSRSDKYLPA |
Ga0181351_12183041 | 3300022407 | Freshwater Lake | VPARIVSELGNGSTEAGAKKLYAMLDRVQRARGKTTGRNKVAANSRADKYLPA |
Ga0181351_12369172 | 3300022407 | Freshwater Lake | GSTEAGARQLYAMMDRVQKARKKTVGKDKVATNSRAARLLPA |
Ga0248169_1063291 | 3300022602 | Freshwater | ARQLYKMMDRIQNARRKTTGKDAVATNTNASKYLPA |
Ga0255773_101969651 | 3300022925 | Salt Marsh | AGARKLYAMMDRIQKARGKTVGKGKVAKNSQAEKHLPA |
Ga0255752_102275433 | 3300022929 | Salt Marsh | EAGARKLYAMMDRIQAARGKTVGKGRVAKNSRSEKYLPA |
Ga0214923_103845103 | 3300023179 | Freshwater | IVSELGNGSTDAGARKLYGMMDRIQKKRKKSVKGKSFAIDSKADEALPA |
Ga0222683_10574421 | 3300023251 | Saline Water | TDAGAQALYKMMDRVQNARRKTMGKDNVAVDTRSTRYLPA |
Ga0256681_107243923 | 3300023311 | Freshwater | NGSTEAGARKLYAMMDRVQKARSKTTGKKQVAKNTRADKYLPA |
Ga0255205_10445063 | 3300024276 | Freshwater | ARIVSELGNGSTDAGAKRLYAMMERVQSGRKKSVGKDKVAVDSKSYKHLPA |
Ga0255147_10765142 | 3300024289 | Freshwater | RIVSELGNGSTDAGARQLYKMMDRVQSARGKTVGKGRVAKDTKASKYLPA |
Ga0255148_10529841 | 3300024306 | Freshwater | STDAGARELYSMMDRVQKARGKTTGKGRVAKDTNASKYLPA |
Ga0244775_104006351 | 3300024346 | Estuarine | AGAQKLYAMMDRVQKARRKTKNVAADTKAHKYLPS |
Ga0255171_10567933 | 3300024354 | Freshwater | EAGARKLYAMMERVQASRKKSMGKKKVAVNSKADKHLPA |
Ga0255151_10477661 | 3300024496 | Freshwater | ARIVSELGNGSTEAGARKLYAMMERIQNTRKKSIGKKKVAVNSRADKHLPA |
Ga0256341_10535242 | 3300024556 | Freshwater | GNGSTEAGARKLYAMMERIQKSRGKTVGKNKVAVNSKADKHLPA |
Ga0208504_10210041 | 3300025358 | Freshwater | VSELGNGSTEAGARQLYKMMDRIQTARRKTTGKDAVATNTNAHQYLPA |
Ga0208504_10221323 | 3300025358 | Freshwater | SELGNGSTEAGARKLYAMMERVQKVRGKTTGKDKVATNTHADKHLPA |
Ga0208256_10177162 | 3300025382 | Freshwater | EAGARQLYKMMDRIQTARRKTTGKDAVATNTNAHKYLPA |
Ga0208257_10218722 | 3300025389 | Freshwater | STEAGARQLYKMMDRIQNARSKTVGKDRVATNTNANQYLPA |
Ga0208257_10456562 | 3300025389 | Freshwater | STEAGARQLYKMMSRIQHARSKTTGKDAVANNTNSAQYLPA |
Ga0207955_10027211 | 3300025401 | Freshwater | RIVSELGNGSTEAGARKLYQMMDRIQKNRAHSVGDNKVAVNSHSEKFLPA |
Ga0208877_10583791 | 3300025416 | Freshwater | TEAGARQLYKMMDRIQQARRKTTGKDAVATNTNASKYLPA |
Ga0208111_10283241 | 3300025420 | Freshwater | TEAGARKLYAMMERVQKVRGKTTGKDKVATNTHADKHLPA |
Ga0207958_10426022 | 3300025421 | Freshwater | IVSELGNGSTEAGARELYKMMARIQQARAKTTGKDAVAVNTNAHKYLPV |
Ga0208500_10084461 | 3300025429 | Freshwater | GSTDAGARKLYDMLDRIQRARGESVGKGKVAKNTKADRYLPA |
Ga0208742_10178341 | 3300025437 | Freshwater | NGSTEAGARQLYKMMDRIQSARQKTVGKDRVATNTNASKYLPA |
Ga0208376_10505262 | 3300025455 | Freshwater | VSELGNGSTEAGARRLYQMMDRVQSARKKSIGKDRVATDSRASKYLPA |
Ga0208497_10061661 | 3300025466 | Freshwater | ARQLYAMMDRIQKSRGKTIGKNKVATDTKAAKHLPA |
Ga0208497_10725281 | 3300025466 | Freshwater | ARQLYKMMSRIQKARSKTTGKDAVATDTNAHQYLPA |
Ga0208379_10023321 | 3300025598 | Freshwater | VVPARIVSELGNGSTEAGARELYKMMARIQQARAKTTGKDAVAVNTNAHKYLPV |
Ga0208379_10097174 | 3300025598 | Freshwater | SSDAGARKLYAMMEKIQHARKKTVKNVAADTKAEQYLPT |
Ga0208379_11478641 | 3300025598 | Freshwater | EAGARQLYKMMDRIQNARRKTTGKDAVATNTNASKYLPA |
Ga0208613_11214481 | 3300025616 | Freshwater | VVPARIVSELGNGSTEAGARKLYQMMDRVQNARKKTTGKQQVAANPRAEQYLPA |
Ga0208258_10324022 | 3300025783 | Freshwater | STEACARQLYKMMDRIQKARSKTVGKDRVAANTNAHQYLPA |
Ga0208498_10231582 | 3300025785 | Freshwater | DAGARKLYAMMEKIQHARKKTVKNVAADTKAEKYLPA |
Ga0208872_12088092 | 3300025838 | Freshwater | SELGNGSTEAGARKLYQMMDRIQKNRAHSVGDNKVAVNSHSEKFLPA |
Ga0208644_10490031 | 3300025889 | Aqueous | IVSELGNGSTEAGARKLYAMLDRVQSARKKSIGKGKVANNSRADKYLPA |
Ga0208644_10737211 | 3300025889 | Aqueous | AGAKRLYAMMERVQRARRKTTGKNKVAVDNKPDKLLPA |
Ga0208644_12993363 | 3300025889 | Aqueous | ARKLYAMMDRVQKNRAKTVGKNKVAVDSRSDKLLPA |
Ga0255099_10129601 | 3300027128 | Freshwater | SELGNGSTEAGARKLYAMMERVQASRKKSIGKKKVAVNSKSDKHLPA |
Ga0255154_10074004 | 3300027467 | Freshwater | DAGARQLYKMMDRVQSARGKTVGKGRVAKDTKASKYLPA |
Ga0255091_10663322 | 3300027487 | Freshwater | ARIVSELGNGSTEAGARKLYAMMERVQASRKKSIGKKKVAVNSKSDKHLPA |
Ga0209552_11302791 | 3300027563 | Freshwater Lake | NGSTEAGARKLYAMMDRVQKARRKTVGNGKVANNPRADKYLPA |
Ga0255120_10548203 | 3300027594 | Freshwater | GSTEAGARKLYQMMERIQADRKKSIGKGKVAVNSKAAKHLPK |
Ga0208974_11279903 | 3300027608 | Freshwater Lentic | GSTEAGARKLYAMMDRIQKARGKTVGKGKVAKNSRSEKYLPA |
Ga0208975_10838571 | 3300027659 | Freshwater Lentic | VSELGNGSTEAGARKLYAMMERVQANRKKSIGKKKVAVNSKADKHLPA |
Ga0208975_11077753 | 3300027659 | Freshwater Lentic | TDAGAKKLYAMMQRVQQARGKTVGRGKVAVNSRAEKLLPA |
Ga0209704_10731473 | 3300027693 | Freshwater Sediment | GNGSTEAGARKLYAMMDRVQKSRGKTVGKGKVATNSRAEKHLPA |
Ga0209443_10181414 | 3300027707 | Freshwater Lake | ARKLYAMMDRVQKARGKTVGKGKVAANSRSAKYLPA |
Ga0209188_11830661 | 3300027708 | Freshwater Lake | GAKKLYAMMDRVQSARGKTTGKNKVAANSRSDKYLPA |
Ga0209499_13372971 | 3300027712 | Freshwater Lake | LGNGSTEAGARKLYAMLDRVQSARGKTVGKGRVAKNSRADKYLPA |
Ga0209492_12280042 | 3300027721 | Freshwater Sediment | AGARALQAMVDKIQHRRKKSIGKGKVAVDSKARKGLLA |
Ga0209442_11899703 | 3300027732 | Freshwater Lake | GAKKLYAMMQRVQQARGRTVGRGKVAVNSRAEKLLPA |
Ga0209297_12486562 | 3300027733 | Freshwater Lake | EAGARKLYAMMDRVQKARGKTLKNVAANSRADKYLPA |
Ga0209087_11680122 | 3300027734 | Freshwater Lake | AKKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0209190_12302292 | 3300027736 | Freshwater Lake | GARKLYAMMDRIQSARGGTVGKGRVAKNSRAEKYLPA |
Ga0209085_12296052 | 3300027741 | Freshwater Lake | RIVSEIGNGSTEAGARKLYQMMDRVQNARAKTTGKGRVAKDTNASKYLPV |
Ga0209085_13872382 | 3300027741 | Freshwater Lake | AGARKLYAMMDRVQGARASTVGKGKVAKNSKADKHLPA |
Ga0209189_10519043 | 3300027747 | Freshwater Lake | EIGNGSTEAGARKLYQMMDRVQNARAKTTGKGRVAKDTNASKYLPV |
Ga0209084_10395223 | 3300027749 | Freshwater Lake | VIPARIVSEIGNGSTDAGARELYKMMDRIQAGRAKTVGKDKVATNTKAVRHLPA |
Ga0209444_103161371 | 3300027756 | Freshwater Lake | STEAGAKQLYAMMDRIQRARRKTTGKKQVAKNTKAHKLMPA |
Ga0209444_103196421 | 3300027756 | Freshwater Lake | SELGNGSTEAGARKLYAMMERVQKRRGKTTGKGKVAVNSKADKHLPA |
Ga0209088_100328261 | 3300027763 | Freshwater Lake | GARKLYAMMDRVQRARRGTVGKGRVAKNSRAEQYLPA |
Ga0209829_100312344 | 3300027777 | Freshwater Lake | GSTEAGARKLYAMMDRVQKARRQTIGKGNVAVNSRADKMLPA |
Ga0209829_103460131 | 3300027777 | Freshwater Lake | NGSTEAGARKLYAMMDRIQAARGKTVGKGRVAKNSRSEKYLPA |
Ga0209500_101696111 | 3300027782 | Freshwater Lake | IPARIVSELGNGSTEAGARKLYAMMERIQAGRRKTIGKNRVAANSRADRHLPV |
Ga0209500_102216892 | 3300027782 | Freshwater Lake | STEAGARKLYAMMDRVQKARSQTVGKGKIARNTRADKYLPV |
Ga0209500_104160871 | 3300027782 | Freshwater Lake | STEAGARKLYAMMDRVQGARASTVGKGKVAKNSKADKHLPA |
Ga0209246_102339031 | 3300027785 | Freshwater Lake | EAGAKKLYAMMDRVQKARRKTKNVAADTKAHKHLPA |
Ga0209246_102735732 | 3300027785 | Freshwater Lake | IVSELGNGSTEAGARQLYAMMDRIQAGRKKTVGKNKTAVNSRSVRHLPA |
Ga0209246_103170241 | 3300027785 | Freshwater Lake | IVSELGNGSTEAGARALYKMMDRIQANRRKTTGKNRVAVNSKSHKYLPA |
Ga0209246_103703912 | 3300027785 | Freshwater Lake | GAKKLYAMMDRVQRARRKTTGKNKVAANSRADKYLPA |
Ga0209107_103728851 | 3300027797 | Freshwater And Sediment | SELGNGSTEAGARKLYAMMDRVQKARRGTVGKGRVAKNSRSEKYLPA |
Ga0209353_100059201 | 3300027798 | Freshwater Lake | GNGSTEAGARKLYAMMDRVQKARGKTMGKGKVAANSRSSKYLPA |
Ga0209353_101585771 | 3300027798 | Freshwater Lake | VIPARIVSELGNGSTDAGARELYKMMARIQAGRAKTVGKNKTAVNSKSARHLPA |
Ga0209229_100650081 | 3300027805 | Freshwater And Sediment | DAGAKKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0209354_100501343 | 3300027808 | Freshwater Lake | EAGARKLYAMMDRIQKARKKTVGKGKVAKNSRSEKYLPA |
Ga0209354_102015962 | 3300027808 | Freshwater Lake | GNGSTEAGARQLYAMMDRIQAGRKKTVGKNKTAVNSRSVRHLPA |
Ga0209354_102441601 | 3300027808 | Freshwater Lake | STEAGARKLYAMMDRIQRARSKTVGKGKVAKNTRTEKYLPA |
Ga0209354_103141481 | 3300027808 | Freshwater Lake | GNGSTDAGAKKLYAMMQRVQQARGRTVGRGKVAVNSRAEKLLPA |
Ga0209990_100069054 | 3300027816 | Freshwater Lake | IVSELGNGSTEAGAKKLYAMLDRIQAARSKTVGKGKVAKDSKAENMLPA |
Ga0209990_101596791 | 3300027816 | Freshwater Lake | RIVSELGNGSTEAGARKLYAMLDRVQSARKKSIGKGKVAKDSRADKLLPA |
Ga0209990_104806981 | 3300027816 | Freshwater Lake | TNAGARKLYAMMDRVQNARKKTTGKNKVAANPRADKYLPA |
Ga0209550_104969252 | 3300027892 | Freshwater Lake | ARKLYAMMDRVQKARRSTVGKGKVAKNSRSDKYLPA |
Ga0209550_107936751 | 3300027892 | Freshwater Lake | NGSTEAGARKLYAMMDRVQKARRGTVGKGRVAKNSRSEKYLPA |
Ga0209636_102003501 | 3300027893 | Marine Sediment | GAKRLYAMMDRVQKARQKTTGKDKVAVNTNPNRLLPA |
Ga0209777_105941091 | 3300027896 | Freshwater Lake Sediment | NGSTEAGARQLYKMMDRIQNARRKTTGRDAVATNTNAHKYLPA |
Ga0209820_10776311 | 3300027956 | Freshwater Sediment | VSELGNGSTDAGAKRLYGMMDRVQKNRSKTVGKGKVAVDSKARKMLPA |
Ga0209401_11068872 | 3300027971 | Freshwater Lake | PARIVSELGNGSTEAGARALYKMMDRIQANRRKTTGKNSVAVDSKAHKYLPA |
Ga0209702_102669201 | 3300027976 | Freshwater | GEFVFPARIVSELGNGSTEAGARQLYKMMARIQAGRKKTTGKDSVAVDSRAAAHLEA |
(restricted) Ga0247838_11051903 | 3300028044 | Freshwater | GARQLYAMMNRVQARRGKTTGKNRVAVDSKARKLLPA |
Ga0255174_10487852 | 3300028275 | Freshwater | TDAGARKLYAMMDRIQNARKKSVGKGKVAVNSRADKNLPA |
Ga0304730_12724882 | 3300028394 | Freshwater Lake | RKLYAMMDRVQAARGRTTGKSRVAANTRADKHLPA |
(restricted) Ga0247843_10842353 | 3300028569 | Freshwater | EAGARKLYAMMDRIQKARRGTVGKGRVAKNSRSDKYLPA |
Ga0302324_1024590982 | 3300031236 | Palsa | FVFPARHVSELGNGSTEAGSKKLYAMLDRIQAGRRKSIGKSKGSIDSGMDKELPA |
Ga0307380_112934821 | 3300031539 | Soil | ELGNGSTEAGARKLYAMMDRIQKGRRKSVGKGKVAVDSKASKHLPA |
Ga0307378_105855661 | 3300031566 | Soil | ARQLYAMMDRVQKARNKTVGKGKVAVNSKSAKALPA |
Ga0307378_112716102 | 3300031566 | Soil | EAGARKLYAMMERVQKGRRKSVGKGKVAVNSKADKHLPA |
Ga0307377_106752891 | 3300031673 | Soil | ARKLYAMMERVQKGRRKSVGKGKVAVNSKADKHLPA |
Ga0315291_105529821 | 3300031707 | Sediment | GSTDAGARKLYAMMDRIQKNRSKTVGKGKVAANTRSDKQLPK |
Ga0315291_113446562 | 3300031707 | Sediment | SELGNGSTEAGARALYKMMARIQANRRKTTGRTRVAVDSKSHKYLPA |
Ga0315293_102306561 | 3300031746 | Sediment | SSEAGAIILQKMVNRVQARRKKSIGKGKVAVDSKANEELPA |
Ga0315293_108685273 | 3300031746 | Sediment | AGARKLYAMMDRIQKARGKTVGKNKVAKNSRSEKYLPA |
Ga0315907_109829171 | 3300031758 | Freshwater | EAGARKLYAMMNRVQAARGKTTGKGRVAKNTRAEKYLPA |
Ga0315288_100608464 | 3300031772 | Sediment | RKLYAMMDRVQKSRKKSIGKNKVAHNNRSEKYLPA |
Ga0315288_111358273 | 3300031772 | Sediment | EAGARKLYAMMDRIQSARGKTVGKGKVAKNSRSEKHLPA |
Ga0315288_112463882 | 3300031772 | Sediment | IGNGSTEAGAKKLYAMMDRVQGARKKSIKNVAANTKADKYLPS |
Ga0315900_106285691 | 3300031787 | Freshwater | EAGARKLYAMMDRVQAARKGSIGKGKVAKNSRADKYLPA |
Ga0315909_103791633 | 3300031857 | Freshwater | ELGNGSTEAGARKLYAMLDRIQAGRKKTVGKGKVATNSRSDKNLPA |
Ga0315909_106141222 | 3300031857 | Freshwater | STDAGAKKLYAMMDRVQNARKKTTKNVAANTKAARFLPR |
Ga0315909_107701901 | 3300031857 | Freshwater | AGARKLYAMMDRIQSARGKTVGKGKVAKNSRAERLLPA |
Ga0315909_109225102 | 3300031857 | Freshwater | GSTDAGAKKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0315285_103950483 | 3300031885 | Sediment | GSTDAGAKALEAMMARVQKRRSKTVGKGKVAVDSKARKELLA |
Ga0315294_106587442 | 3300031952 | Sediment | STEAGAKKLYAMMDRVQNVRKKSFKNVAANTKADKYLPR |
Ga0315274_105708171 | 3300031999 | Sediment | AGARELQGMMDRVQKRRKKTVGKGNIAVDSKARKVLPV |
Ga0315274_108878671 | 3300031999 | Sediment | PARIVSEIGNGSTDAGARKLYAMMNRIQKARGKTLKNVAANTKADKHLPA |
Ga0315274_109140811 | 3300031999 | Sediment | GSTDAGARKLYAMMDRIQKNRSKTVGKGKVAANTRSDKQLPR |
Ga0315274_121064432 | 3300031999 | Sediment | GARKLYAMMDRVQRARGKTTGKDRVAANTSADKYLPA |
Ga0315906_110190413 | 3300032050 | Freshwater | RKLYAMMDRVQKARKKSVGKNKVAVNSKADKYLPA |
Ga0315284_107588463 | 3300032053 | Sediment | SEIGNGSTDAGANRLQGMVDRVQTARKGTTGKGKIAADTKPERMLLA |
Ga0315902_112362512 | 3300032093 | Freshwater | TEAGARKLYAMMDRVQRARAKTTGKGKVAKNTKSEQYLPA |
Ga0315903_101695383 | 3300032116 | Freshwater | PARIVSELGNGSTEAGARKLYAMMARIQSARGKTVGKNKVAKNSRSERFLPA |
Ga0315277_102587903 | 3300032118 | Sediment | EAGARELQGMMDRVQKRRKKTVGKGKIAVDSKARKVLPA |
Ga0315277_116833772 | 3300032118 | Sediment | STEAGAKALQAMVDRVQARRSKTVGKGKVAVNSKARKGLPA |
Ga0315268_105729602 | 3300032173 | Sediment | IVSELGNGSTEAGARALYKMMARIQANRRKTTGRTRVAVDSKSHKYLPA |
Ga0315271_102410731 | 3300032256 | Sediment | ELGNGSTEAGARKLYAMMDRVQKSRKKSIGKNKVAHNNRSEKYLPA |
Ga0315275_122122081 | 3300032401 | Sediment | GSSEAGAIILQKMVNRVQARRKKSIGKGKVAVDSKANEELPA |
Ga0315273_119372562 | 3300032516 | Sediment | GSTEAGARKLYQMMDRVQHNRRKSIGKGRVATNSRSDKFLPA |
Ga0316232_12637301 | 3300032605 | Freshwater | RQLYKMMDRIQTARRKTTGKDAVATNTNTHQYLPA |
Ga0316221_11277832 | 3300032665 | Freshwater | GARKLYAMMERIQHARKKTTENVAADTKAEKYLPK |
Ga0316225_10636043 | 3300032675 | Freshwater | ELGNGSTEAGARQLYKMMDRIQTARRKTTGKDAVATNTNTHQYLPA |
Ga0316225_12735141 | 3300032675 | Freshwater | EIGNGSTDAGAKHLYKMMDNVQKRRSKTIGKGNVAVDSGAHKELNRL |
Ga0316229_11271612 | 3300032676 | Freshwater | SELGNGSTEAGARQLYKMMDRIQTARRKTTGKDAVATNTNTHQYLPA |
Ga0316616_1006579543 | 3300033521 | Soil | GNGSSEAGARKLYAMMDRVQNTRKKSVGKGKVAVDSKAEKHLPA |
Ga0334982_0117187_1277_1387 | 3300033981 | Freshwater | ARKLYAMMDRIQENRKKTIGEDNVAVDSRSDRFLPA |
Ga0334982_0454571_3_122 | 3300033981 | Freshwater | EAGARKLYAMMDRVQAARRKSIGKGKVAKNSRADKYLPA |
Ga0334994_0098029_1_114 | 3300033993 | Freshwater | GARKLYAMLARIQAGRKKSVGRGKVAVNSRMDKHLPA |
Ga0334979_0379034_632_784 | 3300033996 | Freshwater | RIVSELGNGSTEAGARKLYAMMERVQATRKKSIGKKKVAVNSKADKHLPA |
Ga0334979_0545629_505_621 | 3300033996 | Freshwater | AGARKLYAMMDRVQKARRKTVGKNKVAANTKADRHLPA |
Ga0334979_0587734_416_577 | 3300033996 | Freshwater | VPARIVSELGNGSTDAGAKKLYAMLDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0334986_0197952_1011_1124 | 3300034012 | Freshwater | GARKLYAMMDRVQRARGKTTGKGKVAKNTRSDKYLPA |
Ga0334998_0551853_2_130 | 3300034019 | Freshwater | GSTEAGARKLYAMMDRVQRARGKTTGKGKVAKDTRSDKYLPA |
Ga0334998_0590822_475_606 | 3300034019 | Freshwater | NGSTEAGARKLYAMMDRIQENRKKTIGEDNVAVDSRSDRFLPA |
Ga0335002_0685363_271_432 | 3300034020 | Freshwater | MPARIVSELGNGSTEAGARKLYAMMERVQRARSKTVGRGKVAVNSRSEKMLPA |
Ga0334987_0236508_1139_1255 | 3300034061 | Freshwater | AGARKLYAMMDRVQKARGKTVGKGRVARNTRADKYLPA |
Ga0335020_0151010_1_138 | 3300034082 | Freshwater | LGNGSTEAGARKLYAMLARIQAGRKKSIGRNKVAVNSRMDKHLPA |
Ga0335012_0486607_464_586 | 3300034093 | Freshwater | TEAGARKLYAMLDRVQAGRKKSIGKGKVAANSRAYKNLPA |
Ga0335012_0500736_2_109 | 3300034093 | Freshwater | KKLYAMMDRVQRARGKTTGKNKVAANSRADKYLPA |
Ga0335012_0584537_2_130 | 3300034093 | Freshwater | GSTEAGAKKLYAMMARVQRARGKTTGKNKVAANSRADKYLPA |
Ga0335029_0173925_1313_1453 | 3300034102 | Freshwater | EIGNGSTDAGARKLYAMMERVQRARKKTVGRGRVAVKSGADNMLPA |
Ga0335029_0484047_30_167 | 3300034102 | Freshwater | LGNGSTEAGARKLYAMMERVQKSRKKSIGKKKVAVNSKADKHLPA |
Ga0335031_0084756_2_133 | 3300034104 | Freshwater | NGSSEAGAKRLYAMMDRVQNDREKSIGDGKVAVDSKAYRHLLA |
Ga0335031_0160029_1444_1551 | 3300034104 | Freshwater | RKLYAMMDRVQRARGKTTGKNRVAANSRADKHLPA |
Ga0335031_0368850_3_131 | 3300034104 | Freshwater | GSTEAGARKLYAMMDRIQKGRKKSIGKGRVAVNSRADKNLPA |
Ga0335036_0754529_460_567 | 3300034106 | Freshwater | RKLYAMMDRIQKARGKTVGKGKVAKNSRSEKHLPA |
Ga0335066_0334881_718_843 | 3300034112 | Freshwater | STVAGARKLYKMMDRIQAARGKTVGKGRVAKNSRAEKHLPA |
Ga0335053_0491559_580_717 | 3300034118 | Freshwater | LGNGSTEAGARKLYAMMDRVQKNRGKTVGKGKVAVDSRSEKLLPA |
Ga0335056_0101799_1640_1765 | 3300034120 | Freshwater | STEAGAKKLYAMMARVQRARGKTTGKNKVAANSRADKYLPA |
Ga0335056_0319850_738_854 | 3300034120 | Freshwater | AGARKLYAMMDRIQENRKKTIGEDNVAVDSRSDRFLPA |
Ga0335060_0225040_924_1055 | 3300034122 | Freshwater | NGSTEAGARKLYAMMDRVQKARRGTVGKGRVAKNSRSDKYLPA |
Ga0335007_0492443_9_146 | 3300034283 | Freshwater | LGNGSTEAGARKLYQMMERVQADRKKSIGKGKVAVNSKATKHLPK |
Ga0335007_0802769_361_498 | 3300034283 | Freshwater | LGNGSTEAGARKLYAMMDRVQKNRNKTVGKGRVAVDSRSEKLLPA |
Ga0348335_054575_3_131 | 3300034374 | Aqueous | GSTEAGARQLYAMIDRIQKARRKSMGKGKIAKDTKARKLLPA |
⦗Top⦘ |