Basic Information | |
---|---|
Family ID | F002847 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 526 |
Average Sequence Length | 42 residues |
Representative Sequence | VINALQLALAIILLGAVIWVGDAIAGGIDSALGEKKMRDRDA |
Number of Associated Samples | 230 |
Number of Associated Scaffolds | 524 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 76.81 % |
% of genes near scaffold ends (potentially truncated) | 24.90 % |
% of genes from short scaffolds (< 2000 bps) | 83.46 % |
Associated GOLD sequencing projects | 190 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.616 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (15.399 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.958 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.027 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 524 Family Scaffolds |
---|---|---|
PF07883 | Cupin_2 | 23.47 |
PF01212 | Beta_elim_lyase | 12.60 |
PF16188 | Peptidase_M24_C | 6.11 |
PF00903 | Glyoxalase | 4.20 |
PF12681 | Glyoxalase_2 | 4.01 |
PF05721 | PhyH | 3.05 |
PF00557 | Peptidase_M24 | 2.67 |
PF13640 | 2OG-FeII_Oxy_3 | 2.48 |
PF04116 | FA_hydroxylase | 2.48 |
PF16189 | Creatinase_N_2 | 2.10 |
PF10399 | UCR_Fe-S_N | 1.72 |
PF08818 | DUF1801 | 1.34 |
PF00892 | EamA | 0.76 |
PF13619 | KTSC | 0.76 |
PF01321 | Creatinase_N | 0.57 |
PF01925 | TauE | 0.38 |
PF00106 | adh_short | 0.38 |
PF05899 | Cupin_3 | 0.38 |
PF06348 | DUF1059 | 0.38 |
PF02897 | Peptidase_S9_N | 0.38 |
PF03171 | 2OG-FeII_Oxy | 0.38 |
PF04365 | BrnT_toxin | 0.19 |
PF00583 | Acetyltransf_1 | 0.19 |
PF08546 | ApbA_C | 0.19 |
PF00440 | TetR_N | 0.19 |
PF13305 | TetR_C_33 | 0.19 |
PF07715 | Plug | 0.19 |
PF14559 | TPR_19 | 0.19 |
PF08327 | AHSA1 | 0.19 |
PF13185 | GAF_2 | 0.19 |
PF00082 | Peptidase_S8 | 0.19 |
PF13601 | HTH_34 | 0.19 |
PF01433 | Peptidase_M1 | 0.19 |
PF12833 | HTH_18 | 0.19 |
PF13628 | DUF4142 | 0.19 |
COG ID | Name | Functional Category | % Frequency in 524 Family Scaffolds |
---|---|---|---|
COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 25.19 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 12.60 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 12.60 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 12.60 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 12.60 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 12.60 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 12.60 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 12.60 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 12.60 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 12.60 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 12.60 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 12.60 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 12.60 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 12.60 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 12.60 |
COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 12.60 |
COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 12.60 |
COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.05 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 2.48 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.34 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.34 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.34 |
COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.57 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.38 |
COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.38 |
COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.38 |
COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.19 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.19 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.19 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.62 % |
Unclassified | root | N/A | 23.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886012|MBSR1b_contig_6897962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 841 | Open in IMG/M |
2199352024|deeps__Contig_157774 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
2199352024|deeps__Contig_95278 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_102012152 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_102015430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1484 | Open in IMG/M |
3300000651|AP72_2010_repI_A10DRAFT_1013754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter | 1045 | Open in IMG/M |
3300001431|F14TB_108480915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
3300001686|C688J18823_10126064 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300001979|JGI24740J21852_10020196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2328 | Open in IMG/M |
3300001979|JGI24740J21852_10172946 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 536 | Open in IMG/M |
3300001990|JGI24737J22298_10014124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2594 | Open in IMG/M |
3300001990|JGI24737J22298_10053278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1226 | Open in IMG/M |
3300001991|JGI24743J22301_10056335 | Not Available | 806 | Open in IMG/M |
3300002067|JGI24735J21928_10028972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1651 | Open in IMG/M |
3300002568|C688J35102_118099739 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300002568|C688J35102_119659389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 742 | Open in IMG/M |
3300002568|C688J35102_120307343 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300002568|C688J35102_120676788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1336 | Open in IMG/M |
3300002568|C688J35102_120802248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lupini | 1624 | Open in IMG/M |
3300002568|C688J35102_120813996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1665 | Open in IMG/M |
3300002568|C688J35102_120986527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 6746 | Open in IMG/M |
3300002568|C688J35102_120988085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 8189 | Open in IMG/M |
3300003324|soilH2_10020238 | Not Available | 1612 | Open in IMG/M |
3300003324|soilH2_10039191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1420 | Open in IMG/M |
3300003324|soilH2_10097148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1139 | Open in IMG/M |
3300003324|soilH2_10166724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2076 | Open in IMG/M |
3300003848|Ga0058694_1019434 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1167 | Open in IMG/M |
3300004081|Ga0063454_101194615 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 629 | Open in IMG/M |
3300004081|Ga0063454_101389903 | Not Available | 594 | Open in IMG/M |
3300004114|Ga0062593_101223332 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300004114|Ga0062593_102353056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 600 | Open in IMG/M |
3300004156|Ga0062589_101818201 | Not Available | 612 | Open in IMG/M |
3300004157|Ga0062590_100705033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 910 | Open in IMG/M |
3300004463|Ga0063356_101081500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1154 | Open in IMG/M |
3300004463|Ga0063356_101776534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 925 | Open in IMG/M |
3300004463|Ga0063356_102140455 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300004463|Ga0063356_102749965 | Not Available | 757 | Open in IMG/M |
3300004463|Ga0063356_105914905 | Not Available | 525 | Open in IMG/M |
3300004479|Ga0062595_100442442 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 951 | Open in IMG/M |
3300005093|Ga0062594_101050251 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 790 | Open in IMG/M |
3300005093|Ga0062594_101142710 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 766 | Open in IMG/M |
3300005093|Ga0062594_101304262 | Not Available | 729 | Open in IMG/M |
3300005163|Ga0066823_10002206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2331 | Open in IMG/M |
3300005163|Ga0066823_10038808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 821 | Open in IMG/M |
3300005165|Ga0066869_10007478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1414 | Open in IMG/M |
3300005168|Ga0066809_10110889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 680 | Open in IMG/M |
3300005174|Ga0066680_10914989 | Not Available | 519 | Open in IMG/M |
3300005177|Ga0066690_10651250 | Not Available | 701 | Open in IMG/M |
3300005177|Ga0066690_11017263 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005179|Ga0066684_11100106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 508 | Open in IMG/M |
3300005181|Ga0066678_10868206 | Not Available | 592 | Open in IMG/M |
3300005184|Ga0066671_10260527 | Not Available | 1072 | Open in IMG/M |
3300005258|Ga0074071_1033895 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300005260|Ga0074072_1046541 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300005290|Ga0065712_10196524 | Not Available | 1122 | Open in IMG/M |
3300005293|Ga0065715_10056012 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300005327|Ga0070658_10011125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 7215 | Open in IMG/M |
3300005327|Ga0070658_10022825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 5021 | Open in IMG/M |
3300005327|Ga0070658_10022864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 5018 | Open in IMG/M |
3300005327|Ga0070658_10031385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4266 | Open in IMG/M |
3300005327|Ga0070658_10056961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 3178 | Open in IMG/M |
3300005327|Ga0070658_10062240 | Not Available | 3041 | Open in IMG/M |
3300005327|Ga0070658_10119063 | Not Available | 2193 | Open in IMG/M |
3300005327|Ga0070658_10202235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1676 | Open in IMG/M |
3300005327|Ga0070658_10377134 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1216 | Open in IMG/M |
3300005327|Ga0070658_10396930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1184 | Open in IMG/M |
3300005327|Ga0070658_10483680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sabuli | 1068 | Open in IMG/M |
3300005327|Ga0070658_10514709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1034 | Open in IMG/M |
3300005327|Ga0070658_10795688 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300005327|Ga0070658_10805274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 816 | Open in IMG/M |
3300005327|Ga0070658_10850318 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300005327|Ga0070658_10888627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 775 | Open in IMG/M |
3300005327|Ga0070658_10992163 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300005327|Ga0070658_10999438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 728 | Open in IMG/M |
3300005327|Ga0070658_11154482 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300005327|Ga0070658_11418521 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005327|Ga0070658_11794684 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005327|Ga0070658_11832660 | Not Available | 524 | Open in IMG/M |
3300005328|Ga0070676_10267118 | Not Available | 1148 | Open in IMG/M |
3300005328|Ga0070676_10506827 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300005328|Ga0070676_10950606 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
3300005329|Ga0070683_102196186 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005330|Ga0070690_100004857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 7507 | Open in IMG/M |
3300005330|Ga0070690_100018230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4236 | Open in IMG/M |
3300005331|Ga0070670_100871679 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300005331|Ga0070670_100894851 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300005331|Ga0070670_100906023 | Not Available | 799 | Open in IMG/M |
3300005331|Ga0070670_101566116 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 605 | Open in IMG/M |
3300005335|Ga0070666_10299722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1144 | Open in IMG/M |
3300005335|Ga0070666_10586183 | Not Available | 813 | Open in IMG/M |
3300005335|Ga0070666_10834881 | Not Available | 679 | Open in IMG/M |
3300005336|Ga0070680_100000406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 29408 | Open in IMG/M |
3300005336|Ga0070680_100002258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 14240 | Open in IMG/M |
3300005336|Ga0070680_100008960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 7670 | Open in IMG/M |
3300005336|Ga0070680_100826415 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
3300005339|Ga0070660_100227457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1517 | Open in IMG/M |
3300005339|Ga0070660_100393356 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300005339|Ga0070660_100507117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1004 | Open in IMG/M |
3300005339|Ga0070660_100941475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 729 | Open in IMG/M |
3300005339|Ga0070660_100960478 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300005339|Ga0070660_101408720 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 592 | Open in IMG/M |
3300005344|Ga0070661_100050829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3033 | Open in IMG/M |
3300005344|Ga0070661_100064703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2687 | Open in IMG/M |
3300005344|Ga0070661_100107910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2077 | Open in IMG/M |
3300005344|Ga0070661_100177012 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
3300005344|Ga0070661_100265696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1327 | Open in IMG/M |
3300005344|Ga0070661_100555104 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300005344|Ga0070661_101104923 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300005344|Ga0070661_101822804 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300005355|Ga0070671_100008660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 8163 | Open in IMG/M |
3300005355|Ga0070671_100642476 | Not Available | 918 | Open in IMG/M |
3300005355|Ga0070671_101485430 | Not Available | 599 | Open in IMG/M |
3300005355|Ga0070671_102080651 | Not Available | 506 | Open in IMG/M |
3300005356|Ga0070674_100248694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1395 | Open in IMG/M |
3300005356|Ga0070674_101621554 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300005366|Ga0070659_100267820 | Not Available | 1419 | Open in IMG/M |
3300005366|Ga0070659_100483874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1053 | Open in IMG/M |
3300005366|Ga0070659_100493107 | Not Available | 1043 | Open in IMG/M |
3300005366|Ga0070659_100529929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1006 | Open in IMG/M |
3300005367|Ga0070667_100079209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2808 | Open in IMG/M |
3300005434|Ga0070709_10044644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2746 | Open in IMG/M |
3300005434|Ga0070709_10442609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 978 | Open in IMG/M |
3300005435|Ga0070714_100168603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1986 | Open in IMG/M |
3300005435|Ga0070714_100274769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1563 | Open in IMG/M |
3300005435|Ga0070714_100275133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1563 | Open in IMG/M |
3300005435|Ga0070714_100276742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1558 | Open in IMG/M |
3300005435|Ga0070714_100280970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1546 | Open in IMG/M |
3300005435|Ga0070714_100477321 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
3300005435|Ga0070714_101336216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 700 | Open in IMG/M |
3300005436|Ga0070713_100036150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3983 | Open in IMG/M |
3300005436|Ga0070713_100543423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1100 | Open in IMG/M |
3300005438|Ga0070701_10903943 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
3300005454|Ga0066687_10150490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 1230 | Open in IMG/M |
3300005454|Ga0066687_10588779 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 661 | Open in IMG/M |
3300005454|Ga0066687_10994043 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005455|Ga0070663_100155748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1755 | Open in IMG/M |
3300005455|Ga0070663_100193391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1584 | Open in IMG/M |
3300005455|Ga0070663_100375669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1156 | Open in IMG/M |
3300005455|Ga0070663_100981519 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300005456|Ga0070678_100011928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 5380 | Open in IMG/M |
3300005456|Ga0070678_100818716 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300005457|Ga0070662_100550704 | Not Available | 966 | Open in IMG/M |
3300005458|Ga0070681_10318197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1465 | Open in IMG/M |
3300005458|Ga0070681_11319213 | Not Available | 644 | Open in IMG/M |
3300005529|Ga0070741_11047219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 697 | Open in IMG/M |
3300005532|Ga0070739_10022789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 5001 | Open in IMG/M |
3300005532|Ga0070739_10025935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 4520 | Open in IMG/M |
3300005532|Ga0070739_10066148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2219 | Open in IMG/M |
3300005534|Ga0070735_10390651 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300005535|Ga0070684_100736133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
3300005535|Ga0070684_101441809 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005535|Ga0070684_102345310 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 503 | Open in IMG/M |
3300005539|Ga0068853_100067254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3112 | Open in IMG/M |
3300005539|Ga0068853_101449158 | Not Available | 664 | Open in IMG/M |
3300005542|Ga0070732_10081072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1899 | Open in IMG/M |
3300005543|Ga0070672_100484338 | Not Available | 1068 | Open in IMG/M |
3300005543|Ga0070672_100619462 | Not Available | 944 | Open in IMG/M |
3300005544|Ga0070686_100147984 | Not Available | 1642 | Open in IMG/M |
3300005548|Ga0070665_100359211 | Not Available | 1462 | Open in IMG/M |
3300005548|Ga0070665_102020053 | Not Available | 582 | Open in IMG/M |
3300005563|Ga0068855_100095100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3434 | Open in IMG/M |
3300005563|Ga0068855_100441324 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1421 | Open in IMG/M |
3300005563|Ga0068855_100574325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1218 | Open in IMG/M |
3300005563|Ga0068855_102040179 | Not Available | 579 | Open in IMG/M |
3300005564|Ga0070664_100115995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2341 | Open in IMG/M |
3300005564|Ga0070664_100440244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1195 | Open in IMG/M |
3300005564|Ga0070664_100461898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1166 | Open in IMG/M |
3300005564|Ga0070664_101077907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 756 | Open in IMG/M |
3300005564|Ga0070664_101642357 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300005566|Ga0066693_10452881 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005568|Ga0066703_10506793 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300005575|Ga0066702_10011777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3948 | Open in IMG/M |
3300005575|Ga0066702_10124668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1500 | Open in IMG/M |
3300005575|Ga0066702_10772593 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
3300005576|Ga0066708_10079289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1910 | Open in IMG/M |
3300005577|Ga0068857_100023330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 5445 | Open in IMG/M |
3300005577|Ga0068857_102156503 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005578|Ga0068854_100137041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1875 | Open in IMG/M |
3300005578|Ga0068854_100230598 | Not Available | 1469 | Open in IMG/M |
3300005578|Ga0068854_100648195 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300005578|Ga0068854_101171094 | Not Available | 687 | Open in IMG/M |
3300005578|Ga0068854_101571226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
3300005578|Ga0068854_101671498 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 581 | Open in IMG/M |
3300005614|Ga0068856_100186798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2086 | Open in IMG/M |
3300005614|Ga0068856_100481897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1261 | Open in IMG/M |
3300005614|Ga0068856_101444929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 702 | Open in IMG/M |
3300005616|Ga0068852_100362163 | Not Available | 1419 | Open in IMG/M |
3300005718|Ga0068866_10179440 | Not Available | 1249 | Open in IMG/M |
3300005764|Ga0066903_106539745 | Not Available | 607 | Open in IMG/M |
3300005834|Ga0068851_10204410 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300005834|Ga0068851_10325829 | Not Available | 888 | Open in IMG/M |
3300005840|Ga0068870_10606273 | Not Available | 745 | Open in IMG/M |
3300005843|Ga0068860_102615309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
3300005985|Ga0081539_10013055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 6301 | Open in IMG/M |
3300005985|Ga0081539_10429782 | Not Available | 548 | Open in IMG/M |
3300006028|Ga0070717_10082833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2697 | Open in IMG/M |
3300006028|Ga0070717_10264412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1523 | Open in IMG/M |
3300006028|Ga0070717_11329733 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300006031|Ga0066651_10178134 | Not Available | 1121 | Open in IMG/M |
3300006031|Ga0066651_10241359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
3300006032|Ga0066696_10719678 | Not Available | 640 | Open in IMG/M |
3300006032|Ga0066696_10952562 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300006046|Ga0066652_100327767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1370 | Open in IMG/M |
3300006051|Ga0075364_10736817 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300006173|Ga0070716_101132314 | Not Available | 626 | Open in IMG/M |
3300006175|Ga0070712_100055025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2784 | Open in IMG/M |
3300006604|Ga0074060_11563245 | Not Available | 573 | Open in IMG/M |
3300006755|Ga0079222_11164254 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300006797|Ga0066659_11031313 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300006800|Ga0066660_10471937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1052 | Open in IMG/M |
3300006804|Ga0079221_10177363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1144 | Open in IMG/M |
3300006804|Ga0079221_10539476 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300006804|Ga0079221_10557275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
3300006806|Ga0079220_10546687 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300006881|Ga0068865_100135194 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1852 | Open in IMG/M |
3300006881|Ga0068865_101111289 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 697 | Open in IMG/M |
3300006953|Ga0074063_10047334 | Not Available | 858 | Open in IMG/M |
3300006954|Ga0079219_10975191 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 698 | Open in IMG/M |
3300006954|Ga0079219_10975191 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 698 | Open in IMG/M |
3300009012|Ga0066710_100288709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2396 | Open in IMG/M |
3300009012|Ga0066710_104696262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas daechungensis | 511 | Open in IMG/M |
3300009098|Ga0105245_10362797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1438 | Open in IMG/M |
3300009098|Ga0105245_10674845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1065 | Open in IMG/M |
3300009137|Ga0066709_100308593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 2153 | Open in IMG/M |
3300009137|Ga0066709_104399798 | Not Available | 514 | Open in IMG/M |
3300009174|Ga0105241_10805385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 866 | Open in IMG/M |
3300009174|Ga0105241_10962918 | Not Available | 796 | Open in IMG/M |
3300009174|Ga0105241_12267042 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300009176|Ga0105242_12274974 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 588 | Open in IMG/M |
3300009177|Ga0105248_10042715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 5084 | Open in IMG/M |
3300009551|Ga0105238_10212899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1909 | Open in IMG/M |
3300009551|Ga0105238_11528002 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300009551|Ga0105238_12704664 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 533 | Open in IMG/M |
3300009840|Ga0126313_10042316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3178 | Open in IMG/M |
3300010048|Ga0126373_11084977 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300010152|Ga0126318_10508285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1144 | Open in IMG/M |
3300010336|Ga0134071_10294422 | Not Available | 814 | Open in IMG/M |
3300010371|Ga0134125_10217226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2126 | Open in IMG/M |
3300010373|Ga0134128_10035150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 5871 | Open in IMG/M |
3300010373|Ga0134128_10526384 | Not Available | 1317 | Open in IMG/M |
3300010373|Ga0134128_11566100 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300010375|Ga0105239_10617790 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1237 | Open in IMG/M |
3300010375|Ga0105239_11060028 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300010396|Ga0134126_11273251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 815 | Open in IMG/M |
3300010397|Ga0134124_10892143 | Not Available | 895 | Open in IMG/M |
3300010399|Ga0134127_10013991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 6046 | Open in IMG/M |
3300012200|Ga0137382_11098044 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300012208|Ga0137376_10742843 | Not Available | 846 | Open in IMG/M |
3300012210|Ga0137378_11110532 | Not Available | 706 | Open in IMG/M |
3300012212|Ga0150985_100946990 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 581 | Open in IMG/M |
3300012212|Ga0150985_109092927 | Not Available | 758 | Open in IMG/M |
3300012212|Ga0150985_112297075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 978 | Open in IMG/M |
3300012212|Ga0150985_118208344 | Not Available | 1395 | Open in IMG/M |
3300012212|Ga0150985_120002816 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300012357|Ga0137384_10139620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2028 | Open in IMG/M |
3300012469|Ga0150984_100122132 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 553 | Open in IMG/M |
3300012469|Ga0150984_100529044 | Not Available | 537 | Open in IMG/M |
3300012469|Ga0150984_102144666 | Not Available | 1078 | Open in IMG/M |
3300012469|Ga0150984_103540606 | Not Available | 1383 | Open in IMG/M |
3300012469|Ga0150984_105674814 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 528 | Open in IMG/M |
3300012469|Ga0150984_107836794 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 538 | Open in IMG/M |
3300012469|Ga0150984_117595944 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300012469|Ga0150984_118742801 | Not Available | 869 | Open in IMG/M |
3300012469|Ga0150984_120971310 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300012914|Ga0157297_10197763 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300012955|Ga0164298_10136637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1356 | Open in IMG/M |
3300012955|Ga0164298_10489650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Croceibacterium → Croceibacterium atlanticum | 819 | Open in IMG/M |
3300012955|Ga0164298_10498305 | Not Available | 813 | Open in IMG/M |
3300012955|Ga0164298_10850832 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300012955|Ga0164298_11254028 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300012955|Ga0164298_11487488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300012955|Ga0164298_11661119 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300012958|Ga0164299_10109219 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300012958|Ga0164299_10282037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1011 | Open in IMG/M |
3300012960|Ga0164301_10897397 | Not Available | 687 | Open in IMG/M |
3300012960|Ga0164301_11007309 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300012961|Ga0164302_11803362 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300012971|Ga0126369_12419403 | Not Available | 611 | Open in IMG/M |
3300012972|Ga0134077_10401642 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300012986|Ga0164304_10295727 | Not Available | 1107 | Open in IMG/M |
3300012986|Ga0164304_10373393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1004 | Open in IMG/M |
3300012986|Ga0164304_10899122 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300012988|Ga0164306_10193657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1421 | Open in IMG/M |
3300012989|Ga0164305_10181756 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1460 | Open in IMG/M |
3300013100|Ga0157373_10085403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2225 | Open in IMG/M |
3300013100|Ga0157373_10115474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1887 | Open in IMG/M |
3300013100|Ga0157373_10604322 | Not Available | 799 | Open in IMG/M |
3300013100|Ga0157373_11000936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 624 | Open in IMG/M |
3300013100|Ga0157373_11076458 | Not Available | 602 | Open in IMG/M |
3300013100|Ga0157373_11250279 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300013102|Ga0157371_10354470 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300013102|Ga0157371_10656527 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300013102|Ga0157371_10785997 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300013102|Ga0157371_11092334 | Not Available | 611 | Open in IMG/M |
3300013102|Ga0157371_11234367 | Not Available | 577 | Open in IMG/M |
3300013104|Ga0157370_10213524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1788 | Open in IMG/M |
3300013105|Ga0157369_10391959 | Not Available | 1441 | Open in IMG/M |
3300013105|Ga0157369_10673059 | Not Available | 1066 | Open in IMG/M |
3300013105|Ga0157369_10682502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1058 | Open in IMG/M |
3300013105|Ga0157369_12128940 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 569 | Open in IMG/M |
3300013296|Ga0157374_11400534 | Not Available | 722 | Open in IMG/M |
3300013296|Ga0157374_12423200 | Not Available | 552 | Open in IMG/M |
3300013297|Ga0157378_10479755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1239 | Open in IMG/M |
3300013306|Ga0163162_10251369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1900 | Open in IMG/M |
3300013307|Ga0157372_10364811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1683 | Open in IMG/M |
3300013307|Ga0157372_12091153 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300013307|Ga0157372_13062589 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 534 | Open in IMG/M |
3300013307|Ga0157372_13084941 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300014487|Ga0182000_10149627 | Not Available | 844 | Open in IMG/M |
3300014497|Ga0182008_10689142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 582 | Open in IMG/M |
3300015084|Ga0167654_1025375 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
3300015195|Ga0167658_1091031 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300015261|Ga0182006_1223304 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 621 | Open in IMG/M |
3300015356|Ga0134073_10116053 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300015357|Ga0134072_10417525 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
3300015371|Ga0132258_10971270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2146 | Open in IMG/M |
3300015371|Ga0132258_12827940 | Not Available | 1208 | Open in IMG/M |
3300015372|Ga0132256_102638819 | Not Available | 602 | Open in IMG/M |
3300015373|Ga0132257_100481223 | Not Available | 1520 | Open in IMG/M |
3300015373|Ga0132257_100979304 | Not Available | 1063 | Open in IMG/M |
3300015374|Ga0132255_100015559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 9136 | Open in IMG/M |
3300015374|Ga0132255_103368801 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300015374|Ga0132255_103588398 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300015374|Ga0132255_104647492 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300015374|Ga0132255_104757141 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300017656|Ga0134112_10331836 | Not Available | 617 | Open in IMG/M |
3300017937|Ga0187809_10209628 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300017947|Ga0187785_10353778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 692 | Open in IMG/M |
3300018431|Ga0066655_10873679 | Not Available | 614 | Open in IMG/M |
3300018433|Ga0066667_10593500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 923 | Open in IMG/M |
3300018468|Ga0066662_10005155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 6392 | Open in IMG/M |
3300018468|Ga0066662_10085642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2174 | Open in IMG/M |
3300018468|Ga0066662_11314688 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300018468|Ga0066662_12195610 | Not Available | 579 | Open in IMG/M |
3300018468|Ga0066662_12773958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
3300018482|Ga0066669_10980172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 762 | Open in IMG/M |
3300018482|Ga0066669_11930480 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 550 | Open in IMG/M |
3300018920|Ga0190273_10468765 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300020069|Ga0197907_10728958 | Not Available | 581 | Open in IMG/M |
3300020070|Ga0206356_10801169 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300020082|Ga0206353_11523046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Gallaecimonas | 616 | Open in IMG/M |
3300020610|Ga0154015_1693700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 848 | Open in IMG/M |
3300021384|Ga0213876_10374327 | Not Available | 757 | Open in IMG/M |
3300021388|Ga0213875_10034203 | Not Available | 2399 | Open in IMG/M |
3300021445|Ga0182009_10393399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas daechungensis | 715 | Open in IMG/M |
3300021953|Ga0213880_10154458 | Not Available | 628 | Open in IMG/M |
3300025315|Ga0207697_10000100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 39272 | Open in IMG/M |
3300025315|Ga0207697_10007481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 4868 | Open in IMG/M |
3300025321|Ga0207656_10000759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 10569 | Open in IMG/M |
3300025321|Ga0207656_10181458 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1010 | Open in IMG/M |
3300025893|Ga0207682_10159367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
3300025893|Ga0207682_10313518 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300025893|Ga0207682_10620104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 509 | Open in IMG/M |
3300025899|Ga0207642_10146916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1250 | Open in IMG/M |
3300025899|Ga0207642_10564007 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300025899|Ga0207642_10766714 | Not Available | 612 | Open in IMG/M |
3300025899|Ga0207642_10840986 | Not Available | 585 | Open in IMG/M |
3300025901|Ga0207688_10088533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1776 | Open in IMG/M |
3300025901|Ga0207688_10150251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1375 | Open in IMG/M |
3300025901|Ga0207688_10172241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1287 | Open in IMG/M |
3300025903|Ga0207680_10026601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3209 | Open in IMG/M |
3300025903|Ga0207680_10030598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 3038 | Open in IMG/M |
3300025903|Ga0207680_10119225 | Not Available | 1723 | Open in IMG/M |
3300025903|Ga0207680_10983602 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 604 | Open in IMG/M |
3300025904|Ga0207647_10004972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 9802 | Open in IMG/M |
3300025904|Ga0207647_10043513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2810 | Open in IMG/M |
3300025904|Ga0207647_10054126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2470 | Open in IMG/M |
3300025904|Ga0207647_10145163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1389 | Open in IMG/M |
3300025904|Ga0207647_10367469 | Not Available | 813 | Open in IMG/M |
3300025904|Ga0207647_10538680 | Not Available | 648 | Open in IMG/M |
3300025904|Ga0207647_10570774 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300025904|Ga0207647_10600184 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300025907|Ga0207645_10003103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 12739 | Open in IMG/M |
3300025907|Ga0207645_10263928 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
3300025907|Ga0207645_11109081 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 533 | Open in IMG/M |
3300025909|Ga0207705_10005132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 9819 | Open in IMG/M |
3300025909|Ga0207705_10015942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 5395 | Open in IMG/M |
3300025909|Ga0207705_10067276 | Not Available | 2592 | Open in IMG/M |
3300025909|Ga0207705_10150557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1743 | Open in IMG/M |
3300025909|Ga0207705_10248766 | Not Available | 1355 | Open in IMG/M |
3300025909|Ga0207705_10284632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1266 | Open in IMG/M |
3300025909|Ga0207705_10461666 | Not Available | 985 | Open in IMG/M |
3300025909|Ga0207705_10582154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 870 | Open in IMG/M |
3300025909|Ga0207705_10625763 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
3300025909|Ga0207705_10765355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 750 | Open in IMG/M |
3300025909|Ga0207705_10859712 | Not Available | 703 | Open in IMG/M |
3300025909|Ga0207705_10891619 | Not Available | 689 | Open in IMG/M |
3300025909|Ga0207705_10980850 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300025909|Ga0207705_11138822 | Not Available | 600 | Open in IMG/M |
3300025912|Ga0207707_10330292 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300025913|Ga0207695_10335603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1400 | Open in IMG/M |
3300025913|Ga0207695_11209225 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 636 | Open in IMG/M |
3300025917|Ga0207660_10000400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 28576 | Open in IMG/M |
3300025917|Ga0207660_10004418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 9165 | Open in IMG/M |
3300025919|Ga0207657_10154463 | Not Available | 1867 | Open in IMG/M |
3300025919|Ga0207657_10164118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1803 | Open in IMG/M |
3300025919|Ga0207657_10382665 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300025919|Ga0207657_11405851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 524 | Open in IMG/M |
3300025920|Ga0207649_10087134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2036 | Open in IMG/M |
3300025920|Ga0207649_10715007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 778 | Open in IMG/M |
3300025920|Ga0207649_11023847 | Not Available | 650 | Open in IMG/M |
3300025920|Ga0207649_11058659 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 639 | Open in IMG/M |
3300025920|Ga0207649_11401571 | Not Available | 553 | Open in IMG/M |
3300025921|Ga0207652_10786905 | Not Available | 845 | Open in IMG/M |
3300025924|Ga0207694_10499210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1019 | Open in IMG/M |
3300025925|Ga0207650_10043728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 3290 | Open in IMG/M |
3300025925|Ga0207650_10457030 | Not Available | 1063 | Open in IMG/M |
3300025926|Ga0207659_11316756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
3300025928|Ga0207700_10214028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1631 | Open in IMG/M |
3300025928|Ga0207700_11329150 | Not Available | 640 | Open in IMG/M |
3300025929|Ga0207664_10243562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1567 | Open in IMG/M |
3300025929|Ga0207664_10309264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1392 | Open in IMG/M |
3300025929|Ga0207664_10609969 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300025929|Ga0207664_11690833 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300025931|Ga0207644_10013165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 5508 | Open in IMG/M |
3300025931|Ga0207644_11518520 | Not Available | 562 | Open in IMG/M |
3300025932|Ga0207690_10109254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1989 | Open in IMG/M |
3300025932|Ga0207690_10251523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1365 | Open in IMG/M |
3300025932|Ga0207690_10369993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1137 | Open in IMG/M |
3300025932|Ga0207690_10464782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
3300025932|Ga0207690_10826093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 766 | Open in IMG/M |
3300025932|Ga0207690_10931643 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300025937|Ga0207669_11846478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
3300025938|Ga0207704_10123693 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1776 | Open in IMG/M |
3300025940|Ga0207691_10824960 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 778 | Open in IMG/M |
3300025944|Ga0207661_11087299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 736 | Open in IMG/M |
3300025945|Ga0207679_10116104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2122 | Open in IMG/M |
3300025945|Ga0207679_11685360 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 580 | Open in IMG/M |
3300025949|Ga0207667_10218136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1955 | Open in IMG/M |
3300025981|Ga0207640_10041824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2917 | Open in IMG/M |
3300025981|Ga0207640_10282353 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
3300025981|Ga0207640_11211125 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300025986|Ga0207658_11923227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
3300026023|Ga0207677_10641390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
3300026078|Ga0207702_10186559 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
3300026078|Ga0207702_10588790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
3300026078|Ga0207702_10632371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1052 | Open in IMG/M |
3300026078|Ga0207702_11370894 | Not Available | 701 | Open in IMG/M |
3300026078|Ga0207702_11441258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 682 | Open in IMG/M |
3300026078|Ga0207702_12529351 | Not Available | 500 | Open in IMG/M |
3300026088|Ga0207641_12010318 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 579 | Open in IMG/M |
3300026142|Ga0207698_10019682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4626 | Open in IMG/M |
3300026142|Ga0207698_10146490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2043 | Open in IMG/M |
3300026142|Ga0207698_10325155 | Not Available | 1442 | Open in IMG/M |
3300026142|Ga0207698_10673499 | Not Available | 1027 | Open in IMG/M |
3300026142|Ga0207698_12212349 | Not Available | 563 | Open in IMG/M |
3300026319|Ga0209647_1024675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3640 | Open in IMG/M |
3300026527|Ga0209059_1059997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1656 | Open in IMG/M |
3300026527|Ga0209059_1168634 | Not Available | 775 | Open in IMG/M |
3300026527|Ga0209059_1302023 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300026550|Ga0209474_10702884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. RG327 | 524 | Open in IMG/M |
3300026900|Ga0207444_1015895 | Not Available | 530 | Open in IMG/M |
3300027288|Ga0208525_1004709 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300027288|Ga0208525_1004709 | All Organisms → cellular organisms → Bacteria | 1419 | Open in IMG/M |
3300027718|Ga0209795_10035898 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
3300027766|Ga0209796_10007568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 3505 | Open in IMG/M |
3300027766|Ga0209796_10009378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3096 | Open in IMG/M |
3300027766|Ga0209796_10015721 | Not Available | 2307 | Open in IMG/M |
3300027766|Ga0209796_10084725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 969 | Open in IMG/M |
3300027766|Ga0209796_10181020 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
3300027773|Ga0209810_1062260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1864 | Open in IMG/M |
3300027773|Ga0209810_1086886 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300027773|Ga0209810_1128412 | Not Available | 1089 | Open in IMG/M |
3300027775|Ga0209177_10354438 | Not Available | 575 | Open in IMG/M |
3300027842|Ga0209580_10067456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1694 | Open in IMG/M |
3300027986|Ga0209168_10559602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 549 | Open in IMG/M |
3300028379|Ga0268266_10013748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 6970 | Open in IMG/M |
3300028379|Ga0268266_10143881 | Not Available | 2142 | Open in IMG/M |
3300028380|Ga0268265_12378710 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 536 | Open in IMG/M |
3300028381|Ga0268264_12289652 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300030496|Ga0268240_10013757 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300030515|Ga0268254_10237957 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300030515|Ga0268254_10303952 | Not Available | 527 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1137384 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 540 | Open in IMG/M |
3300031231|Ga0170824_113161241 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300031474|Ga0170818_110131396 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300031548|Ga0307408_100425140 | Not Available | 1146 | Open in IMG/M |
3300031716|Ga0310813_10559516 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300031731|Ga0307405_12066733 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300031824|Ga0307413_10765334 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 808 | Open in IMG/M |
3300031852|Ga0307410_10072882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2386 | Open in IMG/M |
3300031901|Ga0307406_10715777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 837 | Open in IMG/M |
3300031938|Ga0308175_100094845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2731 | Open in IMG/M |
3300031938|Ga0308175_100104750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2615 | Open in IMG/M |
3300031938|Ga0308175_100124264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2427 | Open in IMG/M |
3300031938|Ga0308175_100152189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2220 | Open in IMG/M |
3300031938|Ga0308175_100158594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 2179 | Open in IMG/M |
3300031938|Ga0308175_100193135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1997 | Open in IMG/M |
3300031938|Ga0308175_100272574 | All Organisms → cellular organisms → Bacteria | 1710 | Open in IMG/M |
3300031938|Ga0308175_100295345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1649 | Open in IMG/M |
3300031938|Ga0308175_100411554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1415 | Open in IMG/M |
3300031938|Ga0308175_100487720 | Not Available | 1307 | Open in IMG/M |
3300031938|Ga0308175_100625097 | Not Available | 1162 | Open in IMG/M |
3300031938|Ga0308175_100676716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
3300031938|Ga0308175_100912027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 967 | Open in IMG/M |
3300031938|Ga0308175_101372678 | Not Available | 788 | Open in IMG/M |
3300031938|Ga0308175_101459229 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300031938|Ga0308175_102436735 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300031938|Ga0308175_102458888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
3300031938|Ga0308175_102940469 | Not Available | 531 | Open in IMG/M |
3300031939|Ga0308174_10000447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 17114 | Open in IMG/M |
3300031939|Ga0308174_10126180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1874 | Open in IMG/M |
3300031939|Ga0308174_10476766 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300031939|Ga0308174_10989480 | Not Available | 713 | Open in IMG/M |
3300031939|Ga0308174_11038127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 696 | Open in IMG/M |
3300031939|Ga0308174_11828235 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300031995|Ga0307409_102488504 | Not Available | 546 | Open in IMG/M |
3300031996|Ga0308176_10111630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2426 | Open in IMG/M |
3300031996|Ga0308176_10488681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1247 | Open in IMG/M |
3300031996|Ga0308176_10627658 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300031996|Ga0308176_11103814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 839 | Open in IMG/M |
3300031996|Ga0308176_11144039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 824 | Open in IMG/M |
3300031996|Ga0308176_11391352 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300031996|Ga0308176_11785057 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 656 | Open in IMG/M |
3300031996|Ga0308176_11893372 | Not Available | 637 | Open in IMG/M |
3300031996|Ga0308176_12806574 | Not Available | 518 | Open in IMG/M |
3300032074|Ga0308173_10166293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1800 | Open in IMG/M |
3300032074|Ga0308173_10298348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1384 | Open in IMG/M |
3300032074|Ga0308173_10317728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1345 | Open in IMG/M |
3300032074|Ga0308173_10459925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1132 | Open in IMG/M |
3300032074|Ga0308173_11005810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
3300032074|Ga0308173_11031302 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300033412|Ga0310810_10318708 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
3300033475|Ga0310811_10873514 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300034268|Ga0372943_0358701 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300034268|Ga0372943_0860854 | Not Available | 602 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 15.40% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 9.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.32% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.18% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.80% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.04% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.28% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.28% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.09% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.09% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.09% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.90% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.14% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.71% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.71% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.95% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.95% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.76% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.76% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.57% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.38% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.38% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.38% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.38% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.38% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.38% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.19% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.19% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.19% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.19% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.19% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.19% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.19% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.19% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Host-Associated | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300003848 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005258 | Microbial communities on the surface of bentonite enhanced biochar | Environmental | Open in IMG/M |
3300005260 | Microbial communities on the surface of kaolinite enhanced biochar from soil with fertiliser in Sydney, Australia | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026900 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G01K4-12 (SPAdes) | Environmental | Open in IMG/M |
3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
3300030515 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (v2) | Host-Associated | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
MBSR1b_0162.00007010 | 2162886012 | Miscanthus Rhizosphere | VITALQLVLGILLLGLVVWAGDALAGGIEGALGEKKMRDRDA |
deeps_02902860 | 2199352024 | Soil | VTEALQLALAILLLGAVIWLGDAIAGGIDRALGEKKMRDRDA |
deeps_01656000 | 2199352024 | Soil | VINALQLVLAIMLLGAVIWLGDAIAGGIDGALGEKKMRDRDA |
INPhiseqgaiiFebDRAFT_1020121523 | 3300000364 | Soil | VISALQLGLAVILLGVVVWIGDAIAGGIEGALGEKKMRDRDA* |
INPhiseqgaiiFebDRAFT_1020154302 | 3300000364 | Soil | VINALLLVLAILLLGAVIWLGDAVAGGIESALGEKKMRDRDI* |
AP72_2010_repI_A10DRAFT_10137541 | 3300000651 | Forest Soil | VTLALQLALAIILLGTVIWVGDAIASGIDGALGEKKMRDRDA* |
F14TB_1084809151 | 3300001431 | Soil | VISALQLVLAIGLLGAVVWVGDAIAGGIEGALGEK |
C688J18823_101260641 | 3300001686 | Soil | VIDALLFVLAIILLGAVIWLGDAVAGGIESALGEKKMRDRDA* |
JGI24740J21852_100201964 | 3300001979 | Corn Rhizosphere | VTEALLLALAIILLGAVIWVGDAIAGGIDGALGEKXLRDRDA* |
JGI24740J21852_101729463 | 3300001979 | Corn Rhizosphere | RFMTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDA* |
JGI24737J22298_100141245 | 3300001990 | Corn Rhizosphere | EITEIRFMTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDA* |
JGI24737J22298_100532784 | 3300001990 | Corn Rhizosphere | MTALQLVLAIVLLGGMIWLGGALAGSIDAALGEPKLRDRDA* |
JGI24743J22301_100563351 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | EITEIGFMTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDA* |
JGI24735J21928_100289721 | 3300002067 | Corn Rhizosphere | LVIDALLLALAILIVGAIIWLGDTVSGGIENALGEKPLRDRDA* |
C688J35102_1180997391 | 3300002568 | Soil | VIIALQLVLGLLFLGAVIWIGDGVASGIEAALGEKKRRDWDAEA* |
C688J35102_1196593892 | 3300002568 | Soil | CIGDKRKSRSRFVTDAMLLVLAIMLLGAVIWLGDAVAGGIESALGEKPLRDRDA* |
C688J35102_1203073431 | 3300002568 | Soil | VITALQLVLAIGILGLVVWIGDAVAGGIEAALGEKPIRDRDSSN* |
C688J35102_1206767884 | 3300002568 | Soil | VITALQLVLAIGLLGVVVWIGDKLAGGIEGALGEKKLRDRDA* |
C688J35102_1208022483 | 3300002568 | Soil | PLMISALQFALAIILVGAVIWAGDAIAGGIEDALGEKPIRDRDL* |
C688J35102_1208139964 | 3300002568 | Soil | VITALQLILGIGLLGGVIWIGDALAGGIEGALGEKKLRDRDA* |
C688J35102_1209865276 | 3300002568 | Soil | VIAALQFALAIVLVGVVIWIGDAIAGGIEDALGEKPIRDREL* |
C688J35102_1209880855 | 3300002568 | Soil | VIAALQFALAIILVGVVIWIGDAIAGGIEDALGEKPIRDRDL* |
soilH2_100202381 | 3300003324 | Sugarcane Root And Bulk Soil | ALQLILAIFLLGAVIWLGDATARGIDSALGEKKMRDRDA* |
soilH2_100391911 | 3300003324 | Sugarcane Root And Bulk Soil | VTEALLLALAIILLGAVIWVGDAIAGGIDGALGEKKLRDRDA* |
soilH2_100971483 | 3300003324 | Sugarcane Root And Bulk Soil | VITGLQLVLAILLLGLVIWVGDFLSKGIEGALGDKPMRDRDN* |
soilH2_101667244 | 3300003324 | Sugarcane Root And Bulk Soil | VITGLELVLAILLLGGIVWLGDTIAGGIDSALGETRLRDRDN* |
Ga0058694_10194342 | 3300003848 | Agave | VITALQLVSAILLFGGVVWVGDVLAREMDSALGDKPLRDRDG* |
Ga0063454_1011946152 | 3300004081 | Soil | VINALQLALAIILLGAVIWIGDAIAGGIDSALGETKMRDRDA* |
Ga0063454_1013899031 | 3300004081 | Soil | VITALQLVLAIGLLGAVIWIGDKLAGGIEGALGEKKLRDRDA* |
Ga0062593_1012233322 | 3300004114 | Soil | VITGLQLVLAILVLGAVIWIGDAIAGGIDEALGEKPMRDRDA* |
Ga0062593_1023530562 | 3300004114 | Soil | VITALQLVLGILLLGLVVWAGDALAGGIEGALGEKKMRDRDA* |
Ga0062589_1018182011 | 3300004156 | Soil | MTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDA* |
Ga0062590_1007050331 | 3300004157 | Soil | VITALQLVLAILLLGLVIWAGDALAGGIEGALGEKKMRDRDA |
Ga0063356_1010815003 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VITALQLVLGILLLGLVIWAGDALAGGIEGALGEKKMRDRDA* |
Ga0063356_1017765342 | 3300004463 | Arabidopsis Thaliana Rhizosphere | EIRLVINALQLALAIILLGGVIWLGDVVAGGIESALGEKPLRDRDF* |
Ga0063356_1021404552 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VINALQLALAILLLGAAIWIGDVIAGGIDSALGEKKMRDRDA* |
Ga0063356_1027499651 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTEALLFALAIILLGAVIWLGDAVAGGIESALGEKKMRDRDA* |
Ga0063356_1059149052 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VITALQLVLAILLLGLVIWAGDALAGGIEGALGEKKMRDRDA* |
Ga0062595_1004424422 | 3300004479 | Soil | VTEIRLVTTALMFALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0062594_1010502511 | 3300005093 | Soil | VTTALMFALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0062594_1011427102 | 3300005093 | Soil | VTTALMFALAVILLGVIIWVGDAVAGGIESALGEKPLRDRDF* |
Ga0062594_1013042621 | 3300005093 | Soil | VITGLQLVLAVCLLGLVVWVGDAIAGGIEGALGEKPMRDRDI* |
Ga0066823_100022064 | 3300005163 | Soil | VTIALQLALAIILLGAVIWVGDAVASGIDGALGEKKIRDRDIDIVRQFRD* |
Ga0066823_100388082 | 3300005163 | Soil | VINALQLAVAIILLGAVIWVGDAIASGIDSALGEKKMRDRDA* |
Ga0066869_100074783 | 3300005165 | Soil | VTIALQLALAIILLGAVIWVGDAVASGIDGALGEKKIRDRDI* |
Ga0066809_101108892 | 3300005168 | Soil | VINALQLALAIILLGAVIWVGDAIAGGIDGALGEKKMRDRDA* |
Ga0066680_109149891 | 3300005174 | Soil | VTSALQFALAIILVGAVIWAGDAIAGGIEGALGEKPLRDRDL* |
Ga0066690_106512502 | 3300005177 | Soil | VIAALQFALAIILVGIVIWIGDAIAGGIEDALGEKPMRERDL* |
Ga0066690_110172631 | 3300005177 | Soil | VINALQLALAIILLGAVIWVGDAIAGGIDSALGEKKMRDRDA |
Ga0066684_111001061 | 3300005179 | Soil | VTSALQFALAIILVGAVIWVGDAIAGGIEGALGEKPLRDRDL* |
Ga0066678_108682061 | 3300005181 | Soil | AKGKSRETDVINALQLALAIILLGAVIWVGDAIASGIDSALGEKKMRDRDA* |
Ga0066671_102605271 | 3300005184 | Soil | VIDALQLALAVLLLGAVIWLGDAIASGIDGALGEKKMRDRDA* |
Ga0074071_10338952 | 3300005258 | Soil | VITALQLVLALVLLGGMVWLGGALAGGIDAALGEKKLRDRDA* |
Ga0074072_10465412 | 3300005260 | Soil | VITALQLVLALVLLGGMVWLGGALAGGSDAALVEKKLRDRDA* |
Ga0065712_101965243 | 3300005290 | Miscanthus Rhizosphere | VISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDA* |
Ga0065715_100560122 | 3300005293 | Miscanthus Rhizosphere | MTTALMFALAVILLGAIIWVGDAVAGGIEXALGEKPLRDRDA* |
Ga0070658_100111256 | 3300005327 | Corn Rhizosphere | VTTAFLLALAVILLGAVIWIGDAIAGGIESALGEKPLRDRDA* |
Ga0070658_100228252 | 3300005327 | Corn Rhizosphere | VITALQLALGICLLGGVIWIGDQLAGGIEGALGEKKLRDRAPRSCA* |
Ga0070658_1002286410 | 3300005327 | Corn Rhizosphere | VISALQLVLGILLIGGLVWAGDALAGGIESALGEKPLRDRDA* |
Ga0070658_100313851 | 3300005327 | Corn Rhizosphere | VISALQLVLAIVLLGVVIWIGDALAGGIEAALGEKPLRDRDIGRP* |
Ga0070658_100569615 | 3300005327 | Corn Rhizosphere | VIDALLFALAILLIGAVIWLGDAVAGGIETALGEKPLRDRDA* |
Ga0070658_100622403 | 3300005327 | Corn Rhizosphere | VTTALMLALAVILLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0070658_101190632 | 3300005327 | Corn Rhizosphere | VITALQLVLAIVLLGGMVWVGGALAGGIDAALGEKKLRDRDA* |
Ga0070658_102022353 | 3300005327 | Corn Rhizosphere | VITALQLVFAILTLGGLVWAGDALAQGMDAALGEKPLRDRDA* |
Ga0070658_103771342 | 3300005327 | Corn Rhizosphere | VIDALLLALAILLIGAVIWLGDAISSGIEHALGEKPLRDRDA* |
Ga0070658_103969303 | 3300005327 | Corn Rhizosphere | VTEALQLALAIILLGAVIGIGDMVAGGIDSALGEKKLRDRDA* |
Ga0070658_104836801 | 3300005327 | Corn Rhizosphere | MTALQLVLAIVLLGGMIWLGGALAGSIDAALGEKKLRDRDA* |
Ga0070658_105147091 | 3300005327 | Corn Rhizosphere | VINALQLALAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA* |
Ga0070658_107956882 | 3300005327 | Corn Rhizosphere | VTDALLFALAILLLGAVIWLGDAIAGGIESALGEKPLRDRDA* |
Ga0070658_108052742 | 3300005327 | Corn Rhizosphere | VITALQLVLGIGLLGAVIWIGDALAGGIEAALGEKPLRDRDATRR* |
Ga0070658_108503182 | 3300005327 | Corn Rhizosphere | VITGLELVLAIVLLGVIVWVGDAVAGGIDSALGETKLRDRDD* |
Ga0070658_108886271 | 3300005327 | Corn Rhizosphere | VTEALQLALAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA* |
Ga0070658_109921632 | 3300005327 | Corn Rhizosphere | VISALQLVIAILTVGGLVWAGDALAQGMDAALGEKPLRDRDA* |
Ga0070658_109994382 | 3300005327 | Corn Rhizosphere | VITALQLVLAIILLGGMIYIGDLLAGSIDAALGEPKMRDRDA* |
Ga0070658_111544822 | 3300005327 | Corn Rhizosphere | VIEALQLALAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA* |
Ga0070658_114185212 | 3300005327 | Corn Rhizosphere | LEITGERLVVTALQLVLLLLLVGVAIWLGDKLAGGIEGALGEKKMRDRDA* |
Ga0070658_117946842 | 3300005327 | Corn Rhizosphere | VINGLQFVLALILLGAVIWIGDAIAGGIDSALGEKKMRDRDA* |
Ga0070658_118326602 | 3300005327 | Corn Rhizosphere | VINALQLVLAIILLGLVIWAGDAIAGGIDGALGEKKMRDRDA* |
Ga0070676_102671181 | 3300005328 | Miscanthus Rhizosphere | RSRIVITALQLVLGILLLGLVVWAGDALAGGIEGALGEKKMRDRDA* |
Ga0070676_105068272 | 3300005328 | Miscanthus Rhizosphere | VTEIRFVTTALMLALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0070676_109506062 | 3300005328 | Miscanthus Rhizosphere | VIDALLFALAILLIGAVIWLGDAISGGIETALGEKPLRDRDA* |
Ga0070683_1021961862 | 3300005329 | Corn Rhizosphere | VITALQFVFAILTLGGLVWAGDALAQGMDAALGEKPLRDRDA* |
Ga0070690_1000048576 | 3300005330 | Switchgrass Rhizosphere | VTTALMLALAVILLGAVIWVGDAVAGGIESALGEKPLRDRDA* |
Ga0070690_1000182307 | 3300005330 | Switchgrass Rhizosphere | VIDALLLALAILLVGAIIWLGDTVSGGIENALGEKPLRDRDA* |
Ga0070670_1008716793 | 3300005331 | Switchgrass Rhizosphere | VTTALMFALAVILLGVIIWVGDAVAGGIESALGEKPLRDRDA* |
Ga0070670_1008948511 | 3300005331 | Switchgrass Rhizosphere | VINALQLAIAIILLGAVIWMGDTIAGGIESALGEKKMRDRDA* |
Ga0070670_1009060232 | 3300005331 | Switchgrass Rhizosphere | VTDALLLALAIILLGAVIWLGDMIAGGIESALGEKKMRDRDA* |
Ga0070670_1015661161 | 3300005331 | Switchgrass Rhizosphere | VTTALLLALAVILLGAVIWIGDAIAGGIESALGEKPLRDRDA* |
Ga0070666_102997223 | 3300005335 | Switchgrass Rhizosphere | VDKRKSRSRFVISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDA* |
Ga0070666_105861833 | 3300005335 | Switchgrass Rhizosphere | VIDALLFALAIIFLGAVIWLGDAVAGGIESALGEKPLRDRDA* |
Ga0070666_108348811 | 3300005335 | Switchgrass Rhizosphere | FVTTALMFALAVILLGAIIWVGDAIAGGIESALGEKPLRDRDS* |
Ga0070680_10000040622 | 3300005336 | Corn Rhizosphere | VISALQLVSAILILGGFVWVGDALARGMDAALGEKPLRDRDA* |
Ga0070680_1000022583 | 3300005336 | Corn Rhizosphere | VISALQLVSAILLLGGFVWVGDALARGMDAALGEKPLRDRDA* |
Ga0070680_1000089607 | 3300005336 | Corn Rhizosphere | VISALQLVSAILLLGGFVWVGDALARGMDSALGEKPLRDRDA* |
Ga0070680_1008264153 | 3300005336 | Corn Rhizosphere | MIGLQLVLAILLLGAVIWIGDAVAGGIDDALGEKLRDRD* |
Ga0070660_1002274573 | 3300005339 | Corn Rhizosphere | VINALQLALAVILLGAVIWMGDAIAGGIESALGEKKMRDRDA* |
Ga0070660_1003933561 | 3300005339 | Corn Rhizosphere | FVTEALLLALAIILLGAVIWVGDAIAGGIDGALGEKKLRDRDA* |
Ga0070660_1005071172 | 3300005339 | Corn Rhizosphere | VISALQLVLAILLLGVVVWVGDAIAGGIESALGEKPLRDRDA* |
Ga0070660_1009414752 | 3300005339 | Corn Rhizosphere | VIIALQLVLAIVLLGVVVWVGDALAGGIEGALGEKKMRDRDA* |
Ga0070660_1009604782 | 3300005339 | Corn Rhizosphere | VINALQFVLAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA* |
Ga0070660_1014087202 | 3300005339 | Corn Rhizosphere | VISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRD |
Ga0070661_1000508291 | 3300005344 | Corn Rhizosphere | GLQLVLAIVLLGLVIWAGDAIATGIESALGEKPLRDRDA* |
Ga0070661_1000647034 | 3300005344 | Corn Rhizosphere | VTTALMFALAVILLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0070661_1001079102 | 3300005344 | Corn Rhizosphere | VITGLQLVLAIVLLGLVIWAGDAIATGIESALGEKPLRDRDT* |
Ga0070661_1001770123 | 3300005344 | Corn Rhizosphere | VITGLELVFAILLLGGVVWLGDTIAGGIDSALGEKRLRDRE* |
Ga0070661_1002656963 | 3300005344 | Corn Rhizosphere | VVEALQLALALVLLGAVIWLGDAVAGSIDSALGEKKMRDRDA* |
Ga0070661_1005551042 | 3300005344 | Corn Rhizosphere | VTEALQLALAILLLGAVIWLGDAIAGGIDSALGEKKMRDRDA* |
Ga0070661_1011049232 | 3300005344 | Corn Rhizosphere | VIAALQLVLAIGLLAALIWVGDALAGGIEGALGEKPMRDRD |
Ga0070661_1018228042 | 3300005344 | Corn Rhizosphere | VISALQLVLAILLLGVVVWVGDAIAGGIESALGEKPLRERD* |
Ga0070671_1000086604 | 3300005355 | Switchgrass Rhizosphere | VTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDF* |
Ga0070671_1006424763 | 3300005355 | Switchgrass Rhizosphere | VIAALQLVLAIGLLGAVIWAGDALAGGIEGALGEKKMRDRDA* |
Ga0070671_1014854301 | 3300005355 | Switchgrass Rhizosphere | VITALQLVLGIGLLGAVVWIGDALASGLEGALGEKKMRDRDA* |
Ga0070671_1020806512 | 3300005355 | Switchgrass Rhizosphere | VIDALQFVLALILLGAVIWLGDAVAGGIDSALGEKRLRDRDI* |
Ga0070674_1002486944 | 3300005356 | Miscanthus Rhizosphere | VISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDAK |
Ga0070674_1016215541 | 3300005356 | Miscanthus Rhizosphere | VTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDA |
Ga0070659_1002678203 | 3300005366 | Corn Rhizosphere | VITGLQLVLAILLLGVVVWVGDAIARGIDGALGEKRMRDRDN* |
Ga0070659_1004838741 | 3300005366 | Corn Rhizosphere | VAKGNSRESHVINALQLALAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA* |
Ga0070659_1004931072 | 3300005366 | Corn Rhizosphere | MIAALQLVLAIILLGAMIWVGGALAGGIDAALGEKKLRDRDV* |
Ga0070659_1005299292 | 3300005366 | Corn Rhizosphere | VITGLQLVLAILLLGLVVWVGDAIAGGIDDTLGEKRLRDRD* |
Ga0070667_1000792093 | 3300005367 | Switchgrass Rhizosphere | VISALQLASAIVLLGAVIWIGDAIAGGIESALGEKKMRDRDA* |
Ga0070709_100446444 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTALWFALALLLLGVIIWIGDTVAGGIESALGEKPLRDRDA* |
Ga0070709_104426092 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VIIGLQLVLAIVLLGAVIWAGDAVAGGIESALGEKPMRDRDA* |
Ga0070714_1001686033 | 3300005435 | Agricultural Soil | VISAIQLVLGVLAVGGVVWVGDVLAREMDAALGEKPLRDRDA* |
Ga0070714_1002747692 | 3300005435 | Agricultural Soil | VIAGLQLVLAIVLLGAIIWIGDAVAGGIESALGEKPMRDRDA* |
Ga0070714_1002751333 | 3300005435 | Agricultural Soil | MVALQLALALMLLGAVIWLGDTVAGGIESALGEKKMRDRDA* |
Ga0070714_1002767422 | 3300005435 | Agricultural Soil | MTSALQLVFAILTLGGLVWVGDALARGMDAALGEKPLRDRDA* |
Ga0070714_1002809703 | 3300005435 | Agricultural Soil | VITGLQLVLAIALLGAVIWIGDAVAGGIESALGEKPMRDRDA* |
Ga0070714_1004773212 | 3300005435 | Agricultural Soil | VTEALQLALAIILLGAIIWLGDAIAGGIDSALGEQKMRDRDA* |
Ga0070714_1013362162 | 3300005435 | Agricultural Soil | VINALLLALAIILLGAVIWLGDMIAGGIDSALGEKKMRDRDA* |
Ga0070713_1000361505 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MVALQLALALMLLGAVIWLGDTVAGGIESALGEKKMRDRDT* |
Ga0070713_1005434233 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VVEALQLALALVLLGVVIWLGDAVAGSIDSALGEKKMRDRDA* |
Ga0070701_109039432 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDALLLALAILIVGAIIWLGDTVSGGIENALGEKPLRDRDA* |
Ga0066687_101504901 | 3300005454 | Soil | VVNALQFALAIILVGAVIWAGDAIAGGIEGALGEKPLRDRDL* |
Ga0066687_105887792 | 3300005454 | Soil | VINALQLVLALLLVGAVIWLGDAVAGGIESALGEKKMRDRDA* |
Ga0066687_109940431 | 3300005454 | Soil | VINAVQLAIAILLLGSVIWMGDAIAGGIESALGEKKMRDRDA* |
Ga0070663_1001557483 | 3300005455 | Corn Rhizosphere | VINALQFALAIILLGAVIWIGDAIAGGIDSALGEKKMRDRDA* |
Ga0070663_1001933913 | 3300005455 | Corn Rhizosphere | VIVGLQLVLAILLLGLVVWVGDAIAGGIDDTLGEKRLRDRD* |
Ga0070663_1003756691 | 3300005455 | Corn Rhizosphere | VINALQLALAIILLGAIIWLGDAIAGGIDSALGEKKMRDRDA* |
Ga0070663_1009815192 | 3300005455 | Corn Rhizosphere | VITGLQLVLAILLLGLVIWVGDALSKGIEGALGDKPMRDRDL* |
Ga0070678_1000119284 | 3300005456 | Miscanthus Rhizosphere | VTDALLLALAILLLGAVIWLGDAIAGGIESALGEKPLRDRDA* |
Ga0070678_1008187162 | 3300005456 | Miscanthus Rhizosphere | LLVYKRKSRRRFVTDALLLALAILLLGAVIWLGDAIAGGIESALGEKPLRDRDA* |
Ga0070662_1005507043 | 3300005457 | Corn Rhizosphere | RINCQFNTLLLKGKSREARLVINALQLALAILLLGAAIWIGDVIAGGIDSALGEKKMRDRDA* |
Ga0070681_103181974 | 3300005458 | Corn Rhizosphere | VITGLQLVLAIVLLGLVIWAGDAIATGIESALGEKPLRDRDA* |
Ga0070681_113192131 | 3300005458 | Corn Rhizosphere | VINGLQFVLALILLGAVIWIGDAIADGIDSALGEKKMRDRDA* |
Ga0070741_110472192 | 3300005529 | Surface Soil | VTEALLLALAIILLGAVIWIGDTIAAGIDSALGEKKLRDRDA* |
Ga0070739_100227896 | 3300005532 | Surface Soil | VIDALQLALALLLLGAVIWLGDAIAGGIDAALGEKKMRDRDA* |
Ga0070739_100259355 | 3300005532 | Surface Soil | VITALQLVLAIGLLGAVVWVGDTLAGGIEAALGEKPLRDRDA* |
Ga0070739_100661483 | 3300005532 | Surface Soil | VTEALLLALAIILLGAVIWVGDAIATGIDSALGETKLRDRDA* |
Ga0070735_103906512 | 3300005534 | Surface Soil | VIEALQLALAVLLLGAVIWLGDVIAKGIDGALGEKKMRDRDVSGV* |
Ga0070684_1007361331 | 3300005535 | Corn Rhizosphere | VINALQLVLAIILLGLVIWAGDAIAGGIDGALGEKKMRDRD |
Ga0070684_1014418091 | 3300005535 | Corn Rhizosphere | VIIALQLVSAILLVGGVVWVGDALAREMDAALGEKPLRDRDA* |
Ga0070684_1023453101 | 3300005535 | Corn Rhizosphere | VTEALLLALAIILLGAVIWVGDAIAGGIDSALGEKKLRDRDA* |
Ga0068853_1000672541 | 3300005539 | Corn Rhizosphere | IVITGLQLVLAIVLLGLVIWAGDAIATGIESALGEKPLRDRDA* |
Ga0068853_1014491584 | 3300005539 | Corn Rhizosphere | SRRRFVINALQLAIAIILLGAVIWMGDTIAGGIESALGEKKMRDRDA* |
Ga0070732_100810724 | 3300005542 | Surface Soil | VIVALQLAVAFILLGVVIWVGDAVAGSIDSALGEKKMRDRDA* |
Ga0070672_1004843383 | 3300005543 | Miscanthus Rhizosphere | VTTALMFALAVILLGAIIWVGDAIAGGIESALGEKPLRDRDS* |
Ga0070672_1006194624 | 3300005543 | Miscanthus Rhizosphere | MFALAVILLGAVIWIGDAVAGGIESALGEKPLRDRDAF* |
Ga0070686_1001479844 | 3300005544 | Switchgrass Rhizosphere | DRVTEIRLVTTALMLALAVILLGAVIWVGDAVAGGIESALGEKPLRDRDA* |
Ga0070665_1003592111 | 3300005548 | Switchgrass Rhizosphere | VIDALLFALAILLIGAVIWLGDAVAGGIENALGEKPLRDRDA* |
Ga0070665_1020200533 | 3300005548 | Switchgrass Rhizosphere | VIIALQLVLGIMLLGGVIWIGDHLAGGIEGALGEKKLRDRDA* |
Ga0068855_1000951004 | 3300005563 | Corn Rhizosphere | VITGLQLVLAIVLLGAVIWIGDAIAGGIESALGEKPMRDRDA* |
Ga0068855_1004413244 | 3300005563 | Corn Rhizosphere | VTEALLLALAVILLGAVIWIGDTIAGGIDSALGEKKLRDRDA* |
Ga0068855_1005743253 | 3300005563 | Corn Rhizosphere | EALQLALALVLLGAVIWLGDAVAGSIDSALGEKKMRDRDA* |
Ga0068855_1020401792 | 3300005563 | Corn Rhizosphere | VTEALLLALAIILLGAVIWVGDAIARGVDSALGETKLRDRDA* |
Ga0070664_1001159953 | 3300005564 | Corn Rhizosphere | VITALQLVLAIGLLAALIWVGDALAGGIEGALGEKPMRDRDG* |
Ga0070664_1004402442 | 3300005564 | Corn Rhizosphere | VIDALLFALAIILLGAVIWLGDAVAGGIESALGEKPLRDRDA* |
Ga0070664_1004618984 | 3300005564 | Corn Rhizosphere | VIEALLFALAIILLGAVIWLGDAVAGGIESALGEKKMRDRDA* |
Ga0070664_1010779072 | 3300005564 | Corn Rhizosphere | VISALQLFLAIVLLGVVIWIGDALAGGIEAALGEKPLRDRDIGRP* |
Ga0070664_1016423573 | 3300005564 | Corn Rhizosphere | VISALQLVLAILLLGLVVWVGDAVAGGIDEALGEKKIRDRD |
Ga0066693_104528812 | 3300005566 | Soil | VINALQLVLAISLLGAVIWVGDAIAGGIDGALGEKPLRDRDA* |
Ga0066703_105067932 | 3300005568 | Soil | VTTALLFALAVLLLGAVIWLGDTIAGGIESALGEKPLRDRDA* |
Ga0066702_100117772 | 3300005575 | Soil | VIDALQLALALLMLGVVIWLGDAIAGGIEGALGEKKMRDRDA* |
Ga0066702_101246684 | 3300005575 | Soil | VTTALLFALAVLLLGAVIWLGDMIAGGIESALGEKPLRDRDA* |
Ga0066702_107725932 | 3300005575 | Soil | VTTALMFALALLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0066708_100792894 | 3300005576 | Soil | VIAALQFALAIILVGAVIWIGDAIAGGIEDALGEKPIRDRDL* |
Ga0068857_10002333011 | 3300005577 | Corn Rhizosphere | VITGLQLVLAILLLGAVVWVGDAIARGIEGALGEKPLRDRDF* |
Ga0068857_1021565031 | 3300005577 | Corn Rhizosphere | MTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDF* |
Ga0068854_1001370414 | 3300005578 | Corn Rhizosphere | VTDALLLALAIILLGAVIWLGDAVAGGIESALGEKPLRDRDA* |
Ga0068854_1002305984 | 3300005578 | Corn Rhizosphere | ALQLALALVLLGAVIWLGDAVAGSIDSALGEKKMRDRDA* |
Ga0068854_1006481953 | 3300005578 | Corn Rhizosphere | LAVILLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0068854_1011710943 | 3300005578 | Corn Rhizosphere | DKAEIRSRIVISALQLVSAILLLGGFVWVGDALARGMDSALGEKPLRDRDA* |
Ga0068854_1015712262 | 3300005578 | Corn Rhizosphere | VTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDA* |
Ga0068854_1016714981 | 3300005578 | Corn Rhizosphere | FIVGKRDFTENRRVINGLQFVLALILLGAVIWIGDAIAGGIDSALGEKKMRDRDA* |
Ga0068856_1001867984 | 3300005614 | Corn Rhizosphere | VTEALLLALAIILLGAVIWIGDAIASGIDSALGEKKLRDRDA* |
Ga0068856_1004818973 | 3300005614 | Corn Rhizosphere | VITGLQLVLAIVLLGLVIWAGDAIATGIDSALGEKPLRDRDA* |
Ga0068856_1014449292 | 3300005614 | Corn Rhizosphere | MFALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0068852_1003621631 | 3300005616 | Corn Rhizosphere | VITGLQLVLAIVLLGAVVWIGDAIAGGIESALGEKPLRDRDA* |
Ga0068866_101794401 | 3300005718 | Miscanthus Rhizosphere | SRFVISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDA* |
Ga0066903_1065397451 | 3300005764 | Tropical Forest Soil | VISALQLGLAIILLGVVVWIGDAIAGGIEDALGEKKMRDRRH* |
Ga0068851_102044101 | 3300005834 | Corn Rhizosphere | VTEALQLALAIILLGAVIWIGDMVAGGIDSALGEKKLRDRDA* |
Ga0068851_103258291 | 3300005834 | Corn Rhizosphere | RRFVINALQLAIAIILLGAVIWMGDTIAGGIESALGEKKMRDRDA* |
Ga0068870_106062731 | 3300005840 | Miscanthus Rhizosphere | MFALAVILLGVIIWVGDAVAGGIESALGEKPLRDRDF* |
Ga0068860_1026153091 | 3300005843 | Switchgrass Rhizosphere | SRSRFVISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDA* |
Ga0081539_100130559 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VINALQLAIAIVLLGAVIWIGDAIAGGIESALGEKKMRDRDA* |
Ga0081539_104297821 | 3300005985 | Tabebuia Heterophylla Rhizosphere | SRFVINALQLVIGIMLLGAVIWIGDAIAGGIDSALGEKKMRDRDA* |
Ga0070717_100828335 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VINALQLVVAIILLGAVIWMGDAIAGGIESALGEKKMRDRDA* |
Ga0070717_102644122 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VIEALQLALALILLGAVIWLGDAVAGGIESALGEKKMRDRDA* |
Ga0070717_113297331 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MVALQLALALILLGAVIWLGDTVAGGIESALGEKKMRDR |
Ga0066651_101781341 | 3300006031 | Soil | NALQLVLAISLLGAVIWVGDAIAGGIDGALGEKPLRDRDA* |
Ga0066651_102413592 | 3300006031 | Soil | VTNALQFALAILLVGAIIWIGDAIAGGIEGALGEKPLRDRDP* |
Ga0066696_107196782 | 3300006032 | Soil | VTSALQFALAIILVGAVIWAGDAIDGGIEGALGEKPLRDRDL* |
Ga0066696_109525621 | 3300006032 | Soil | VINALQLALAIILLGALIWTGDAIAGGIDSALGEKKMRDRDA* |
Ga0066652_1003277674 | 3300006046 | Soil | VTNALMLALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0075364_107368172 | 3300006051 | Populus Endosphere | VISALQLAIAIILLGAVIWMGDTIAGGIESALGEKK |
Ga0070716_1011323141 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TTALWFALALLLLGVIIWIGDTVAGGIESALGEKPLRDRDA* |
Ga0070712_1000550255 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VISALQLGLAIILLGVVVWIGDAIAGGIEGALGEKKMRDRDA* |
Ga0074060_115632454 | 3300006604 | Soil | LAIILLGAVIWVGDAVASGIDGALGEKKIRDRDI* |
Ga0079222_111642541 | 3300006755 | Agricultural Soil | VIVALQLVLGIGLLGTVIWAGDKLAGGIEGALGEKPLRDRDA* |
Ga0066659_110313132 | 3300006797 | Soil | VINALQLALAIFLLGAVIWVGDAIAGGIDSALGEKKMRDRDT* |
Ga0066660_104719373 | 3300006800 | Soil | VIAALQFALAIILVGAVIWAGDAIAGGIEGALGEKPLRDRDL* |
Ga0079221_101773633 | 3300006804 | Agricultural Soil | VITGLQLVLAILLLGAVIWIGDAVAAGIEGALGDKPMRDRDA* |
Ga0079221_105394762 | 3300006804 | Agricultural Soil | VITGLELVFAILLLGGVVWVGDTIAGGIDSALGEKRLRDRD* |
Ga0079221_105572752 | 3300006804 | Agricultural Soil | MFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDA* |
Ga0079220_105466873 | 3300006806 | Agricultural Soil | VITGLQLVLAIVLLGLVIWVGDAIATGIESALGEKPLRDRDA* |
Ga0068865_1001351941 | 3300006881 | Miscanthus Rhizosphere | VTTALLFVLALILLGAVIWIGDAVAGGIESALGEKPMRDRDG* |
Ga0068865_1011112893 | 3300006881 | Miscanthus Rhizosphere | VTTAVMFALAVILLGAVIWIGDAVAGGIESALGEKPHRDRDAF* |
Ga0074063_100473342 | 3300006953 | Soil | VTIALQLVLAIILLGAVIWIGDAIASGIDGALGEKKMRDRDAR* |
Ga0079219_109751911 | 3300006954 | Agricultural Soil | SRRRFVTDALLLALAIILLGAVIWLGDAVAGGIESALGEKPLRDRDA* |
Ga0079219_109751914 | 3300006954 | Agricultural Soil | VITALQLVLGIGLLGAVVLIGDALASGLEGALGEKKMRDRDA* |
Ga0066710_1002887091 | 3300009012 | Grasslands Soil | VVSALQFALAIILVGAVIWIGDAIAGGIEGALGEKPMRDRDL |
Ga0066710_1046962622 | 3300009012 | Grasslands Soil | VIDALQLALAVLLLGAVIWLGDAIASGIDGALGEKKMRDRDA |
Ga0105245_103627973 | 3300009098 | Miscanthus Rhizosphere | MLALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0105245_106748451 | 3300009098 | Miscanthus Rhizosphere | MLALAVILLGAVIWVGDAVAGGIESALGEKPLRDRDA* |
Ga0066709_1003085931 | 3300009137 | Grasslands Soil | VVSALQFALAIILVGAVIWIGDAIAGGIEGALGEKPMRDRDL* |
Ga0066709_1043997983 | 3300009137 | Grasslands Soil | FVIDALQLALAVLLLGAVIWLGDAVAGGIDAALGEKKMRDRDA* |
Ga0105241_108053851 | 3300009174 | Corn Rhizosphere | MFALAVILLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0105241_109629181 | 3300009174 | Corn Rhizosphere | MFSLAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0105241_122670421 | 3300009174 | Corn Rhizosphere | VITGLQLVLAILLLGLVIWVGDALSKGIEGALGDK |
Ga0105242_122749743 | 3300009176 | Miscanthus Rhizosphere | MFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDF* |
Ga0105248_100427154 | 3300009177 | Switchgrass Rhizosphere | MFALAVILLGAIIWVGDAIAGGIESALGEKPLRDRDF* |
Ga0105238_102128991 | 3300009551 | Corn Rhizosphere | LAIILLGAIIWLGDAIAGGIDSALGEKKMRDRDA* |
Ga0105238_115280021 | 3300009551 | Corn Rhizosphere | DALLLALAILLIGAVIWLGDAISSGIEHALGEKPLRDRDA* |
Ga0105238_127046643 | 3300009551 | Corn Rhizosphere | VTTALMLAFAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0126313_100423162 | 3300009840 | Serpentine Soil | VIIALQLVLGILLLGLVIWAGDALAGGIEGALGEKKMRDRDA* |
Ga0126373_110849774 | 3300010048 | Tropical Forest Soil | VITGLQLALAIVLLGGIIWAGDAIAGGIESALGEKPMRDRDA* |
Ga0126318_105082853 | 3300010152 | Soil | VVEALQLALALVLLGVVIWLGDAVAGSIDSALGEKKMCDRDA* |
Ga0134071_102944222 | 3300010336 | Grasslands Soil | SREVINALQLVLAISLLGAVIWVGDAIAGGIDGALGEKPLRDRDA* |
Ga0134125_102172265 | 3300010371 | Terrestrial Soil | VTEALLLALAIILLGAVIWIGDAIATGIDGALGETKLRDRDA* |
Ga0134128_100351504 | 3300010373 | Terrestrial Soil | VTEALLLALAIILLGAVIWVGDPIATGIDSALGETKLRDRDA* |
Ga0134128_105263844 | 3300010373 | Terrestrial Soil | KAEIRSRIVISALQLVSAILLLGGFVWVGDALARGMDSALGEKPLRDRDA* |
Ga0134128_115661002 | 3300010373 | Terrestrial Soil | VIEAVQLAVALILLGAVIWLGDTVAGGIESALGEKKMRDRDA* |
Ga0105239_106177901 | 3300010375 | Corn Rhizosphere | FVINALQLALAVILLGAVIWMGDAIAGGIESALGEKKMRDRDA* |
Ga0105239_110600282 | 3300010375 | Corn Rhizosphere | VINALQLAIAILLLGAVIWMGDAIAGGIESALGEKKMRDRDA* |
Ga0134126_112732512 | 3300010396 | Terrestrial Soil | VIAGIQLVIAILLLGGVVWVGDAIAGGIESALGEKPLRDRDV* |
Ga0134124_108921431 | 3300010397 | Terrestrial Soil | VTDALLLALAIILLGAVICLGDAVAGGIESALGEKPLRDRDA* |
Ga0134127_100139913 | 3300010399 | Terrestrial Soil | VINALLLALAIILLGAVIWLGDLIAGGIDSALGEKKMRDRDA* |
Ga0137382_110980441 | 3300012200 | Vadose Zone Soil | VINALQLALAIILLGAVIWTGDAIAGGIESALGEKKMRDRDA |
Ga0137376_107428431 | 3300012208 | Vadose Zone Soil | VISALQLALAIILLGVVVWIGDAIAGGIEGALGEKPLRDRDG* |
Ga0137378_111105322 | 3300012210 | Vadose Zone Soil | SALQFALAIILVGAVIWAGDAIAGGIEGALGEKPLRDRDL* |
Ga0150985_1009469901 | 3300012212 | Avena Fatua Rhizosphere | VTEALLFALAIILLGAVIWLGDAVAGGIENALGEKPLRGRHA* |
Ga0150985_1090929274 | 3300012212 | Avena Fatua Rhizosphere | KRLVINALQLALAIILLGAVIWIGDAIAGGIDSALGEKKMRDRDA* |
Ga0150985_1122970752 | 3300012212 | Avena Fatua Rhizosphere | FVNDALLLVLAIILLGAVIWLGDAVAGGIESALGEKPLRDRDG* |
Ga0150985_1182083443 | 3300012212 | Avena Fatua Rhizosphere | LLFVLAIILLGAVIWLGDAVAGGIESALGEKKMRDRDA* |
Ga0150985_1200028164 | 3300012212 | Avena Fatua Rhizosphere | LVLAVILLGAVIWLGDAVAGGIESALGEKPLRDRDAQGRRS* |
Ga0137384_101396201 | 3300012357 | Vadose Zone Soil | VTSALQFALAIILVGAVIWAGDAIAGGIEGALGEKPPR |
Ga0150984_1001221323 | 3300012469 | Avena Fatua Rhizosphere | MLALAVILLGAVIWVGDTIAGGIESALGEKPLRDRDA* |
Ga0150984_1005290441 | 3300012469 | Avena Fatua Rhizosphere | DVCSSDLITALQLVLAIGLLGAVIWIGDKLAGGIEGALGEKKLRDRDA* |
Ga0150984_1021446663 | 3300012469 | Avena Fatua Rhizosphere | VLAIILLGAVIWLGDAVAGGIESALAEKKMRDRDA* |
Ga0150984_1035406062 | 3300012469 | Avena Fatua Rhizosphere | VTEALLFALAIILLGAVIWLGDAVAGGIESALGEKPLRDRDV* |
Ga0150984_1056748143 | 3300012469 | Avena Fatua Rhizosphere | VTDALLLVLAIILLGAVIWLGDVVAGGIESALGEKPLRDRDA* |
Ga0150984_1078367941 | 3300012469 | Avena Fatua Rhizosphere | RLVINALQLALAIILLGAVIWIGDAIAGGIDSALGETKMRDRDA* |
Ga0150984_1175959442 | 3300012469 | Avena Fatua Rhizosphere | VTTALLFALAVILLGAVIWVGDAVAGGIESALGEKPLRDRDA* |
Ga0150984_1187428011 | 3300012469 | Avena Fatua Rhizosphere | RKSRRVDVIDALQFVLALVLLGAVIWLGDAVAGGIDSALGEKRLRDRDG* |
Ga0150984_1209713104 | 3300012469 | Avena Fatua Rhizosphere | VITALQLILGIGLLGGVIGIGDALAGGIEGALGEKKLRDRDA* |
Ga0157297_101977633 | 3300012914 | Soil | VITGLQLVLAILLLGGVIWIGDAVAGGIDDALGEKPMRDRD* |
Ga0164298_101366372 | 3300012955 | Soil | VIDALLLALAIILLGAVIWLGDAIAGGIESALGEKPLRDRDA* |
Ga0164298_104896504 | 3300012955 | Soil | VIIALQLILAIALLGLVVWVGDAVAGGIEGALGEKPLRDRDV* |
Ga0164298_104983051 | 3300012955 | Soil | VITALQLALGICLLGGVIWIGDQLAGGIEGALGEKKLRDRDA* |
Ga0164298_108508322 | 3300012955 | Soil | VIIALQLILGIGLLGGVIWIGDALAGGIEGALGEKKLRDRDA* |
Ga0164298_112540282 | 3300012955 | Soil | VINALQLALAIILLGALIWLGDAIAGGIDSALGEKKMRDRDA* |
Ga0164298_114874882 | 3300012955 | Soil | VTEALLFALAIILLGAVIWLGDTIAGGIESALGEKPLRDRDA* |
Ga0164298_116611192 | 3300012955 | Soil | VITGLQLVLAILLLGLVIWVGDALSKGIEGALGDKPMRDRYL* |
Ga0164299_101092191 | 3300012958 | Soil | VITGLQLVLAILLLGLVIWVGDALSKGIEGALGEKKMRDRDA* |
Ga0164299_102820372 | 3300012958 | Soil | VIDALLLALAIILLGAVIWLGDAIAGGIESALGETPLRDRDA* |
Ga0164301_108973971 | 3300012960 | Soil | VIAALQFALAIILVGVVIWIGDAIAGGIEDALGEKPIRDREL* |
Ga0164301_110073091 | 3300012960 | Soil | VTDALLFVLAILLLGAVIWLGDAVAGGIESALGEKPLRDRDT* |
Ga0164302_118033622 | 3300012961 | Soil | VIDALQLALAVLLLGAVIWLGDAVAGGIDAALGEKKMRDRDA* |
Ga0126369_124194033 | 3300012971 | Tropical Forest Soil | VITALQLVLAIALLGAVVWVGDALSRGVEDALGEKKMRDRDT* |
Ga0134077_104016421 | 3300012972 | Grasslands Soil | RSREVINALQLVLAISLLGAVIWVGDAIAGGIDGALGEKPLRDRDA* |
Ga0164304_102957272 | 3300012986 | Soil | VITGLQLVAAILLLGGVIWIGDAIAGGIESALGEKPMRDRDA* |
Ga0164304_103733933 | 3300012986 | Soil | VGKGDFTENRRVINGLQFVLALILLGAVIWIGDAIAGGIDSALGEKKMRDRDA* |
Ga0164304_108991222 | 3300012986 | Soil | VIDALLLVLAVLLLGAVIWLGDAVAGGIESALGEKPLRDRDA* |
Ga0164306_101936571 | 3300012988 | Soil | VITALQLALGICLLGGVIWIGDKLAGCLEGALGEKKLRDRDA* |
Ga0164305_101817564 | 3300012989 | Soil | ALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDA* |
Ga0157373_100854035 | 3300013100 | Corn Rhizosphere | VITGLQLVLAILLLGGVVWVGDAVAGGIDSALGEKRLRDRD* |
Ga0157373_101154742 | 3300013100 | Corn Rhizosphere | VINALQLALAIILLGAIIWLGDAIAGGIDGALGEKKMRDRDA* |
Ga0157373_106043224 | 3300013100 | Corn Rhizosphere | VISALQLVLGILLIGGLVWVGDALAGGIESALGEKPLRDRDA* |
Ga0157373_110009361 | 3300013100 | Corn Rhizosphere | VIAAFQFALAIILVGIVIWIGDAIAGGIEDALGEKPIRDREL* |
Ga0157373_110764581 | 3300013100 | Corn Rhizosphere | MLAFAVLLLGAIIWIGDAVAGGIESALGEKPLRDRD |
Ga0157373_112502792 | 3300013100 | Corn Rhizosphere | VINALQLALAIILLGAVIWLGDAVAGGIESALGEKPLRDRDF* |
Ga0157371_103544703 | 3300013102 | Corn Rhizosphere | VITGLQLVLAIVLLGLVIWAGDAIATGIESALGGKPLRNQDT* |
Ga0157371_106565272 | 3300013102 | Corn Rhizosphere | VITGLQLVLAILLLGAVVWVGDAIAGGIDDTLGEKRLRDRD* |
Ga0157371_107859971 | 3300013102 | Corn Rhizosphere | ARRRFVITGLQLVLAILLLGGVIWIGDAVAGGIDDALGEKPMRDRD* |
Ga0157371_110923343 | 3300013102 | Corn Rhizosphere | VITGLEIVFAILLLGGVVWVGDTIAGGIDSALGEKRLRDRE* |
Ga0157371_112343672 | 3300013102 | Corn Rhizosphere | DKAEIRSRIVISALQLVSAILVLGGFVWLGDALAQGMDAALGETPLRDRDA* |
Ga0157370_102135243 | 3300013104 | Corn Rhizosphere | VINALQLALAIILLGAIIWLGDAIAGGIDSALGEKKMRHRDA* |
Ga0157369_103919592 | 3300013105 | Corn Rhizosphere | MTALQLVLAIVLLGGMVWLGGALAGSIDAALGEKKLRDRDA* |
Ga0157369_106730594 | 3300013105 | Corn Rhizosphere | TGLQLVLAIVLLGLVIWAGDAIATGIESALGEKPLRDRDA* |
Ga0157369_106825022 | 3300013105 | Corn Rhizosphere | VISALQLVSAILVLGGFVWLGDALAQGMDAALGETPLRDRDA* |
Ga0157369_121289404 | 3300013105 | Corn Rhizosphere | RVVIEALLFALAIILLGAVIWLGDAVAGGIESALGEKKMRDRDA* |
Ga0157374_114005344 | 3300013296 | Miscanthus Rhizosphere | FALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDA* |
Ga0157374_124232001 | 3300013296 | Miscanthus Rhizosphere | VTEALLFALAIILLGAVIWLGDAISSGIEHALGEKPLRDRDA* |
Ga0157378_104797554 | 3300013297 | Miscanthus Rhizosphere | LVTEIRFVTTALMFALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA* |
Ga0163162_102513693 | 3300013306 | Switchgrass Rhizosphere | LLFALAILLLGAVIWLGDAIAGGIESALGEKPLRDRDA* |
Ga0157372_103648113 | 3300013307 | Corn Rhizosphere | VGKRDFTENRRVINGLQFVLALILLGAVIWIGDAIAGGIDSALGEKKMRDRDA* |
Ga0157372_120911532 | 3300013307 | Corn Rhizosphere | VITGLQLVLAIVLLGLVIWAGDAIATGIESSLGEKPLRDRDP* |
Ga0157372_130625893 | 3300013307 | Corn Rhizosphere | VTEALLFALAIILLGAVIWLGDAVAGGIESALGEKPLRDRDI* |
Ga0157372_130849412 | 3300013307 | Corn Rhizosphere | MTALQLVLAIVLLGGMVWLGGALAGGIDAALGEKKLRDRDA* |
Ga0182000_101496272 | 3300014487 | Soil | VISALQLVLAILLIGGLVWVGDALAGGIESALGEKKMRDRDA* |
Ga0182008_106891422 | 3300014497 | Rhizosphere | VTEALLLALAIILLGAVIWVGDAIASGIDSALGEKKLRDRDA* |
Ga0167654_10253752 | 3300015084 | Glacier Forefield Soil | MLALAVILLGAIIWIGDAIAGGIESALGEKPLRDRDAKHL* |
Ga0167658_10910312 | 3300015195 | Glacier Forefield Soil | MFALAVLLLGAIIWVGDAIAGGIESALGEKPLRDRDAKHL* |
Ga0182006_12233043 | 3300015261 | Rhizosphere | VTDALLFVLAILLLGAVIWLGDAVAGGIESALGEKPLRDRDA* |
Ga0134073_101160531 | 3300015356 | Grasslands Soil | VIDALQFVLALVLLGAVIWLGDAVAGGIDSALGEKRRRDRDV* |
Ga0134072_104175251 | 3300015357 | Grasslands Soil | HRSREVINALQLVLAISLLGAVIWVGDAIAGGIDGALGEKPLRDRDA* |
Ga0132258_109712702 | 3300015371 | Arabidopsis Rhizosphere | VIIALQLVLGLLFLGAVIWIGDGIASGIESALGEKPLRDRDA* |
Ga0132258_128279401 | 3300015371 | Arabidopsis Rhizosphere | VIDALQLVLAIALLGAVIWIGDALSRGVDDALGEKKMRDRDV* |
Ga0132256_1026388191 | 3300015372 | Arabidopsis Rhizosphere | VITGLQLVLAICLLGLVVWVGDAIAGGIEGALGEKPM |
Ga0132257_1004812231 | 3300015373 | Arabidopsis Rhizosphere | LVIDALLFALAILLIGAVIWLGDAISGGIETALGEKPLRDRDA* |
Ga0132257_1009793041 | 3300015373 | Arabidopsis Rhizosphere | DKRKSRSRFVISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDA* |
Ga0132255_10001555914 | 3300015374 | Arabidopsis Rhizosphere | KSREKRLVINALQFALAIILLGAVIWIGDAIAGGIDSALGEKKMRDRDA* |
Ga0132255_1033688012 | 3300015374 | Arabidopsis Rhizosphere | VIIALQLVLGLLFLGAVIWIGDGIASGIDSALGEKKMRDRDA* |
Ga0132255_1035883982 | 3300015374 | Arabidopsis Rhizosphere | VIAALQLVLAILILGVVIWIGDALAGGIEAALGEKPLRDRDAPRR* |
Ga0132255_1046474922 | 3300015374 | Arabidopsis Rhizosphere | VIIALQLVLGLLFLGAVIWVGDGIASGIESALGEKPLRDRDA* |
Ga0132255_1047571412 | 3300015374 | Arabidopsis Rhizosphere | VINTLQLAIAILLLGAVIWMGDAIAGGIESALGEKKMRDRDA* |
Ga0134112_103318361 | 3300017656 | Grasslands Soil | VITALQLVLAIGILGLVVWIGDAVAGGIEAALGEKPIRDRDSSN |
Ga0187809_102096281 | 3300017937 | Freshwater Sediment | VITGLQLALAIVLLGAVIWIGDAVAGGIESALGEKPMRDRDA |
Ga0187785_103537783 | 3300017947 | Tropical Peatland | VTIALQLALAIILLGAVIWVGDAIAGGIDGALGEKKMRDRDAK |
Ga0066655_108736791 | 3300018431 | Grasslands Soil | VTSALQFALAIILVGAVIWAGDAIAGGIEGALGEKPLRDRDL |
Ga0066667_105935002 | 3300018433 | Grasslands Soil | VINALQLVLAISLLGAVIWVGDAIAGGIDGALGEKPLRDRDA |
Ga0066662_1000515510 | 3300018468 | Grasslands Soil | VIAALQFALAIILVGAIIWAGDAIAGGIEGALGEKPLRDRDL |
Ga0066662_100856424 | 3300018468 | Grasslands Soil | VTTALWFALALLLLGVIIWIGDTVAGGIESALGEKPLRDRDA |
Ga0066662_113146884 | 3300018468 | Grasslands Soil | VTTALLFALAVLLLGAVIWLGDTIAGGIESALGEKPLRDRDA |
Ga0066662_121956102 | 3300018468 | Grasslands Soil | VIAALQFALAIILVGVVIWIGDAIAGGIEDALGEKPIRDREL |
Ga0066662_127739582 | 3300018468 | Grasslands Soil | KQNHGKRLVIDALQLALALLMLGVVIWLGDAIAGGIEGALGEKKMRDRDA |
Ga0066669_109801722 | 3300018482 | Grasslands Soil | VTSALQFALAIILVGAVIWAGDAIAAGIEGALGEKPLRDRDP |
Ga0066669_119304802 | 3300018482 | Grasslands Soil | VIIALQLVLAIALLGAVIWIGDAIAGGIEGALGEKKMRDRDA |
Ga0190273_104687652 | 3300018920 | Soil | VTTALLFALGVLLLGAIIWIGDTIAGGIESALGEKPLRDRDA |
Ga0197907_107289584 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | RSRIVISALQLVSAILLLGGFVWVGDALARGMDSALGEKPLRDRDA |
Ga0206356_108011693 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | VISALQLVSAILLLGGFVWVGDALARGMDSALGEKPLRDRDA |
Ga0206353_115230462 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VITALQLVLAIVLLGGMVWVGGALAGGIDAALGEKKLRDRDA |
Ga0154015_16937002 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | VINALQLVLAIILLGLVIWAGDAIAGGIDGALGEKKMRDRDA |
Ga0213876_103743273 | 3300021384 | Plant Roots | VINALQFVVAIILLGAVIWVGDVIAGGIDSALGEKKMRDRDA |
Ga0213875_100342034 | 3300021388 | Plant Roots | VITALQLVLAIVLLGGMIWIGDLLAGSVDAALGEKKMRDRDA |
Ga0182009_103933993 | 3300021445 | Soil | VISALQLVLAIVLLGVVIWIGDALAGGIEAALGEKPLRDRDIGRP |
Ga0213880_101544582 | 3300021953 | Exposed Rock | VIEALQLALAVLLLGAIIWLGDAIAQGIDGALGEKKMRDRDA |
Ga0207697_100001003 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VIDALLLALAILIVGAIIWLGDTVSGGIENALGEKPLRDRDA |
Ga0207697_100074812 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDF |
Ga0207656_100007594 | 3300025321 | Corn Rhizosphere | VITGLQLVLAILVLGAVIWIGDAIAGGIDEALGEKPMRDRDA |
Ga0207656_101814582 | 3300025321 | Corn Rhizosphere | VTEALQLALAIILLGAVIWIGDMVAGGIDSALGEKKLRDRDA |
Ga0207682_101593673 | 3300025893 | Miscanthus Rhizosphere | LLFALAILLLGAVIWLGDAIAGGIESALGEKPLRDRDA |
Ga0207682_103135182 | 3300025893 | Miscanthus Rhizosphere | VITGLQLVLAILLLGGVIWIGDAVAGGIDDALGEKPMRDRD |
Ga0207682_106201042 | 3300025893 | Miscanthus Rhizosphere | VITALQLVLGILLLGLVVWAGDALAGGIEGALGEKKTRDRDA |
Ga0207642_101469163 | 3300025899 | Miscanthus Rhizosphere | VIDALLLALAILLVGAIIWLGDTVSGGIENALGEKPLRDRDA |
Ga0207642_105640073 | 3300025899 | Miscanthus Rhizosphere | VTTALMLALAVILLGAVIWVGDAVAGGIESALGEKPLRDRDA |
Ga0207642_107667142 | 3300025899 | Miscanthus Rhizosphere | SRFVISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDA |
Ga0207642_108409861 | 3300025899 | Miscanthus Rhizosphere | VTTALLFVLALILLGAVIWIGDAVAGGIESALGEKPMRDRDG |
Ga0207688_100885333 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VTDALLFALAILLLGAVIWLGDAIAGGIESALGEKPLRDRDA |
Ga0207688_101502511 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VINALQLAIAIILLGAVIWMGDTIAGGIESALGEKKMRDRDA |
Ga0207688_101722412 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTALMLALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA |
Ga0207680_100266015 | 3300025903 | Switchgrass Rhizosphere | VTTALMFALAVILLGVIIWVGDAVAGGIESALGEKPLRDRDF |
Ga0207680_100305984 | 3300025903 | Switchgrass Rhizosphere | VTDALLLALAILLLGAVIWLGDAIAGGIESALGEKPLRDRDA |
Ga0207680_101192254 | 3300025903 | Switchgrass Rhizosphere | VINALQLAIAILLLGAVIWMGDAIAGGIESALGEKKMRDRDA |
Ga0207680_109836022 | 3300025903 | Switchgrass Rhizosphere | MFALAVILLGAIIWVGDAIAGGIESALGEKPLRDRDS |
Ga0207647_100049725 | 3300025904 | Corn Rhizosphere | VTEALLLALAIILLGAVIWVGDAIAGGIDGALGEKKLRDRDA |
Ga0207647_100435132 | 3300025904 | Corn Rhizosphere | VINALQLALAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA |
Ga0207647_100541262 | 3300025904 | Corn Rhizosphere | VITGLQLVLAIVLLGLVIWAGDAIATGIESALGEKPLRDRDA |
Ga0207647_101451634 | 3300025904 | Corn Rhizosphere | VISALQLVIAILTVGGLVWAGDALAQGMDAALGEKPLRDRDA |
Ga0207647_103674693 | 3300025904 | Corn Rhizosphere | VTTAFLLALAVILLGAVIWIGDAIAGGIESALGEKPLRDRDA |
Ga0207647_105386801 | 3300025904 | Corn Rhizosphere | VITALQLVFAILTLGGLVWAGDALAQGMDAALGEKPLRDRDA |
Ga0207647_105707741 | 3300025904 | Corn Rhizosphere | VITGLQLVFAIVLLGAVIWIGDAIAGGIESALGEKPMRDRDA |
Ga0207647_106001843 | 3300025904 | Corn Rhizosphere | VIVGLQLVLAILLLGLVVWVGDAIAGGIDDTLGEKRLRDRD |
Ga0207645_1000310314 | 3300025907 | Miscanthus Rhizosphere | VIDALLFALAILLIGAVIWLGDAISGGIETALGEKPLRDRDA |
Ga0207645_102639284 | 3300025907 | Miscanthus Rhizosphere | MFALAVILLGVIIWVGDAVAGGIESALGEKPLRDRDF |
Ga0207645_111090811 | 3300025907 | Miscanthus Rhizosphere | MLALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA |
Ga0207705_100051328 | 3300025909 | Corn Rhizosphere | VTEALLFALAIILLGAVIWLGDAVAGGIESALGEKKMRDRDA |
Ga0207705_100159426 | 3300025909 | Corn Rhizosphere | VINGLQFVLALILLGAVIWIGDAIAGGIDSALGEKKMRDRDA |
Ga0207705_100672762 | 3300025909 | Corn Rhizosphere | VITALQLALGICLLGGVIWIGDQLAGGIEGALGEKKLRDRAPRSCA |
Ga0207705_101505571 | 3300025909 | Corn Rhizosphere | LALAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA |
Ga0207705_102487661 | 3300025909 | Corn Rhizosphere | RSRIVITGLQLVLAIVLLGLVIWAGDAIATGIESALGEKPLRDRDA |
Ga0207705_102846321 | 3300025909 | Corn Rhizosphere | VTEALQLALAIILLGAVIGIGDMVAGGIDSALGEKKLRDRDA |
Ga0207705_104616661 | 3300025909 | Corn Rhizosphere | VIDALLFALAILLIGAVIWLGDAVAGGIETALGEKPL |
Ga0207705_105821544 | 3300025909 | Corn Rhizosphere | VINALQFVLAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA |
Ga0207705_106257632 | 3300025909 | Corn Rhizosphere | VITGLELVLAIVLLGVIVWVGDAVAGGIDSALGETKLRDRDD |
Ga0207705_107653551 | 3300025909 | Corn Rhizosphere | VTEALQLALAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA |
Ga0207705_108597121 | 3300025909 | Corn Rhizosphere | VITALQLVLAIILLGGMIYIGDLLAGSIDAALGEPKMRDRDA |
Ga0207705_108916191 | 3300025909 | Corn Rhizosphere | VTTALMLALAVILLGAIIWIGDAVAGGIESALGEKP |
Ga0207705_109808501 | 3300025909 | Corn Rhizosphere | VINALQLALAIILLGAVIWLGDAIAGGIDSALGEK |
Ga0207705_111388222 | 3300025909 | Corn Rhizosphere | VIDALLLALAILLIGAVIWLGDAISSGIEHALGEKPLRDRDA |
Ga0207707_103302921 | 3300025912 | Corn Rhizosphere | SRRRFVITGLQLVLAILLLGLVIWVGDALSKGIEGALGDKPMRDRDL |
Ga0207695_103356031 | 3300025913 | Corn Rhizosphere | EALQLALALVLLGAVIWLGDAVAGSIDSALGEKKMRDRDA |
Ga0207695_112092254 | 3300025913 | Corn Rhizosphere | VITGLQLVLAIVLLGAVVWIGDAIAGGIESALGEKPLRDRDA |
Ga0207660_1000040028 | 3300025917 | Corn Rhizosphere | VISALQLVSAILILGGFVWVGDALARGMDAALGEKPLRDRDA |
Ga0207660_1000441813 | 3300025917 | Corn Rhizosphere | VISALQLVSAILLLGGFVWVGDALARGMDAALGEKPLRDRDA |
Ga0207657_101544631 | 3300025919 | Corn Rhizosphere | VITALQLVLALVLLGGMVWLGGALAGGIDAALGEKKLRDRDA |
Ga0207657_101641183 | 3300025919 | Corn Rhizosphere | VINALQLALAVILLGAVIWMGDAIAGGIESALGEKKMRDRDA |
Ga0207657_103826651 | 3300025919 | Corn Rhizosphere | VITGLQLVLAILLLGVVVWVGDAIARGIDGALGEKRMRDRDN |
Ga0207657_114058512 | 3300025919 | Corn Rhizosphere | VTTALMFALAVILLGAIIWIGDAVAGGIESALGEKPLRDRDA |
Ga0207649_100871344 | 3300025920 | Corn Rhizosphere | VITGLQLVLAIVLLGLVIWAGDAIATGIESALGEKPLRDRDT |
Ga0207649_107150071 | 3300025920 | Corn Rhizosphere | VITALQLVLAIGLLAALIWVGDALAGGIEGALGEK |
Ga0207649_110238474 | 3300025920 | Corn Rhizosphere | KSRRRFVITGLQLVLAILLLGLVIWVGDALSKGIEGALGDKPMRDRDL |
Ga0207649_110586591 | 3300025920 | Corn Rhizosphere | VISALQLVLAILLLGVVVWVGDAIAGGIESALGEKPLRERD |
Ga0207649_114015711 | 3300025920 | Corn Rhizosphere | LALAILLLGAAIWIGDVIAGGIDSALGEKKMRDRDA |
Ga0207652_107869051 | 3300025921 | Corn Rhizosphere | VTEALLFALAIILLGAVIWLGDAVAGGIESALGEKKMRDRD |
Ga0207694_104992103 | 3300025924 | Corn Rhizosphere | VITGLELVFAILLLGGVVWLGDTIAGGIDSALGEKRLRDRE |
Ga0207650_100437283 | 3300025925 | Switchgrass Rhizosphere | VIDALLFALAIIFLGAVIWLGDAVAGGIESALGEKPLRDRDA |
Ga0207650_104570303 | 3300025925 | Switchgrass Rhizosphere | VTDALLLALAIILLGAVIWLGDMIAGGIESALGEKKMRDRDA |
Ga0207659_113167562 | 3300025926 | Miscanthus Rhizosphere | VTTALMLALAVILLGAVIWVGDAVAGGIESALGEKPLRDR |
Ga0207700_102140281 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MVALQLALALMLLGAVIWLGDTVAGGIESALGEKKMRDRDA |
Ga0207700_113291501 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AGVTEKRLVTTALWFALALLLLGVIIWIGDTVAGGIESALGEKPLRDRDA |
Ga0207664_102435623 | 3300025929 | Agricultural Soil | VITGLQLVLAIALLGAVIWIGDAVAGGIESALGEKPMRDRDA |
Ga0207664_103092643 | 3300025929 | Agricultural Soil | MTSALQLVFAILTLGGLVWVGDALARGMDAALGEKPLRDRDA |
Ga0207664_106099694 | 3300025929 | Agricultural Soil | INALLLALAIILLGAVIWLGDMIAGGIDSALGEKKMRDRDA |
Ga0207664_116908331 | 3300025929 | Agricultural Soil | VINALLLALAIILLGAVIWLGDMIAGGIDSALGEKKMRDRDA |
Ga0207644_100131656 | 3300025931 | Switchgrass Rhizosphere | VTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDF |
Ga0207644_115185202 | 3300025931 | Switchgrass Rhizosphere | VITALQLVLAIGILGAVVWVGDAVAGGIEAALGEKPIRDRDASN |
Ga0207690_101092545 | 3300025932 | Corn Rhizosphere | VITGLQLVLAILLLGGVVWVGDAVAGGIDSALGEKR |
Ga0207690_102515234 | 3300025932 | Corn Rhizosphere | MTTALMFALAVILLGAIIWVGDAVAGGIESALGEK |
Ga0207690_103699933 | 3300025932 | Corn Rhizosphere | ALAIILLGAVIWIGDMVAGGIDSALGEKKLRDRDA |
Ga0207690_104647822 | 3300025932 | Corn Rhizosphere | VITGLQLVLAILLLGLVVWVGDAIAGGIDDTLGEKRLRDRD |
Ga0207690_108260933 | 3300025932 | Corn Rhizosphere | VISALQLVIAILTVGGLVWAGDALAQGMDAALGEKPLRDRD |
Ga0207690_109316432 | 3300025932 | Corn Rhizosphere | VISALQLVLAILLLGVVVWVGDAIAGGIESALGEKPLRDRDA |
Ga0207669_118464781 | 3300025937 | Miscanthus Rhizosphere | KSRSRFVISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDA |
Ga0207704_101236931 | 3300025938 | Miscanthus Rhizosphere | VTTALLFVLALILLGAVIWIGDAVAGGIESALGEKPMR |
Ga0207691_108249602 | 3300025940 | Miscanthus Rhizosphere | VTTALMFALAVILLGAIIWVGDAIAGGIESALGEKPLRDRDS |
Ga0207661_110872993 | 3300025944 | Corn Rhizosphere | VIIALQLVSAILLVGGVVWVGDALAREMDAALGEKPL |
Ga0207679_101161044 | 3300025945 | Corn Rhizosphere | VIAALQLVLAIGLLAALIWVGDALAGGIEGALGEKPMRDRDG |
Ga0207679_116853601 | 3300025945 | Corn Rhizosphere | FALAIILLGAVIWLGDAVAGGIESALGEKKMRDRDA |
Ga0207667_102181363 | 3300025949 | Corn Rhizosphere | VTEALLLALAIILLGAVIWIGDAIATGIDGALGETKLRDRDA |
Ga0207640_100418244 | 3300025981 | Corn Rhizosphere | VINALQFALAIILLGAVIWIGDAIAGGIDSALGEKKMRDRDA |
Ga0207640_102823532 | 3300025981 | Corn Rhizosphere | VTDALLLALAIILLGAVIWLGDAVAGGIESALGEKPLRDRDA |
Ga0207640_112111252 | 3300025981 | Corn Rhizosphere | VTDALLLALAILLLGAVIWLGDAIAGGIESALGEKPL |
Ga0207658_119232271 | 3300025986 | Switchgrass Rhizosphere | RKSRSRFVISALQLASAIVLLGAVIWVGDAIAGGIESALGEKKMRDRDA |
Ga0207677_106413903 | 3300026023 | Miscanthus Rhizosphere | VTTALMFALAVILLGVIIWVGDAVAGGIESALGEKPLRDR |
Ga0207702_101865591 | 3300026078 | Corn Rhizosphere | LQLALAIILLGAVIWIGDMVAGGIDSALGEKKLRDRDA |
Ga0207702_105887903 | 3300026078 | Corn Rhizosphere | VINALLLALAIILLGAVIWLGDLIAGGIDSALGEKKMRDRDA |
Ga0207702_106323713 | 3300026078 | Corn Rhizosphere | KSRRRFVITGLELVLAIVLLGVIVWVGDAVAGGIDSALGETKLRDRDD |
Ga0207702_113708943 | 3300026078 | Corn Rhizosphere | VTEALLLALAIILLGAVIWIGDAIASGIDSALGEKKLRDRDA |
Ga0207702_114412582 | 3300026078 | Corn Rhizosphere | VINALQLALAILLLGGIIWIGDAIAGGIDSALGEKKMRDRDA |
Ga0207702_125293513 | 3300026078 | Corn Rhizosphere | TEKRFVTEALLLALAIILLGAVIWVGDAIARGVDSALGETKLRDRDA |
Ga0207641_120103182 | 3300026088 | Switchgrass Rhizosphere | VITALQLVLGIGLLGAVIWIGDALAGGIEAALGEKPLRDRDATRR |
Ga0207698_100196828 | 3300026142 | Corn Rhizosphere | FALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA |
Ga0207698_101464901 | 3300026142 | Corn Rhizosphere | RRFVITGLQLVLAILLLGGVVWVGDAVAGGIDSALGEKRLRDRD |
Ga0207698_103251551 | 3300026142 | Corn Rhizosphere | ALQFVLAIILLGAVIWLGDAIAGGIDSALGEKKMRDRDA |
Ga0207698_106734993 | 3300026142 | Corn Rhizosphere | ISALQLVLAILLLGVVVWVGDAIAGGIESALGEKPLRDRDA |
Ga0207698_122123491 | 3300026142 | Corn Rhizosphere | VIIALQLVLGIMLLGGVIWIGDHLAGGIEGALGEKKLRDRDA |
Ga0209647_10246755 | 3300026319 | Grasslands Soil | VTTALLFALALLLLGAIIWIGDAVAGGVESALGEKPLRDRDV |
Ga0209059_10599972 | 3300026527 | Soil | VIDALQLALALLMLGVVIWLGDAIAGGIEGALGEKKMRDRDA |
Ga0209059_11686342 | 3300026527 | Soil | SALQFALAIILVGAVIWAGDAIAGGIEGALGEKPLRDRDL |
Ga0209059_13020231 | 3300026527 | Soil | VINALQLVLAIFLLGAVIWVGDAIAGGIDGALGEKPLRDRDF |
Ga0209474_107028841 | 3300026550 | Soil | VVNALQFALAIILVGAVIWAGDAIAGGIEGALGEKPLRDRDL |
Ga0207444_10158953 | 3300026900 | Soil | AAKWKSRRRVVIVGLQLVLAILLLGLVVWVGDAIAGGIDDTLGEKRLRDRD |
Ga0208525_10047093 | 3300027288 | Soil | VTIALQLALAIILLGAVIWVGDAVASGIDGALGEKKIRDRDI |
Ga0208525_10047096 | 3300027288 | Soil | IRFVTTALMFALAVILLGVIIWVGDAVAGGIESALGEKPLRDRDF |
Ga0209795_100358984 | 3300027718 | Agave | VTDALLLVLAIILLGVVIWLGDAIAGGIESALGEKKMRDRDA |
Ga0209796_100075685 | 3300027766 | Agave | MISALQLVSGILLLGGVVWVGDMLAREMDSALGEKRLRDRDA |
Ga0209796_100093783 | 3300027766 | Agave | VITALQLVSAILLFGGVVWVGDVLAREMDSALGDKPLRDRDG |
Ga0209796_100157213 | 3300027766 | Agave | VVTALQLVLAIVLLGGMIWLGDALSKGIDAALGEKKMRDRDA |
Ga0209796_100847253 | 3300027766 | Agave | MISALQLVFAILTLGGLVYVGDALARGMDAALGEKPLRDRDA |
Ga0209796_101810201 | 3300027766 | Agave | VITALQLVLAIGLLGGVIWVGDALAGGVEAALGEKPLRDRDA |
Ga0209810_10622602 | 3300027773 | Surface Soil | VTEALLLALAIILLGAVIWVGDAIATGIDSALGETKLRDRDA |
Ga0209810_10868861 | 3300027773 | Surface Soil | KAKSRSRFVIDALQLALALLLLGAVIWLGDAIAGGIDAALGEKKMRDRDA |
Ga0209810_11284124 | 3300027773 | Surface Soil | VITALQLVLAIGLLGAVVWVGDTLAGGIEAALGEKPLRDRDA |
Ga0209177_103544381 | 3300027775 | Agricultural Soil | VITGLELVFAILLLGGVVWVGDTIAGGIDSALGEKRLRD |
Ga0209580_100674564 | 3300027842 | Surface Soil | VIVALQLAVAFILLGVVIWVGDAVAGSIDSALGEKKMRDRDA |
Ga0209168_105596022 | 3300027986 | Surface Soil | VIEALQLALAVLLLGAVIWLGDVIAKGIDGALGEKKMRDRDVSGV |
Ga0268266_100137484 | 3300028379 | Switchgrass Rhizosphere | VIDALLFALAILLIGAVIWLGDAVAGGIENALGEKPLRDRDA |
Ga0268266_101438813 | 3300028379 | Switchgrass Rhizosphere | MTALQLVLAIVLLGGMIWLGGALAGSIDAALGEPKLRDRDA |
Ga0268265_123787101 | 3300028380 | Switchgrass Rhizosphere | MTTALMFALAVILLGAIIWVGDAVAGGIESALGEKPLRDRDA |
Ga0268264_122896522 | 3300028381 | Switchgrass Rhizosphere | VINALQLAIAIILLGAVIWIGDAIAGGIDSALGEKKMRDRDA |
Ga0268240_100137571 | 3300030496 | Soil | VIDALLLALGVLLLGAVIWLGDAIAGGIDAALGEKKMRDRDA |
Ga0268254_102379571 | 3300030515 | Agave | VVTGLQLVLGILVLGVVVWVGDAIAGGIESALGEKPLRDRDG |
Ga0268254_103039521 | 3300030515 | Agave | SALQLVTAILLLGGVVWVGDALAREMDAALGEKPLRDRDA |
(restricted) Ga0255311_11373842 | 3300031150 | Sandy Soil | FALAIILVGAVIWIGDAIAGGIEDALGEKPIRDRDH |
Ga0170824_1131612411 | 3300031231 | Forest Soil | VIIGLQLVLAIVLLGAVIWVGDAIAGGIESALGEKPM |
Ga0170818_1101313961 | 3300031474 | Forest Soil | VIVGLQLVLAIVLLGAVIWVGDAIAGGIESALGEKPMRDRDA |
Ga0307408_1004251403 | 3300031548 | Rhizosphere | VINALQLALAIILLGGVIWLGDVVAGGIESALGEKPLRDRDF |
Ga0310813_105595163 | 3300031716 | Soil | MTTALMFALAVLLLGAIIWIGDAVAGGIESALGEKPLRDRDA |
Ga0307405_120667332 | 3300031731 | Rhizosphere | VITALQLVLGILLLGLVIWAGDALAGGIEGALGEKKMRDRDV |
Ga0307413_107653344 | 3300031824 | Rhizosphere | VTEALMFALAIILLGAVIWLGDAVAGGIESALGEKKMRDRDA |
Ga0307410_100728823 | 3300031852 | Rhizosphere | VIDALLLALAIILLGAVIWLGDTIAGGIESALGEKKMRDRDA |
Ga0307406_107157771 | 3300031901 | Rhizosphere | VINALQLALAILLLGAVIWIGDAIAGGIDSALGEKKMRDRDA |
Ga0308175_1000948454 | 3300031938 | Soil | VIDALLLALAVLLLGAVIWLGDAIAGGIDAALGEKKMRDRDA |
Ga0308175_1001047504 | 3300031938 | Soil | VINALQFVLAIILLGAVIWLGDAIANGIDSALGEKKMRDRDA |
Ga0308175_1001242644 | 3300031938 | Soil | VITALQLVLAIVLLGGMVWIGDLLAGSIDAALGEKKMRDRDA |
Ga0308175_1001521894 | 3300031938 | Soil | VITALQLVLGIVLLGAVIWVGDALAGGIEAALGEKPLRDRDARRR |
Ga0308175_1001585942 | 3300031938 | Soil | VINALQLVLAIVLLGGVIWLGDAVAGGIDSALGEKKMRDRDA |
Ga0308175_1001931352 | 3300031938 | Soil | VITALQLVLAIVLLGGMIWIGDLLAGSIDAALGEPKMRDRDA |
Ga0308175_1002725742 | 3300031938 | Soil | VTDALMLSLAILLLGAVIWAGDAIAGGIESALGEPPLRDRDS |
Ga0308175_1002953454 | 3300031938 | Soil | VTTALMLALAVLLLGAIIWIGDTIAGGIESALGEKPLRDRDA |
Ga0308175_1004115542 | 3300031938 | Soil | VITGLELVFAILLLGGVVWVGDAIAGGIDSALGEKRLRDRE |
Ga0308175_1004877204 | 3300031938 | Soil | VIVALQLVLGIGLLGAVVWVGDSVAGGIESALGEKKMRDRDA |
Ga0308175_1006250973 | 3300031938 | Soil | VINALQLALAIILLGAVIWIGDAIAGGIDSALGEKKMRDRDA |
Ga0308175_1006767163 | 3300031938 | Soil | VITALQLVLAIVLLGGMIWIGDVLAGSIDAALGEPKMRDRDA |
Ga0308175_1009120273 | 3300031938 | Soil | VIDAFQFVFALILLGAVIWLGDAIAGGIDSALGEKRLRDRDI |
Ga0308175_1013726782 | 3300031938 | Soil | VISALQLVLAIASLAAIIWIGDALAGGVEAALGEKPLRDRDA |
Ga0308175_1014592293 | 3300031938 | Soil | VIAGLQLVLAIILLGLVIWAGDAIARGIESALGEKPLRDRDA |
Ga0308175_1024367353 | 3300031938 | Soil | VITGLQLVLAILLLGLVIWVGDALSKGIEGALGDKPMRDRDL |
Ga0308175_1024588882 | 3300031938 | Soil | VTEALQLALAILLLGAVIWLGDAIAGGIDSALGEKKMRDRDA |
Ga0308175_1029404691 | 3300031938 | Soil | VINALQLALAVLLLGGIIWIGDAIAGGIDSALGEKKMRDRDA |
Ga0308174_100004479 | 3300031939 | Soil | VITALQLILGIGLLGGVIWIGDALAGGIEGALGEKKLRDRDA |
Ga0308174_101261804 | 3300031939 | Soil | VITALQLVLAIGLLGGVIWVGDALAGGLEAALGEKPLRDRDA |
Ga0308174_104767663 | 3300031939 | Soil | VISALQLVLAIFLLGLIVWVGDAVARGIESALGEKPMRDRD |
Ga0308174_109894802 | 3300031939 | Soil | VLAILLLGVVVWVGDAIAGGIESALGEKPLRDRDA |
Ga0308174_110381272 | 3300031939 | Soil | LLLVLAIILLGAVIWLGDAVAGGIESALGEKPLRDRDG |
Ga0308174_118282352 | 3300031939 | Soil | VIDALQLALAVLLLGAVIWLGDAVAGGIDAALGEKKMRDRDA |
Ga0307409_1024885041 | 3300031995 | Rhizosphere | MFALAIILLGAVIWLGDAVASGIESALGEKKMRDRDA |
Ga0308176_101116302 | 3300031996 | Soil | VVDALLLALAVLLLGAVIWLGDAVAGGIDAALGEKKMRDRDA |
Ga0308176_104886813 | 3300031996 | Soil | VIAGLQLVFAILLLGAVVWVGDAIAGGIEGALGEKPLRDRD |
Ga0308176_106276584 | 3300031996 | Soil | TRGRIVTEALQLALAIILLGAVIWIGDMVAGGIDSALGEKKLRDRDA |
Ga0308176_111038142 | 3300031996 | Soil | VITGLQLVLAILLLGLVVWVGDAIAGGIDDTLGEKR |
Ga0308176_111440391 | 3300031996 | Soil | LITGLQLVLAILLLGVVIWVGDFLSKGIEGALGDKPMRDRDL |
Ga0308176_113913523 | 3300031996 | Soil | VIDAFQFMFALILLGAVIWLGDAIAGGIDSALGEKRLRDRDI |
Ga0308176_117850571 | 3300031996 | Soil | VISALQLVLAILLLGLIVWVGDAVARGIESALGEKPMRDRD |
Ga0308176_118933722 | 3300031996 | Soil | MIALQLVLGIGLLGAVIWIGDKLAAGLEGALGEKKLRDRDA |
Ga0308176_128065741 | 3300031996 | Soil | RKSRRRFVITGLQLVLAILLLGLVVWVGDAIAGGIDDTLGEKRLRDRD |
Ga0308173_101662934 | 3300032074 | Soil | VITGLELVFAILLLGGVVWVGDAIAGGIDSALGEKRL |
Ga0308173_102983481 | 3300032074 | Soil | LRVQHIAVKRKSRSRFVNDALLLVLAIILLGAVIWLGDAVAGGIESALGEKPLRDRDG |
Ga0308173_103177283 | 3300032074 | Soil | VIAGLQLVVAILLLGVVVWVGDAIAGGIESALGEKPLRDRDA |
Ga0308173_104599251 | 3300032074 | Soil | VTTALLFALAVLLLGAIIWIGDAVAGGIESALGEK |
Ga0308173_110058102 | 3300032074 | Soil | LSLLTNRGERFVITALQLVLAIVLLGGMIWIGDLLAGSIDAALGEPKMRDRDA |
Ga0308173_110313023 | 3300032074 | Soil | VIDALQLALAVLILGAVIWLGDAVAGGIDAALGEKKMRDRDA |
Ga0310810_103187084 | 3300033412 | Soil | VISALQLVLGILLIGGLVWAGDALAGGIESALGEKPLRDRDA |
Ga0310811_108735144 | 3300033475 | Soil | VISALQLVLGILLIGGLVWAGDALADGIESALGEKPLRDRDA |
Ga0372943_0358701_595_708 | 3300034268 | Soil | MLALAVLLLGAVIWIGDAIAGGIESALGEKPLRDRDA |
Ga0372943_0860854_401_529 | 3300034268 | Soil | VIAALQFALAIILVGIVIWIGDAIAGGIEDALGEKPMRERDL |
⦗Top⦘ |