NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F002691

Metagenome / Metatranscriptome Family F002691

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F002691
Family Type Metagenome / Metatranscriptome
Number of Sequences 536
Average Sequence Length 136 residues
Representative Sequence MHVSGYNGADEDEIMDNIFSRFSNEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPAEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGQLNKFAAAPGSIGDLTSGGTNYPLPYPAGSEATPVGAV
Number of Associated Samples 325
Number of Associated Scaffolds 536

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 17.94 %
% of genes near scaffold ends (potentially truncated) 43.47 %
% of genes from short scaffolds (< 2000 bps) 99.81 %
Associated GOLD sequencing projects 303
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.627 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(30.970 % of family members)
Environment Ontology (ENVO) Unclassified
(67.351 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(78.358 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.36%    β-sheet: 9.04%    Coil/Unstructured: 50.60%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.81 %
UnclassifiedrootN/A0.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000127|SA_S1_NOR05_45mDRAFT_c10058520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum958Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10171105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10070204All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum983Open in IMG/M
3300001354|JGI20155J14468_10093236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1083Open in IMG/M
3300002408|B570J29032_108891289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300002776|Ga0005234J37281_1045921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300003677|Ga0008458J53046_104778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300004507|Ga0008280_1128826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter pasteurianus604Open in IMG/M
3300004507|Ga0008280_1129868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300004788|Ga0007742_11050791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300005599|Ga0066841_10033437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum815Open in IMG/M
3300005662|Ga0078894_11542739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300005838|Ga0008649_10320320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300006355|Ga0075501_1326486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300006355|Ga0075501_1344537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300006356|Ga0075487_1021448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300006356|Ga0075487_1375316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300006357|Ga0075502_1560994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300006366|Ga0075499_1206989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300006382|Ga0075494_1006224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300006383|Ga0075504_1358669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300006390|Ga0075509_1427962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300006399|Ga0075495_1538056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300006399|Ga0075495_1577889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300006400|Ga0075503_1382135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300006401|Ga0075506_1631334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300006401|Ga0075506_1723963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300006404|Ga0075515_10524781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300006405|Ga0075510_10621240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300006602|Ga0075484_1506764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300006602|Ga0075484_1523095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300006850|Ga0075491_1443636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300007715|Ga0102827_1152976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300007725|Ga0102951_1075346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum968Open in IMG/M
3300007725|Ga0102951_1117284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum752Open in IMG/M
3300007863|Ga0105744_1158146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300008832|Ga0103951_10478717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300008832|Ga0103951_10518477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300008919|Ga0103484_1009906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300008922|Ga0103487_1010526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300008931|Ga0103734_1044002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300008932|Ga0103735_1059837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300008936|Ga0103739_1045260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300008938|Ga0103741_1119771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300008938|Ga0103741_1126418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300008958|Ga0104259_1022489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300008958|Ga0104259_1033586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300008993|Ga0104258_1070186All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300008993|Ga0104258_1098280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300008993|Ga0104258_1113453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300009022|Ga0103706_10085546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300009025|Ga0103707_10080393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300009054|Ga0102826_1076469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300009071|Ga0115566_10242848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1081Open in IMG/M
3300009071|Ga0115566_10429927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum757Open in IMG/M
3300009193|Ga0115551_1236817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum810Open in IMG/M
3300009193|Ga0115551_1244609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300009195|Ga0103743_1039045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300009195|Ga0103743_1057142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300009216|Ga0103842_1024324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300009263|Ga0103872_1017690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum834Open in IMG/M
3300009263|Ga0103872_1071610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300009274|Ga0103878_1014102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300009276|Ga0103879_10056325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300009279|Ga0103880_10059839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300009420|Ga0114994_10721302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300009422|Ga0114998_10211904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum919Open in IMG/M
3300009432|Ga0115005_10728759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum797Open in IMG/M
3300009432|Ga0115005_10730812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300009432|Ga0115005_11318064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300009432|Ga0115005_11612610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300009436|Ga0115008_10305821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1128Open in IMG/M
3300009436|Ga0115008_10591755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum798Open in IMG/M
3300009436|Ga0115008_10953034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300009436|Ga0115008_11146863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300009436|Ga0115008_11557156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300009440|Ga0115561_1294501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300009441|Ga0115007_10696707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300009441|Ga0115007_10726925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300009441|Ga0115007_11247555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300009466|Ga0126448_1048976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum976Open in IMG/M
3300009466|Ga0126448_1074280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300009495|Ga0115571_1337888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300009497|Ga0115569_10406265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300009498|Ga0115568_10354967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300009505|Ga0115564_10491220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300009543|Ga0115099_10279438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum772Open in IMG/M
3300009543|Ga0115099_10673863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300009544|Ga0115006_11503786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300009592|Ga0115101_1298011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300009592|Ga0115101_1584063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum759Open in IMG/M
3300009599|Ga0115103_1085101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300009599|Ga0115103_1323110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum713Open in IMG/M
3300009599|Ga0115103_1403617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300009599|Ga0115103_1482338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum933Open in IMG/M
3300009599|Ga0115103_1690199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300009599|Ga0115103_1753721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300009606|Ga0115102_10068748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300009606|Ga0115102_10805570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300009608|Ga0115100_10499386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300009677|Ga0115104_10156965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300009677|Ga0115104_10377642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300009677|Ga0115104_10469346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300009677|Ga0115104_10588128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300009677|Ga0115104_10800571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300009679|Ga0115105_10308910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300009679|Ga0115105_10635575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300009679|Ga0115105_10767708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300009747|Ga0123363_1039464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300009785|Ga0115001_10506601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300010135|Ga0123382_1188635All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300010306|Ga0129322_1000519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300010981|Ga0138316_10702964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300010981|Ga0138316_11096096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300010981|Ga0138316_11113193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300010985|Ga0138326_10240315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300010985|Ga0138326_10892523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300010985|Ga0138326_12122057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300010987|Ga0138324_10412025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300010987|Ga0138324_10588798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300012030|Ga0136599_1021814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum922Open in IMG/M
3300012036|Ga0136600_1062509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum850Open in IMG/M
3300012408|Ga0138265_1134147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300012412|Ga0138266_1272260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300012412|Ga0138266_1298091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300012414|Ga0138264_1625920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300012414|Ga0138264_1670281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300012415|Ga0138263_1781221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300012417|Ga0138262_1665894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300012470|Ga0129329_1015808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300012471|Ga0129334_1107238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300012516|Ga0129325_1368987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300012518|Ga0129349_1126474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300012518|Ga0129349_1147966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300012518|Ga0129349_1392602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300012522|Ga0129326_1125920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum841Open in IMG/M
3300012523|Ga0129350_1358835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300012524|Ga0129331_1053129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300012524|Ga0129331_1135228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300012709|Ga0157608_1056745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300012715|Ga0157599_1162315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300012717|Ga0157609_1075603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300012782|Ga0138268_1191133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300012967|Ga0129343_1259678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300012969|Ga0129332_1072580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300013010|Ga0129327_10370125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum754Open in IMG/M
3300016724|Ga0182048_1057495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300016727|Ga0182051_1105469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300016735|Ga0182074_1038899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300016737|Ga0182047_1033240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300016739|Ga0182076_1283732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300016748|Ga0182043_1139702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum756Open in IMG/M
3300016766|Ga0182091_1390184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300016776|Ga0182046_1574567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300016791|Ga0182095_1877628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300017768|Ga0187220_1194184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300017818|Ga0181565_10356013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum973Open in IMG/M
3300017949|Ga0181584_10434691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum817Open in IMG/M
3300017949|Ga0181584_10864857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300017951|Ga0181577_10337923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum970Open in IMG/M
3300017951|Ga0181577_10972485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300018410|Ga0181561_10202378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum973Open in IMG/M
3300018418|Ga0181567_10530307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300018428|Ga0181568_10592860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum875Open in IMG/M
3300018515|Ga0192960_104088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300018599|Ga0188834_1026547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300018602|Ga0193182_1014209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum707Open in IMG/M
3300018617|Ga0193133_1015934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300018628|Ga0193355_1017092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300018628|Ga0193355_1019071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300018628|Ga0193355_1021865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300018628|Ga0193355_1021920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300018649|Ga0192969_1029821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum856Open in IMG/M
3300018671|Ga0193571_1011176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300018674|Ga0193166_1013022All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300018684|Ga0192983_1047194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300018692|Ga0192944_1024821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum856Open in IMG/M
3300018692|Ga0192944_1033530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300018692|Ga0192944_1036448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum713Open in IMG/M
3300018741|Ga0193534_1047183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300018742|Ga0193138_1031470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300018742|Ga0193138_1032338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300018742|Ga0193138_1043894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300018745|Ga0193000_1038580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum720Open in IMG/M
3300018745|Ga0193000_1060034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300018745|Ga0193000_1069828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300018749|Ga0193392_1036262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300018763|Ga0192827_1082103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300018765|Ga0193031_1046473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300018765|Ga0193031_1057549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum652Open in IMG/M
3300018765|Ga0193031_1062253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300018779|Ga0193149_1058813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300018796|Ga0193117_1058198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300018796|Ga0193117_1081144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300018800|Ga0193306_1050188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300018812|Ga0192829_1071284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300018812|Ga0192829_1086063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300018823|Ga0193053_1042883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300018823|Ga0193053_1052733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300018823|Ga0193053_1078910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300018832|Ga0194240_1006503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum855Open in IMG/M
3300018832|Ga0194240_1032602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300018838|Ga0193302_1074276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300018842|Ga0193219_1077468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300018846|Ga0193253_1067241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum876Open in IMG/M
3300018846|Ga0193253_1078956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300018846|Ga0193253_1111940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300018846|Ga0193253_1122406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300018846|Ga0193253_1122649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300018846|Ga0193253_1134802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300018861|Ga0193072_1072493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300018862|Ga0193308_1078158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300018871|Ga0192978_1063434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300018871|Ga0192978_1066851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300018871|Ga0192978_1077603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300018871|Ga0192978_1085569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300018871|Ga0192978_1090485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018874|Ga0192977_1076688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300018874|Ga0192977_1096718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300018874|Ga0192977_1110518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300018880|Ga0193337_1044042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300018882|Ga0193471_1085466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300018882|Ga0193471_1102905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300018913|Ga0192868_10075629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300018913|Ga0192868_10092415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300018926|Ga0192989_10114750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300018928|Ga0193260_10137297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300018967|Ga0193178_10030584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum739Open in IMG/M
3300018967|Ga0193178_10035580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300018974|Ga0192873_10438790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300018975|Ga0193006_10210631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300018975|Ga0193006_10246075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300018979|Ga0193540_10116962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300018980|Ga0192961_10167169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300018981|Ga0192968_10175044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300018982|Ga0192947_10170673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300018982|Ga0192947_10276533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300018988|Ga0193275_10160629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300018989|Ga0193030_10099177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum892Open in IMG/M
3300018989|Ga0193030_10167147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300018989|Ga0193030_10172326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum707Open in IMG/M
3300018989|Ga0193030_10228669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300018989|Ga0193030_10276382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300018989|Ga0193030_10281659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300018989|Ga0193030_10315663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300019001|Ga0193034_10057790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum811Open in IMG/M
3300019001|Ga0193034_10152520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300019001|Ga0193034_10184642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300019001|Ga0193034_10184889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300019010|Ga0193044_10256341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300019021|Ga0192982_10192718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum725Open in IMG/M
3300019021|Ga0192982_10221633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300019021|Ga0192982_10324340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300019024|Ga0193535_10206038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300019024|Ga0193535_10282666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300019025|Ga0193545_10076296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300019027|Ga0192909_10132507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300019027|Ga0192909_10247464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300019031|Ga0193516_10234276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300019031|Ga0193516_10253073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300019031|Ga0193516_10292917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300019031|Ga0193516_10300298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300019032|Ga0192869_10198967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum851Open in IMG/M
3300019032|Ga0192869_10259501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300019032|Ga0192869_10320473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300019033|Ga0193037_10201716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300019033|Ga0193037_10214958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300019033|Ga0193037_10308774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300019036|Ga0192945_10185553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300019036|Ga0192945_10241708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300019036|Ga0192945_10282064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300019037|Ga0192886_10273431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300019039|Ga0193123_10426927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300019045|Ga0193336_10182524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300019045|Ga0193336_10223210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300019045|Ga0193336_10467785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300019045|Ga0193336_10479974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300019048|Ga0192981_10232270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300019048|Ga0192981_10232285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300019048|Ga0192981_10274722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300019048|Ga0192981_10348351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300019049|Ga0193082_10717181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300019051|Ga0192826_10211629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300019051|Ga0192826_10237501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300019051|Ga0192826_10265453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300019051|Ga0192826_10310424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300019051|Ga0192826_10324490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300019051|Ga0192826_10324713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300019051|Ga0192826_10333172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300019051|Ga0192826_10375401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300019051|Ga0192826_10387479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300019081|Ga0188838_114914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300019095|Ga0188866_1018156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300019095|Ga0188866_1019829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300019095|Ga0188866_1020954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300019095|Ga0188866_1023354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300019095|Ga0188866_1023482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300019095|Ga0188866_1023928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300019095|Ga0188866_1024461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300019097|Ga0193153_1023816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300019099|Ga0193102_1027030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300019118|Ga0193157_1016520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300019118|Ga0193157_1035596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300019118|Ga0193157_1036337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300019123|Ga0192980_1063092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300019123|Ga0192980_1079626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300019129|Ga0193436_1053673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300019133|Ga0193089_1123942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300019133|Ga0193089_1138364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300019139|Ga0193047_1125076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300019149|Ga0188870_10126279All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300019150|Ga0194244_10022420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum858Open in IMG/M
3300019150|Ga0194244_10023121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum851Open in IMG/M
3300019150|Ga0194244_10059478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300019272|Ga0182059_1115771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300019272|Ga0182059_1463105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300019272|Ga0182059_1539472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300019272|Ga0182059_1731160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300019281|Ga0182077_1495483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300019282|Ga0182075_1051562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300020165|Ga0206125_10190553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum804Open in IMG/M
3300020422|Ga0211702_10270527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300020566|Ga0208222_1066779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300020595|Ga0206126_10258312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300021085|Ga0206677_10178613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum925Open in IMG/M
3300021085|Ga0206677_10277870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum679Open in IMG/M
3300021169|Ga0206687_1026032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300021169|Ga0206687_1221191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum757Open in IMG/M
3300021169|Ga0206687_1283136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300021169|Ga0206687_1335501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300021169|Ga0206687_1379278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300021169|Ga0206687_1733919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300021169|Ga0206687_1827307All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300021325|Ga0210301_1405927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300021342|Ga0206691_1102003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum878Open in IMG/M
3300021342|Ga0206691_1103289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300021345|Ga0206688_10032334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300021345|Ga0206688_10219382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300021345|Ga0206688_10571642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300021345|Ga0206688_10629271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300021347|Ga0213862_10220161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300021348|Ga0206695_1114667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300021348|Ga0206695_1654013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300021350|Ga0206692_1412832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300021350|Ga0206692_1885029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum729Open in IMG/M
3300021353|Ga0206693_1057952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300021353|Ga0206693_1328233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300021353|Ga0206693_1944624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300021355|Ga0206690_10230116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300021359|Ga0206689_10454092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300021359|Ga0206689_11106052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300021359|Ga0206689_11116969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300021359|Ga0206689_11126621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300021365|Ga0206123_10158571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1031Open in IMG/M
3300021368|Ga0213860_10335126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300021371|Ga0213863_10289753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300021389|Ga0213868_10531450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300021872|Ga0063132_102063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300021872|Ga0063132_107028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300021881|Ga0063117_1033212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300021886|Ga0063114_1034519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300021889|Ga0063089_1043962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300021890|Ga0063090_1083156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300021893|Ga0063142_1057035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300021910|Ga0063100_1088170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300021912|Ga0063133_1016073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300021913|Ga0063104_1036707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300021913|Ga0063104_1067173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300021924|Ga0063085_1044383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300021925|Ga0063096_1006683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300021925|Ga0063096_1070213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300021927|Ga0063103_1055523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300021927|Ga0063103_1128309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300021930|Ga0063145_1034093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300021932|Ga0063872_1040397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300021934|Ga0063139_1091676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300021934|Ga0063139_1201294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300021950|Ga0063101_1046125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300021950|Ga0063101_1063446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300021954|Ga0063755_1071219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300021954|Ga0063755_1100729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300021954|Ga0063755_1118841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300021954|Ga0063755_1118842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300021957|Ga0222717_10251392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1026Open in IMG/M
3300021959|Ga0222716_10428543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300021959|Ga0222716_10563009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300021960|Ga0222715_10271259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum977Open in IMG/M
3300022369|Ga0210310_1034413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300022934|Ga0255781_10386901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300023084|Ga0255778_10364618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300023173|Ga0255776_10516063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300023175|Ga0255777_10365893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum790Open in IMG/M
3300023679|Ga0232113_1028559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300023683|Ga0228681_1046739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300023685|Ga0228686_1063577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300023694|Ga0228683_1024217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300023696|Ga0228687_1044490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300023698|Ga0228682_1053718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300023704|Ga0228684_1067341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300023704|Ga0228684_1076199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300023704|Ga0228684_1083053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300024335|Ga0228672_1130184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300024343|Ga0244777_10796332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300024417|Ga0228650_1197106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300025570|Ga0208660_1127009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300025626|Ga0209716_1095646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum855Open in IMG/M
3300025626|Ga0209716_1136821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300025690|Ga0209505_1156061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300025809|Ga0209199_1263698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300025886|Ga0209632_10270161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300026130|Ga0209961_1052838All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300026448|Ga0247594_1071418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300026462|Ga0247568_1104623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300026466|Ga0247598_1119616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300026466|Ga0247598_1158115All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300026470|Ga0247599_1114180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300026471|Ga0247602_1131458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300026500|Ga0247592_1129877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300026503|Ga0247605_1146487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300026504|Ga0247587_1183159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300027771|Ga0209279_10188983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300027833|Ga0209092_10544513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300027849|Ga0209712_10371362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum807Open in IMG/M
3300027849|Ga0209712_10669001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300027849|Ga0209712_10778152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300028137|Ga0256412_1241660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300028137|Ga0256412_1242782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300028137|Ga0256412_1253600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300028137|Ga0256412_1274509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300028137|Ga0256412_1334385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300028233|Ga0256417_1195424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300028279|Ga0228613_1073077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum809Open in IMG/M
3300028282|Ga0256413_1180776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum760Open in IMG/M
3300028405|Ga0306909_113674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum839Open in IMG/M
3300028412|Ga0306910_1028149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum922Open in IMG/M
3300028575|Ga0304731_10190604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300028575|Ga0304731_10223749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300028575|Ga0304731_10431614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300028575|Ga0304731_10893623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300028575|Ga0304731_10924984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300030653|Ga0307402_10807857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300030671|Ga0307403_10755597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300030671|Ga0307403_10820494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300030699|Ga0307398_10657722All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300030699|Ga0307398_10734699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300030699|Ga0307398_10761773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300030709|Ga0307400_10961047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300030721|Ga0308133_1029119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum754Open in IMG/M
3300030722|Ga0308137_1064567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300030756|Ga0073968_11791659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300030780|Ga0073988_12344408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300030786|Ga0073966_11174048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300030856|Ga0073990_10008797All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum764Open in IMG/M
3300030856|Ga0073990_11996336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300030857|Ga0073981_11650037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300030948|Ga0073977_1607948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300031004|Ga0073984_11248970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300031004|Ga0073984_11254616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum817Open in IMG/M
3300031004|Ga0073984_11281318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300031005|Ga0073974_1292266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300031032|Ga0073980_11357494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300031038|Ga0073986_12027315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300031062|Ga0073989_10006668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300031062|Ga0073989_13557463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum652Open in IMG/M
3300031062|Ga0073989_13616514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300031522|Ga0307388_10913464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300031523|Ga0307492_10241246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300031569|Ga0307489_10254990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1114Open in IMG/M
3300031579|Ga0308134_1092386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300031579|Ga0308134_1107850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300031579|Ga0308134_1150978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300031580|Ga0308132_1104205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300031589|Ga0307996_1137908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300031626|Ga0302121_10067541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1084Open in IMG/M
3300031717|Ga0307396_10567513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300031717|Ga0307396_10594545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300031725|Ga0307381_10207611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300031725|Ga0307381_10363300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300031725|Ga0307381_10391931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300031729|Ga0307391_10564195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300031729|Ga0307391_10655195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300031729|Ga0307391_10778256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300031729|Ga0307391_10823614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300031729|Ga0307391_10909927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300031734|Ga0307397_10367566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300031734|Ga0307397_10383706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300031735|Ga0307394_10322880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300031735|Ga0307394_10332061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300031735|Ga0307394_10373199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300031735|Ga0307394_10391625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300031735|Ga0307394_10401280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300031737|Ga0307387_10845779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300031738|Ga0307384_10356507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300031739|Ga0307383_10350977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum720Open in IMG/M
3300031739|Ga0307383_10443134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300031739|Ga0307383_10633620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300031739|Ga0307383_10679000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300031742|Ga0307395_10403756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300031742|Ga0307395_10477466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300031742|Ga0307395_10518563All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300031743|Ga0307382_10457757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300031752|Ga0307404_10467849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300032275|Ga0315270_10610532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300032470|Ga0314670_10594173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300032491|Ga0314675_10540766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300032492|Ga0314679_10447261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300032492|Ga0314679_10569794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300032517|Ga0314688_10485947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300032517|Ga0314688_10770028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300032518|Ga0314689_10685447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300032520|Ga0314667_10719286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300032521|Ga0314680_10657459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300032521|Ga0314680_11030084All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300032522|Ga0314677_10565085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300032540|Ga0314682_10703654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300032615|Ga0314674_10585172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300032616|Ga0314671_10669580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300032616|Ga0314671_10755525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300032617|Ga0314683_10631004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300032650|Ga0314673_10487958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300032666|Ga0314678_10576239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300032708|Ga0314669_10774506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300032724|Ga0314695_1407068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300032728|Ga0314696_10512900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300032728|Ga0314696_10557479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300032733|Ga0314714_10730976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300032743|Ga0314707_10517663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300032745|Ga0314704_10473568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum691Open in IMG/M
3300032746|Ga0314701_10508618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300032750|Ga0314708_10283526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum813Open in IMG/M
3300032751|Ga0314694_10518710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300032755|Ga0314709_10740974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300033572|Ga0307390_10865098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300033572|Ga0307390_10964359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300034105|Ga0335035_0464124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine30.97%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine23.51%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.16%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.97%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.41%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.04%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.43%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake2.24%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.49%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.31%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.31%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.93%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.75%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.75%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.75%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.56%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.56%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.37%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.37%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.37%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond0.37%
Bay WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water0.37%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.19%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.19%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.19%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.19%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.19%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.19%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.19%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.19%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.19%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000127Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45mEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002776Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_150m_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004788Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005599Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91AEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006366Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006602Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006850Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008919Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NA1EnvironmentalOpen in IMG/M
3300008922Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB2EnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009279Eukaryotic communities of water from the North Atlantic ocean - ACM42EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009466Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009747Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_197_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010135Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_257_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010306Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012030Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697EnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012715Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300016724Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011507AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016727Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016739Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016791Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018671Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018882Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002185 (ERX1789654-ERR1719480)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019081Metatranscriptome of marine microbial communities from Baltic Sea - GS676_3p0_dTEnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019139Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001430 (ERX1809743-ERR1740120)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023084Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaGEnvironmentalOpen in IMG/M
3300023173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaGEnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024335Seawater microbial communities from Monterey Bay, California, United States - 90DEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024417Seawater microbial communities from Monterey Bay, California, United States - 62DEnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027771Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028279Seawater microbial communities from Monterey Bay, California, United States - 14DEnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028405Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697 (v2)EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030722Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_943_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030786Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR05_45mDRAFT_1005852013300000127MarineMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKMLMKDDAKLAAGQILEAAHFLKPEEVPDFLNTNFEGSWEHFDQNHEGWIRYEETHTFQRFIQGTLNKFALAPGSISDMASGGAAYGTIVPAGTSVISVGNQ*
SA_S1_NOR08_45mDRAFT_1017110513300000128MarineGLTSTGHKTGQKMLMKDDAKLAAGQILEAAHFLKPEEVPDFLNTNFEGSWEHFDQNHEGWIRYEETHTFQRFIQGTLNKFALAPGSISDMASGGAAYGTIVPAGTSVISVGNQ*
KGI_S1_ANT02_95mDRAFT_1007020423300000136MarineMHVSGYNGADEDEIMDNVYSRFSREGETPSGHKTGQKLLMKDDAKLASGTVLEAAHKLTPGQVPAYMNANFETAWSHFDQNHEGWIRYEETHTFQRFLQGGLNKFSNAPGSIMDLSSGGATYPLPYPQGSEQTPVGQV*
JGI20155J14468_1009323613300001354Pelagic MarineMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDAVPVSHV*ANL*RV*
B570J29032_10889128913300002408FreshwaterYTHKDTHISGYNGADEDEIYDNIFSRFSKEGLTPSGHKTGQKLLMKDDAKIASGQSLEAAHWLSPSEVPSYLDANFENAWNHYDQNGEGWIRYEETHVFFRYLLGKLNRFTGAPGSISDLSSGGKAYKLHYSTTKREKTPVGAV*SI*
Ga0005234J37281_104592113300002776MarineMILSGYNGADEDEIMDNVFARYSKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLKPSEVPGWLDTNFEAAWSHFDQNHEGWIRYEETHTFQRFLMGSLNNFALAPGTLSDMTSGGKAYPLPSPVGSEAIAVGAV*
Ga0008458J53046_10477813300003677SeawaterMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDAVPVSHV*
Ga0008280_112882613300004507MarineDNIFSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGTILEAAHKLAPAAVPAYMDANFENAWNHFDQNKEGWIRYEESHTMQRYLQGKLNKLDGAAGSIGDLASGGDKYNTLPAGDAATPVGAVAATAATTPA*
Ga0008280_112986813300004507MarineMKISGYNGADEDEIMDNVYGRYSKEGRTTSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKSWDHFDQNHEGWIRYEETHTFQRFLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV*
Ga0007742_1105079113300004788Freshwater LakeTHISGYNGADEDEIYDNVFSRFSKEGRTPSGHKTGQKLLMKDDAKLASGQSLEAAHWLSPAEVPSYLDANFENAWNHYDQNGEGWIRYEETHTFFRYLLGKLNRFTGAPGSISDLSSGGKAYKLHYSTTTREKTAVSAV*
Ga0066841_1003343713300005599MarineSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLNQFALAPGSLSDMTSGGKAYPLPYPAGSEAVPVGGV*
Ga0078894_1154273913300005662Freshwater LakeVLGRNVDKYTHKDTKISGYNGADEDEIYDNIFSRFSKEGLTPSGHKTGQKLLMKDDAKLAAGQSLEAAHWLSPAEVPSYLDANFENAWNHYDQNGEGWIRYEETHTFMRFLLGKLNRFTGAPGSISDLSSGGKAYKLHYSTTKREKTPVGAV*
Ga0008649_1032032013300005838MarineTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLTPKEVPGYLDANFEGAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAGAPGSIGDLNSGGTNYPLPYPEGSEGTAVGAV*
Ga0075501_132648613300006355AqueousMRISGFNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEARFAAGMCLEALHKLAPADVPAYLEAHFEESWNHYDQNHEGWIRYEETHTFQRYLMGHLNNFILAPGSITDMSSGGPTYKLPYPQGAELTPVGQV*TKKQCLGLLDLIIIFKKYD
Ga0075501_134453723300006355AqueousMRISGFNGADEDEIMDNVFSRYSKEGLTPSGHKTGQKLLMKDQARLAAGTLLEALHKLSPANVPAYLEANFEPSWAKFDQNHEGWIRYEETHTFQRYLMGHLNNFILAPGSITDMSSGGVAYKLPYPQGAE*
Ga0075487_102144813300006356AqueousMHVSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLESAHKLKPAEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDLTSGGTAYPLPYPAGSEATAVGAV*
Ga0075487_137531613300006356AqueousGAETWYEQKISGYNGADEDEIMDNIYSKFSKEGITPSGHKTGQKLLMKDDAKIAAGTTLEAAHKLAPKDVPAFLDANFEKAWSHYDQNNEGWIRYEETHTFQRYLNGALNKFAGAPGSITDMTSGGATYKLPYPAGSEAVPVGSV*
Ga0075502_156099423300006357AqueousMKISGYNGADEDEIMDNIYGRYSQEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLTPQQVPAYLAKNFEPAWNHFDQNHEGWIRYEETHTFQRFLNGALNKFKNAPGSIMDLSSGGASYPLPYPQGSEATPVGQV*
Ga0075499_120698913300006366AqueousMRISGFNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEARFAAGMCLEALHKLAPADVPAYLEAHFEESWNHYDQNHEGWIRYEETHTFQRYLMGHLNNFILAPGSITDMSSGGPTYKLPYPQGAELTPVGQV*
Ga0075494_100622413300006382AqueousMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGAV*
Ga0075504_135866913300006383AqueousMRVSGFNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPADVPGYLSKNFEDSWNHFDQNHEGWIRYEETHTFQKYLMGKLNKFNGAPGSITDLTTGGKAYPLPFPQGSEQTPVGQV*
Ga0075509_142796223300006390AqueousMRVSGFNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPADVPGYLSKNFEDSWNHFDQNHEGWIRYEETHTFQRYLMGKLNKFNGAPGSITDLTTGGKAYPLPFPQG
Ga0075495_153805613300006399AqueousGKNEAKDQHGDMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGWLDTNFEKSWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAFPVGSV*
Ga0075495_157788913300006399AqueousDMTLSGHNGADEDEIMDNIYGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDLTPVGAVAPTAAA*
Ga0075503_138213513300006400AqueousMRVSGFNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPADVPGYLSKNFEDSWNHFDQNHEGWIRYEETHTFQRYLMGKLNKFNGAPGSITDLTTGGKAYPLPFP
Ga0075506_163133423300006401AqueousMKISGYNGADEDEIMDNIYGRYSREGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPGQVPAYLAKNFESTWNHFDQNHEGWIRYEETHTFQRFLNGALNKFKNAPGSIMDLSSGGASYPLPYPQGSEATPVGQV*
Ga0075506_172396323300006401AqueousMHLSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKIASGTILEAAHKMSPADVPAYMDANFENAWNHFDQNHEGWIRYEETHTFQRYIQGALNKLALAPGSIGDLSSGGAAYVTLPVGHDATPVGAVAPPASI*GMRGRK*YKRSVGSITTN
Ga0075515_1052478123300006404AqueousMHLSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKIASGTILEAAHKMSPADVPAYMDANFENAWNHFDQNHEGWIRYEETHTFQRYIQGALNKLALAPGSIGDLSSGGAAYVTLPVGHDATPVGAVAPPASI*
Ga0075510_1062124023300006405AqueousMKISGYNGADEDEIMDNIYGRYSREGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPGQVPAYLAKNFESTWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDATPVGSVAPAASG*
Ga0075484_150676423300006602AqueousMKISGYNGADEDEIMDNVYGRYSKEGRTTSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKSWDHFDQNHEGWIRYEETHTFQRYLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV*
Ga0075484_152309513300006602AqueousAGAETWYEQKISGYNGADEDEIMDNIYSKFSKEGITPSGHKTGQKLLMKDDAKIAAGTTLEAAHKLAPKDVPAFLDANFEKAWSHYDQNNEGWIRYEETHTFQRYLNGALNKFAGAPGSITDMTSGGSTYKLPYPAGSEAVPVGSV*
Ga0075491_144363623300006850AqueousMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATAVGAV*
Ga0102827_115297613300007715EstuarineLDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFENAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEATVVGAV*
Ga0102951_107534613300007725WaterMHISGYNGADEDEIMDNIFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPKDVPGYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQGALNKFTAAPGSIGDLSSGGSTYPLPYPANAEKVPVGSV*
Ga0102951_111728413300007725WaterMHISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPKDVPAYLDANFEKSWNFFDQNHEGWIRYEETHTFQRHLQGKLNKFTAAPGSIGDLASGGSAHKLASGMDAVKVGAV*
Ga0105744_115814613300007863Estuary WaterMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSS
Ga0103951_1047871723300008832MarineMKISGYNGADEDEIMDNIYGRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLTPAQVPAYLAKNFESSWNHFDQNHEGWIRYEETHTFQRFLNGGLNKFKNAPGSIMDLSSGGATYPLPYPQGSEQTPVGQV*
Ga0103951_1051847713300008832MarineMHISGYNGADEDEIIDNVYSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPHQVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVGHV*
Ga0103484_100990623300008919Bay WaterMRVSGFNGADEDEIMDNVFSRFSQEGRTPSGHKTGQKLLMKDDARLAAGTILEAAHKLSPADVPKYLNSNFESAWNHFDQNHEGWIRYEETHTFQRFIQSKLNKFNGAPGSITDLASGASAYALSYPAGSEQTPIRQV*
Ga0103487_101052613300008922Bay WaterMRVSGFNGADEDEIMDNIYSRYSEEGRTTSGHKTGQKLLMKDQARLAAGTVLEAAHKLSPADVPKYLEANFEASWNHFDQNHEGWIRYEETHTFQRYLNGKLNKFNAAPGSITDLTSGGVNYALSYPAGSEQTPIRQV*
Ga0103734_104400213300008931Ice Edge, Mcmurdo Sound, AntarcticaMHISGFNGADEDEIMDNIYGHYAKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVPAYLDAHFEAAWDHFDQNHEGWVRYEETHTLQRFLNGQLNKFSAAPGSLGDLSSGGKTYPLPYPTASETVPVGGI*
Ga0103735_105983713300008932Ice Edge, Mcmurdo Sound, AntarcticaMAPSGYNGADEDEILDNIYSRFSNEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLKPNEVPGYLDSNFENAWNHFDQNHEGWIRYEETHVFQRFLNGQLNKFAAAPGSIGDLTSGGTNYPL
Ga0103739_104526023300008936Ice Edge, Mcmurdo Sound, AntarcticaMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLESAHKLQPSEVPSYLEANFENSWNHFDQNHEGWIRYEETHVFQRYLNGQLNKFAAAPGSLGD
Ga0103741_111977113300008938Ice Edge, Mcmurdo Sound, AntarcticaDGKNVDGTTWKEMHVSGYNGADEDEIMDNVYARFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPAYLDANFENSWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGQAYPLPYPAASEATAVGAV*
Ga0103741_112641813300008938Ice Edge, Mcmurdo Sound, AntarcticaILDNIYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRYLNGQLNKFAAAPGSLGDLTSGGVAYPLPFPAGSESVAVGAV*
Ga0104259_102248923300008958Ocean WaterMKISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLASGTILEAAHKLSPKDVPAYLDANFEKSWNQFDQNHEGWIRYEETHTYQRHLQGKLNKLANAPGSIGDMASGGALHKLRPGMDSVKVGAV*
Ga0104259_103358623300008958Ocean WaterMKISGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQLLLMKDEAKLAAGTVLEAAHKLQPDEVPGFLAKNFETAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKLALAPGSIGDLSSGGDKYVTLPAGHDLTPVGSVAP*
Ga0104258_107018613300008993Ocean WaterMKISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLASGTILEAAHKLSPKDVPAYLDANFEKSWNQFDQNHEGWIRYEETHTYQRHLQGKLNKLANAPGSIGDMASGGALHKLRPGMDAVKVGAV*
Ga0104258_109828013300008993Ocean WaterMAPSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPADVPGYLDSNFESAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKLALAPGSIGDLSSGGDKYVTLPAGHDATPVGSVAP*
Ga0104258_111345313300008993Ocean WaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGA
Ga0103706_1008554613300009022Ocean WaterMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLTPGQFPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV*
Ga0103707_1008039313300009025Ocean WaterMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPHEVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV*
Ga0102826_107646913300009054EstuarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFENAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGSV*
Ga0115566_1024284813300009071Pelagic MarineMTLSGHNGADEDEIMDNIYGRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDATPVGSVAPAASA*
Ga0115566_1042992713300009071Pelagic MarineMDNIFSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGTILEAAHKLAPAAVPAYMDANFENAWNHFDQNKEGWIRYEESHTMQRYLQGKLNKLDGASGSIGDLASGGDKYNTLPAGDAATAVGAVNAQAAGL*
Ga0115551_123681713300009193Pelagic MarineSGHNGADEDEIMDNIYSRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPADVPGYLDSNFESAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKLALAPGSIGDLSSGGDKYVTLPAGHDATPVGSVAP*
Ga0115551_124460913300009193Pelagic MarineEIMDNIYGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDATPVGSVAPAASA*
Ga0103743_103904513300009195Ice Edge, Mcmurdo Sound, AntarcticaMHVSGYNGADEDEIMDNVYARFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPAYLDANFENSWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGQAYPLPYPAASEATAVGAV*
Ga0103743_105714223300009195Ice Edge, Mcmurdo Sound, AntarcticaMAPSGYNGADEDEILDNVYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPSPAASEATPVGSV*
Ga0103842_102432423300009216River WaterMDNIFSKYSKEGVTPSGHKTGQKLLMKDDAKMAAGTVLEAAHKLKPADVPAYLDANFETSWGHFDQNHEGWIRYEETHTFQRHLQGQLNKFANAPGSITDLSS
Ga0103872_101769023300009263Surface Ocean WaterMDNIFSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGTILEAAHKLKPAEVPAYVDANFENAWNHFDQNKEGWIRYEETHTFQRYFMGSLNKLAGAAGSIGDLSSGGVQYNTLPAGHEATPVGAVAPLGEASGSTDDSSGK*
Ga0103872_107161013300009263Surface Ocean WaterDNIYSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLSPGQVPQFLSKNFETAWNHFDQNHEGWIRYEETHTFQRFLNGALNKFKDAPGSIMDLSSGGATYPLPYPQGSEQTPVGQV*
Ga0103878_101410223300009274Surface Ocean WaterMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTFQRHLQGQLNKFANAPGSITDLSSGGPAYPLNYPLDAESVPVGHV*
Ga0103879_1005632513300009276Surface Ocean WaterDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLAPAQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV*
Ga0103880_1005983913300009279Surface Ocean WaterDNIFSRFSKEGLTPSGHKTGQKLLMKDEAKIAAGMILESAHKLKPHEVPAFLDGAFESSWNHFDQNHEGWIRYEETHTFQRHLMGHLNKFILAPGSISDMSSGGAAYKLPYPEGSEQTAVGSV*
Ga0114994_1072130213300009420MarineMILSGYNGADEDEIMDNVFARYSKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLKPSEVPGWLDTNFEAAWSHFDQNHEGWIRYEETHTFQRFLMGSLNNFALAPGTLSDMTSGGKAYPLPSPVGSEAI
Ga0114998_1021190423300009422MarineMHISGYHGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDAVPVSHV*
Ga0115005_1072875913300009432MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAGGMALEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPFPAESEAVVVGAV*
Ga0115005_1073081223300009432MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWVRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGSV*
Ga0115005_1131806413300009432MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFESAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPDASEATVVGAV*
Ga0115005_1161261013300009432MarineIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPTEVGGYLDTNFENAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPFPADSESVAVGAV*
Ga0115008_1030582113300009436MarineMHISGYNGADEDEIMDNIFSKYSKEGITPSGHKTGQKLLMKDQAKLAAGTILEAAHKLGPADVPGFLDANFESSWGHFDQNHEGWIRYEETHTFQRHLMGNLNKFANAPGSITDLSSGGPAYPLNYPLDSESVAVGHV*
Ga0115008_1059175513300009436MarineMAPSGYNGADEDEILDNIYSRYSHEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPYPDASEATVVGAV*
Ga0115008_1095303413300009436MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGAV*
Ga0115008_1114686313300009436MarineYSREGVTPSGHKTGQKLLMKDDAKLASGTVLEAAHKLAPGQVPAFLAKNFEAAWNHFDQNHEGWIRYEETHTFQRFLTGGLNKFKNAPGSIMDLSSGGATYPLPYPQGSEATPVGQV*
Ga0115008_1155715613300009436MarineRYSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPVYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEASEETAVGAV*
Ga0115561_129450113300009440Pelagic MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDGNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGS
Ga0115007_1069670713300009441MarineAREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLMPKDVPTYLNKNFESTWNYFDQNHEGWIRYEETHTFQRHLQGKLNKFSGASGSITDLTSGGATYPLPYPQGSEATPVGQV*
Ga0115007_1072692513300009441MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGMALEASHKLSPKDVPSYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYILPFPADSEATVV
Ga0115007_1124755513300009441MarineRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPTEVGGYLDTNFENAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPFPADSEAVPVGAV*
Ga0126448_104897613300009466Meromictic PondMHISGYNGADEDEIMDNIFGRYSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLAPKDVPGYLDANFEKAWNYFDQNHEGWIRYEETHTFQRHLQGALNKFTGAPGSIGDLSSGGSAYPLPYPANAEKVPVGSV*
Ga0126448_107428023300009466Meromictic PondMKISGYNGADEDEIMDNVFSRFSKEARTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPKDVPGYLDANFESAWNFFDQNHEGWIRYEETHTFQRHLQGKLNKFSGAPGSIGDLSSGGPAHVLATGMDAVKVGAV*
Ga0115571_133788813300009495Pelagic MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGG
Ga0115569_1040626513300009497Pelagic MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKMAGGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGG
Ga0115568_1035496713300009498Pelagic MarineMDNIFGRFSKEGRTPSGHKTGQKLLLKDDAKLAAGTILEAAHKLKPAEVPGYLDSNFESAWSHFDQNHEGWIRYEETHTFQKFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGHDATPVGAVAPTAAA*
Ga0115564_1049122013300009505Pelagic MarineMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKLAGAPGSITDLSSGGPKYPLA
Ga0115099_1027943823300009543MarineMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSSWGHFDQNHEGWIRYEETHTFQRFLQGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSKV*
Ga0115099_1067386313300009543MarineMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPVYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAGAPGSIGDLNSGGGNYPLPYPEGSESTPVGSV*
Ga0115006_1150378613300009544MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRHLMGTLNAFALSPGSLSDMTSGGKAYPLPFP
Ga0115101_129801113300009592MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPGQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV*
Ga0115101_158406313300009592MarineMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKMLMKDDAKLAAGQILEAAHFLKPDEVPDFLNANFETAWTYFDQNHEGWIRYEETHTFQRFIQGKLNKFALAPGSISDINSGGAAYNTIVPAGTSVIAVGNQ*
Ga0115103_108510113300009599MarineKFSKEGLTSTGHKTGQKMLMKDDAKLAAGQILEAAHFLKPDEVPDFLNANFETAWNYFDQNHEGWIRYEETHTFQRFIQGKLNKFALAPGSISDINSGGAAYNTIVPAGTSVIAVGNQ*
Ga0115103_132311013300009599MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEATVVGAV*
Ga0115103_140361713300009599MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKMAGGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGSV*
Ga0115103_148233813300009599MarineMGRNVDQTLHTDMKISGYNGADEDEIMDNIYSKFSSEGLTSTGHKTGQKLLMKDDAKLAAGQTLEAAHFLHPDDVPAYLNANFEDSWNHFDQNHEGWIRYEETHTFQRYIQGKLNKFALAPGSISDMTSGGAAYSAIVPAGTGSISVGNQ*
Ga0115103_169019913300009599MarineMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGYLEQNFETAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGVAYPLPYPAGSEATAVGAV*
Ga0115103_175372113300009599MarineMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLQPGEVPSYLEANFENSWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGVNYPLPYPSGSEATAVGAV*
Ga0115102_1006874813300009606MarineVTPSGHKTGQKLLMKDEGKLAAGMVLEAAHKLEASEVPAFLDERFEDAWNHYDQNHEGWIRYEETHTFQRFLMGSLNKFTLAAGSITDMNSGGAAYPLPYSTGASEDAPEATPVGGV*
Ga0115102_1080557013300009606MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPDASEATAVGAV*
Ga0115100_1049938623300009608MarineMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLTPAEVPGYLDSNFENAWNHFDQNHEGWIRFEETHTFQRYLNGNLNKLALAPGSIGDLSSGGALYTTLPAGHDATAVGAVGL*
Ga0115104_1015696513300009677MarineMAPSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEATHKLKPSDVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRFLNGNLNRFAAAPGSIGDLNSGGSNYVLPYPDGSESTPVGAV*
Ga0115104_1037764213300009677MarineMAPSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPSDVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRFLNGNLNRFAAAPGSIGDLNSGGSNYVLPYPAGSEATPVGAV*
Ga0115104_1046934613300009677MarineADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSSWGHFDQNHEGWIRYEETHTFQRFLQGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSKV*
Ga0115104_1058812813300009677MarineRWQEMHISGYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDQAKLAAGTVLEAAHKLGPADVPGFLDANFENSWSHFDQNHEGWIRYEETHTFQRHLMGNLNKFANAPGSITDLSSGGPAYPLNYPLDSESVAVGKV*
Ga0115104_1080057123300009677MarineMAPSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGAV*
Ga0115105_1030891013300009679MarineIFSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLSPSEVPSYLDGNFETSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGTVYPLNYPLDSESVAVAHV*
Ga0115105_1063557513300009679MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLNKFAMAPGSLGDMTSGGKAYPLPF*
Ga0115105_1076770813300009679MarineRNVDQWTHSDQYISGFNGADEDEIMDNIFSKFSKEGMTPSGHKTGQKLLMKDEAKLAAGMILESAHKLTPAEVPDFLDDRFEEAWNHYDQNHEGWIRYEETHTFQRYLMGYLNKFTLAAGSITDMNSGGTAYPLPYSTGDSPDAPEDTPVGGV*
Ga0123363_103946413300009747MarineMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKLLMKDEAKIAAGQILEAAHFLAPEAVPSYLDAHFEDAWSHFDQNHEGWIRYEETHTFQRHLMGSLNKFANAPGSITDLSSGGPVYPLNYPLDSESVPVATSEHDKGE*
Ga0115001_1050660113300009785MarineMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHMLRPQEVPGWLDKNFEGSWSHFDQNHEGWIRYEETHTFQRHLMGTLNNFAMSPGSISDMTSGGKAYPLPSPAGSEAVAVAAV*
Ga0123382_118863513300010135MarineMHVSGYNGADEDEIMDNIFSRFSNEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPAEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGQLNKFAAAPGSIGDLTSGGTNYPLPYPAGSEATPVGAV*
Ga0129322_100051913300010306AqueousMKISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLASGTILEAAHKLSPKDVPAYLDANFEKSWNQFDQNHEGWIRYEETHTYQRHLQGKLNKLANAPGSIGDMASGGVMHKLRPGMDAVKVGAV*
Ga0138316_1070296423300010981MarineMHISGYNGADEDEIMDNIFSKYSREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLTPAKVPGYLEANFENSWNHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAAGSITDLSSGGPAYPLVYPLNAEQVPVGSV*
Ga0138316_1109609613300010981MarineMHLSGFNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKAWNHFDQNHEGWIRYEETHTFQRFLMGSLNKFAMAPGSIGDMTSGGKAYPLPFPAGAEATPVGSVGTDGV*
Ga0138316_1111319313300010981MarineDPLGRNEAKDQHGDMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGLLDTNFEKSWNHFDQNHEGWIRYEETHTFQRYLMGALNKFALAPGSIGDMTSGGKAYPLPFPAASEAVAVGAV*
Ga0138326_1024031513300010985MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDANFEGAWNHFDQNHEGWIRYEETHTFQRFLMGTLNQFAMAPGTISDMTSGGKAYPLPFPAGSEAVPVGGV*
Ga0138326_1089252323300010985MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLKPHEVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVGHV*
Ga0138326_1212205713300010985MarineGRNMDTARWQEMHISGYNGADEDEIMDNVYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLSPSQVPTYLDANFENSWGHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVTHV*
Ga0138324_1041202513300010987MarineMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGYLDANFEAAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDLTSGGTAYPLPYPAGSEATAVGAV*
Ga0138324_1058879823300010987MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGTLNKFALAPGSISDMISGGKAYPLPF
Ga0136599_102181413300012030Saline LakeMHVSGYNGADEDEIMDNIYSRFSREGVTPSGHKTGQKLLMKDEARLASGTVLEAAHKLTPNQVPAYLNANFETAWNHFDQNHEGWIRYEETHVFQRFLQGGLNKLSNAPGSIMDLSSGGVNYPLPYPQGSEQTPVGQV*
Ga0136600_106250913300012036Saline LakeMHVSGYNGADEDEIMDNIYSRYSKEGVTPSGHKTGQKLLMKDEARLAAGTVLEAAHKLKPVDVPTYLNANFESAWNHFDQNHEGWIRYEETHVFQRFLQGKLNKFQGAPGSITDLTSGGINYPLPYPQGSEQTPVGQV*
Ga0138265_113414723300012408Polar MarineMAPSGYNGADEDEILDNVYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGATTFSHTQLVQKLL*
Ga0138266_127226013300012412Polar MarineMAPSGYNGADEDEILDNIYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVL
Ga0138266_129809113300012412Polar MarineMAPSGYNGADEDEILDNVYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPYPAGSEATVVGSV*
Ga0138264_162592013300012414Polar MarineMAPSGYNGADEDEILDNIYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPYPDASEATPVGSV*
Ga0138264_167028123300012414Polar MarineSGYNGADEDEIMDNVYGHFSKEGRTPSGHKTGQKLLMKEQAKLAAGTVLEAAHKLKPAEVPAFLDGQFEAAWDHFDQNHEGWIRYEETHTFQRYLNGHLNKLTNAPRSLGDMNSGGKVYPLPYPAGSESVAVGAV*
Ga0138263_178122113300012415Polar MarineMAPSGYNGADEDEILDNVYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSICDLNSGGANYVLPYPAGSEATVVGSV*
Ga0138262_166589413300012417Polar MarineDATTWEDMHISGYNGADEDEIMDNVYGHFSKEGRTPSGHKTGQKLLMKEQAKLAAGTVLEAAHKLKPAEVPAFLDGQFEAAWDHFDQNHEGWIRYEETHTFQRYLNGHLNKLTNAPGSLGDMNSGGKVYPLPYPAGSESVAVGAV*
Ga0129329_101580813300012470AqueousMTLSGHNGADEDEIMDNIYGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHD
Ga0129334_110723823300012471AqueousMRISGFNGADEDEIMDNIFSRYSKEGRTTSGHKTGQKLLMKDEARLAAGTILEAAHKLRPDQVPAFLNANFESAWNYFDQNHEGWIRYEETHTFQRYLQGRLNKFNGAPGSITDLSSGGAVYQLQYPLGSNITPIRQV*
Ga0129325_136898723300012516AqueousMTLSGHNGADEDEIMDNIYGRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALVPGSIGDLSSGGALYTTLPAGHDATPVGSVAPAASG*
Ga0129349_112647413300012518AqueousMHISGYNGADEDEIMDNVYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSAVPAYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLTAEATQVGKV*
Ga0129349_114796613300012518AqueousMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPAQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPHYPLTYPLGSEAVPVSHV*
Ga0129349_139260223300012518AqueousMHISGYNGADEDEIYDNIYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTCLEAAHKLAPSAVPAYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAETV
Ga0129326_112592013300012522AqueousMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDATPVGSVAPAASA*
Ga0129350_135883513300012523AqueousMHISGYNGADEDEIYDNIYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTCLEAAHKLAPSAVPAYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAETVPVGKV*
Ga0129331_105312913300012524AqueousMTLSGHNGADEDEIMDNIYGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDATPVGSVAPAASA*
Ga0129331_113522813300012524AqueousMTLSGHNGADEDEIMDNIYGRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDLTPVGAVAPTAAA*
Ga0157608_105674513300012709FreshwaterTHKDTKISGYNGADEDEIYDNIFSRFSKEGLTPSGHKTGQKLLMKDDAKLAAGQSLEAAHWLSPAEVPSYLDANFENAWNHYDQNGEGWIRYEETHTFMRFLLGKLNRFTGAPGSISDLSSGGKAYKLHYSTTKREKTPVGAV*
Ga0157599_116231513300012715FreshwaterRNVDKYTHKDTKISGYNGADEDEIYDNIFSRFSKEGLTPSGHKTGQKLLMKDDAKLAAGQSLEAAHWLSPAEVPSYLDANFENAWNHYDQNGEGWIRYEETHTFMRFLLGKLNRFTGAPGSISDLSSGGKAYKLHYSTTKREKTSVGVV*
Ga0157609_107560313300012717FreshwaterTKISGYNGADEDEIYDNIFSKFSKEGLTPSGHKTGQKLLMKDDAKLASGQSLEAAHWLSPAEVPSYLDANFENAWNHYDQNGEGWIRYEETHTFFRYLLGKLNRFTSAPGSISDLSSGGKAYKLHYSTTKREKTPVSAV*
Ga0138268_119113313300012782Polar MarineMHVSGYNGADEDEIMDNVYSRYSQEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPSEVPSYLEANFENSWNHYDQNHEGWIRYEETHVFQRFLNGQLYKFAAAPGSIGDTTSGGVAYPLPYPAGSEATAVGAV*
Ga0129343_125967823300012967AqueousMKISGYNGADEDEIMDNIFGRYSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLAPKDVPGYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQGALNKFAKAPGSIGDLSSGGSTYPLPYPANAEKVPVGSV*
Ga0129332_107258013300012969AqueousMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATAVG
Ga0129327_1037012513300013010Freshwater To Marine Saline GradientGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDLTPVGAVAPTAAA*
Ga0182048_105749513300016724Salt MarshRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLLPPAVPAYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQGALNKFTAAPGSLGDLSSGGATYPLPYPANSEKVPVGSV
Ga0182051_110546913300016727Salt MarshMKISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLASGTILEAAHKLSPKDVPAYLDANFEKSWNQFDQNHEGWIRYEETHTYQRHLQGKLNKLANAPGSIGDMASGGVMHKLRPGMDAVKVGAV
Ga0182074_103889923300016735Salt MarshMKISGYNGADEDEIMDNIFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLAPKDVPGFLDAKFEGAWNHFDQNHEGWIRYEETHTFQRYLMGSLNKFSGAPGSIGDLSSGGSTYPLPYPANAEKVPVGSV
Ga0182047_103324013300016737Salt MarshMKISGYNGADEDEIMDSVFSHYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILESAHKLKPEEVPAYLSANFESSWDHFDQNHEGWIRYEETHTFQRHIQGSLNKFNGAKGSITDMTSGGSTYPLPYPAGSEATPVGAV
Ga0182076_128373223300016739Salt MarshMKISGYNGADEDEIMDNIYGRYSREGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLTPQQVPAYLAKNFESSWNHFDQNHEGWIRYEETHTFQRFLNGALNKFKNAPGSIMDLSSGGATYPLPYPQGSEATPVGQV
Ga0182043_113970213300016748Salt MarshMVQSGKKFLPGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLLPPAVPAYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQGALNKFTAAPGSLGDLSSGGATYPLPYPANSEKVPVGSV
Ga0182091_139018413300016766Salt MarshDNVYGRYSKEGRTTSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKSWDHFDQNHEGWIRYEETHTFQRFLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV
Ga0182046_157456713300016776Salt MarshKISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLASGTILEAAHKLSPKDVPAYLDANFEKSWNQFDQNHEGWIRYEETHTYQRHLQGKLNKLANAPGSIGDMASGGVMHKLRPGMDAVKVGAV
Ga0182095_187762823300016791Salt MarshGRTTSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKSWDHFDQNHEGWIRYEETHTFQRYLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV
Ga0187220_119418413300017768SeawaterMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPGQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYP
Ga0181565_1035601313300017818Salt MarshMKISGYNGADEDEIMDNVYGRYSKEGRTTSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKSWDHFDQNHEGWIRYEETHTFQRYLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV
Ga0181584_1043469123300017949Salt MarshMRVSGFNGADEDEIMDNIFSRYSKEGRTTSGHKTGQKLLMKDEARLAAGTILEAAHKLTPENVPKFLNANFESAWNYFDQNHEGWIRYEETHTFQRYLQGKLNKFNGAPGSITDLSSGGAVYQLQYPVGANITPIRQV
Ga0181584_1086485713300017949Salt MarshNSNPEGRNFDGAETWYEQKISGYNGADEDEIMDNIYSKFSKEGQTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLAPRDVPDFLEANFEKAWNHYDQNHEGWIRYEETHTFQRFLNGALNKFAGAPGSITDMNSGGAAYKLPYPAGSEATPVGSV
Ga0181577_1033792313300017951Salt MarshMKISGYNGADEDEIMDNVYGRYSKEGRTTSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKAWDHFDQNHEGWIRYEETHTFQRYLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV
Ga0181577_1097248513300017951Salt MarshMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKMQPSAVPAYMDANFENAWNHFDQNKEGWIRYEESHTMQRYLQGKLNKLDKAPGSIGDLASGGDKYNTLPAGDNATPVGAVAATAEASXRT
Ga0181561_1020237813300018410Salt MarshMKISGYNGADEDEIMDNVYGRYSKEGRTTSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKSWDHFDQNHEGWIRYEETHTFQRFLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV
Ga0181567_1053030723300018418Salt MarshGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGTILEAAHKLTPAEVPAYVDANFENSWNHFDQNKEGWIRYEETHTFQRHFMGALNKLSGAPGSIGDLASGGVQYNTLPAGHDATPVGAVAPAGGEAGATTGEGAGAPAVGP
Ga0181568_1059286013300018428Salt MarshMHVSGYNGADEDEIMDNIFSRFSNEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPAEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGQLNKFAAAPGSIGDLTSGGTNYPLPYPAGSEATPVGAV
Ga0192960_10408823300018515MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPHQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDTVAVSHV
Ga0188834_102654713300018599Freshwater LakeMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKMQPSAVPAYMDANFENAWNHFDQNKEGWIRYEESHTMQRYLQGKLNKLDKAPGSIGDLASGGDKYNTLPAGDAATPVGAVAATA
Ga0193182_101420913300018602MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPHEVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDGVPVSHV
Ga0193133_101593413300018617MarineDPLGRNVDRTIWQDMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKLLMKDDAKIAGGQILEAAHFLKPGEVPDFLNAHFEDSWSHFDQNHEGWIRYEETHTFQRYLQGSLNKFAGSPGSIGDMTSGGKAYNGWLPSGGEQVGVGYQ
Ga0193355_101709213300018628MarineMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKLLMKDEAKIAAGQILEAAHFLTPEAVPGFLDAHFEDSWTHFDQNHEGWIRYEETHVFQRHLQGELNKFAGSPGSLGDIKSGGKAYNGWLPSGGEQVAVGRQ
Ga0193355_101907113300018628MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLTPGSVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSHV
Ga0193355_102186513300018628MarineMHISGYNGADEDEIMDNVYSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPHQVPGYLDANFENSWGHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVGHV
Ga0193355_102192013300018628MarineIFSRFAKEGLTPSGHKTGQKLLMKDEAKLAAGMILESAHKLKPHEVPQYLDGSFENAWGHFDQNHEGWIRYEETHTFQRYLMGHLNKFILAPGSISDMSSGGAAYKLPYPEGSEQTAVGAVX
Ga0192969_102982113300018649MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPHQVPAYLDANFDSSWSHFDQNHEGWVRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDTVPVSHV
Ga0193571_101117613300018671MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLTPGSVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV
Ga0193166_101302213300018674MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKMKPHEVPSYLDANFDPSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV
Ga0192983_104719413300018684MarineIDATTWEDMHISGYNGADEDEIMDNVYGHFSKEGRTPSGHKTGQKLLMKEQAKLAAGTVLEAAHKLKPAEVPAFLDGQFEAAWDHFDQNHEGWIRYEETHTFQRYLNGHLNKLTNAPGSLGDMNSGGKVYPLPYPAGSESVAVGAV
Ga0192944_102482113300018692MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPHQVPAYLDANFDSSWSHFDQNHEGWVRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDTVAVSHV
Ga0192944_103353013300018692MarineMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKIASGTVLEAAHKLNPHEVPSFLDANFENSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAETVPVGHV
Ga0192944_103644813300018692MarineMHVSGYNGADEDEIMDNVYSRFSQEGRTPSGHKTGQKLLMKDDAKLAAGTVLESAHKLQPTAVPGYLESNFESAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFSGAPGSIGDLQSGGTNYPLPYPAGSEATAVGAV
Ga0193534_104718313300018741MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPGQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVAVSHV
Ga0193138_103147013300018742MarineMHISGYNGADEDEIMDNVYSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPHQVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVGHV
Ga0193138_103233813300018742MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLKPHEVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV
Ga0193138_104389423300018742MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLTPGSVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPAYPLNYPLDSESVTVGHV
Ga0193000_103858013300018745MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPAQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV
Ga0193000_106003413300018745MarineTWEDMHVSGYNGADEDEIMDNIYGHYSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVPGYLDAHFEAAWDHFDQNHEGWIRYEETHTFQRFLNGQLNKFSAAPGSLGDLSSGGKAYPLPYPAGSESVPVGGV
Ga0193000_106982813300018745MarineMHISGYNGADEGEIMDNVYSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPHQVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVGHV
Ga0193392_103626213300018749MarineEDEIMDNIYSRFSKEGLTPSGHKTGQKLLMKDEAKIAAGMVLESAHKLQPHEVPAFLEANFENAWNHYDQNHEGWIRYEETHTFQKYLNGHLNKYILAPGSISDMASGGAAYSLPYPEGSETTAVGAW
Ga0192827_108210313300018763MarineISGYNGADEDEIMDNIYGHYAKEGRTPSGHKTGQKLLMKDDAKIAAGTVFEAAHKLKPAEVQPYLDANFEAAWNHFDQNHEGWIRYEETHTFQRYLNGHLNKFTNAPGSLGDLSSGGKTYPLPYPSGSEAVPVGAV
Ga0193031_104647313300018765MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDANFEGAWNHFDQNHEGWIRYEETHTFQRFLMGTLNQFAMAPGTISDMTSGGKAYPLPFPAGSEAVPVGGV
Ga0193031_105754923300018765MarineMHISGYNGADEDEIMDNVYSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPHQVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPVYPLVYPLDAESVGVGHV
Ga0193031_106225313300018765MarineMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGYLDANFEAAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGTAYPLPYPAGSEATAVGAV
Ga0193149_105881313300018779MarineEIMDNIFSKYSREGQTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLEPSRVPAYLEANFENSWNHFDQNHEGWIRYEETHTFQRHMMGQLNKFANAPGSITDLSSGGPAYPLTYPLTAESVAVGAV
Ga0193117_105819813300018796MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLNRFALAPGTISDMTSGGKAYPLPYPAASEAVPVGGV
Ga0193117_108114423300018796MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPGQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV
Ga0193306_105018813300018800MarineSEPEGRNMDTATWKEMHISGYNGADEDEIMDNVYSRFSREGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPHEVPAYLDANFEPSWSHFDQNHEGWIRYEETHTFQRHLQGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSKV
Ga0192829_107128413300018812MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPAQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDGVPVSHV
Ga0192829_108606313300018812MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPHEVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDGVPVSHV
Ga0193053_104288313300018823MarineMHISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLMKDEAKIAAGMILESAHKLKPHEVPAFLDGAFESSWDHFDQNHEGWIRYEETHTFQRHLMGHLNKFILAPGSISDMSSGGAAYKLPYPEGSEQTAVGAV
Ga0193053_105273313300018823MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPHQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV
Ga0193053_107891013300018823MarineDEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPHEVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV
Ga0194240_100650323300018832MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLAPGQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV
Ga0194240_103260213300018832MarineGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDQAKLAAGTILEAAHKLGPADVPGFLDANFENSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVTHV
Ga0193302_107427613300018838MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPAQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV
Ga0193219_107746813300018842MarineKISGYNGADEDEIMDNIFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLEPKDVPAYLDSNFEKSWNHFDQNHEGWIRYEETHTFQRHLQGALNKFTKAPGSIGDLSSGGSTYPLPYPANAEKVPVGSV
Ga0193253_106724123300018846MarineMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDAQFDSSWGHFDQNHEGWIRYEETHTFQRFLQGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSKV
Ga0193253_107895623300018846MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPGQVPTYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV
Ga0193253_111194013300018846MarineMHISGYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDQAKLACGTVLEAAHKLKPADVPGYLDANFENTWSHFDQNHEGWIRYEETHTFQRHLQGNLNKFANAPGSITDLSSGGPAYPLNYPLDAESVGVGHV
Ga0193253_112240613300018846MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPNEVPSFLDANFENAWNHYDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSLGDLNSGGSNYVLPYPDGSEATPVGSV
Ga0193253_112264913300018846MarineMKISGFNGADEDEIMDSIYSRFSREGQTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPGEVPGFLAKSFESAWNHFDQNHEGWIRYEETHTFQRFLNGALNKFKNAPGSIMDMSSGGAAYPLPYPQGSEQTPVGQV
Ga0193253_113480223300018846MarineMKISGYNGADEDEIMDNIYGRYSKEGRTPSGHKTGQKLLMKDDAKLASGTVLEAAHKLTPAQVPAYLAKNFESSWNHFDQNHEGWIRYEETHTFQRFLNGGLNKFKNAPGSIMDLSSGGATYPLPYPQGSEQTPVGQV
Ga0193072_107249313300018861MarineMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPGQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVAVSHV
Ga0193308_107815813300018862MarineLKLTAFDDSDKEGRNVDQTTWKEMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPNEVPGYLDANFEAAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDLTSGGTAYPLPYPAGSEATAVGAV
Ga0192978_106343413300018871MarineMTLSGYNGADEDEIMDNVYSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLRPQEVPGWLDKNFEAAWSHFDQNHEGWIRYEETHTFQRYLMGTLNQFAMSPGSISDMTSGGKAYPLPFPVGSETLAVGAV
Ga0192978_106685113300018871MarineMTLSGYNGADEDEIMDNVYSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLRPQEVPGWLDKNFEAAWSHFDQNHEGWIRYEETHTFQRFLMGTLNAFAMSPGSISDMTSGGKAYPLPWPVKSEELGVGAV
Ga0192978_107760313300018871MarineMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPNEVPGFLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGASNYVLPYPADSEATPVGSV
Ga0192978_108556913300018871MarineMHVSGYNGADEDEIMDNVYARFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPAYLDANFENSWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGQAYPLPYPAASEATAVGAV
Ga0192978_109048513300018871MarineMAPSGYNGADEDEILDNIYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPQDVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYILPYPEASEATPVGSV
Ga0192977_107668813300018874MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSYLDANFENSWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGGSNYILPFPEGSEATVVGAV
Ga0192977_109671813300018874MarineMAPSGYNGADEDEILDNIYSRFSNEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLKPNEVPGYLDSNFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGGSNYILPFPADSEATPVGAV
Ga0192977_111051813300018874MarineMTLSGHNGADEDEIMDNIFARFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPAEVPGYLDSNFENAWAHFDQNHEGWIRYEETHTFQRFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGHDATPVGAVAPAAAV
Ga0193337_104404213300018880MarineMKISGYNGADEDEIMDNIYGRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLTPAQVPAYLAKNFESSWNHFDQNHEGWIRYEETHTFQRFLNGGLNKFKNAPGSIMDLSSGGATYPLPYPQGSEQTPVGQV
Ga0193471_108546613300018882MarineMHISGYNGADEDEIMDNIFSRFAKEGLTPSGHKTGQKLLMKDEAKLAAGMILESAHKLKPHEVPQYLDGSFENAWGHFDQNHEGWIRYEETHTFQRYLMGHLNKFILAPGSISDMSSGGAAYKLPYPEGSEQTAVGAV
Ga0193471_110290513300018882MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPGQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSHV
Ga0192868_1007562913300018913MarineEGLTPSGHKTGEKLLMKDQAKLAAGTILEAAHKLAPADVPGYLDANFETSWGHFYQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLASGGPAYPLAYPLDAESVGVGHV
Ga0192868_1009241513300018913MarineDMTLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDVKIAAGTILEAAHKLKPAEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLQGSLNKLALAPGSIGDLSSGGALYTTLPAGHDATPVGSVAPGAAAN
Ga0192989_1011475023300018926MarineMKISGFNGADEDEIMDSIYSRFSREGQTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPGEVPGFLAKSFESAWNHFDQNHEGWIRYEETHTFQRFLNGALNKFKNAPGSIMDMSSGGAAYPLPYPQGSE
Ga0193260_1013729723300018928MarineDMKISGYHGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPADVPTYLDKNFETTWNHFDQNHEGWIRYEETHTFQRHLQGSLNKFAMAPGSIGDLSSGGKAYPLPYPAASEAVPVGAV
Ga0193178_1003058423300018967MarineMHISGYNGADEDEIMDNIFSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLSPHEVPGYLDANFENSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGAHYPLVYPLDAESVGVTHV
Ga0193178_1003558013300018967MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPHEVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGAHYPLTYPLGSEAVPVSHV
Ga0192873_1043879013300018974MarineDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDANFEAAWSHFDQNHEGWIRYEETHTFQRFLMGTLNSFALAPGSISDMASGGKAYPLPYPVGSEALGVGAV
Ga0193006_1021063113300018975MarineVDHTTWEDMHISGYNGADEDEIMDNVYGHYSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVQPYLDANFEGSWDHFDQNHEGWIRYEETHTFQRHLNGHLNKFTNAPGSLGDLSSGGKVYPLPYPSGSEAVPVGAV
Ga0193006_1024607513300018975MarineIFSKYAREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLEPSKVPGYLEANFENSWNHFDQNHEGWIRYEETHTFQRHMMGQLNKFANAPGSITDLSSGGPAYPLAYPLNSEQVPVGS
Ga0193540_1011696223300018979MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPGQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV
Ga0192961_1016716913300018980MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKMAGGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGSV
Ga0192968_1017504413300018981MarineNGADEDEIMDNIYGHYAKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVPAYLDAHFEAAWDHFDQNHEGWVRYEETHTLQRFLNGQLNKFSAAPGSLGDLSS
Ga0192947_1017067313300018982MarineMHVSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPNEVPGYLDANFEASWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDLTSGGTAYPLPYPAGSESVAVGAV
Ga0192947_1027653313300018982MarineYIFSKFSKEGLTSTGHKTGQKLLMKDDAKLAAGQVLEAAHFLGPTEVPDFLNAHFEDSWNHFDQNHEGWIRYEETHTFQRFIQGSLNKFALAPGSISDLASGGAAYNTIVPVGTPVIAVGRQ
Ga0193275_1016062913300018988MarineMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDKNFEPAWDHFDQNHEGWIRYEETHTFQRFLMGTLNAFALAPGSISDMASGGKAYPLPYPAGSEAVPVGGV
Ga0193030_1009917713300018989MarineMHISGYNGADEDEIMDNVYSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPHQVPSYLDANFENSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPVYPLVYPLDAESVGVGHV
Ga0193030_1016714713300018989MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDTNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLNQFALAPGTISDMMSGGKAYPLPYPAASETVAVGAV
Ga0193030_1017232613300018989MarineMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDANFEAAWSHFDQNHEGWIRYEETHTFQRFLMGTLNSFALAPGSISDMASGGKAYPLPYPVGSEALGVGAV
Ga0193030_1022866913300018989MarineEMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSSWGHFDQNHEGWIRYEETHTFQRFLQGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSKV
Ga0193030_1027638213300018989MarineYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLNKFALAPGSISDMSSGGKAYPLPYPAASEAVPVGGV
Ga0193030_1028165913300018989MarineMHISGYNGADEDEIMDNVFSKFSKEGITPSGHKTGQKLLMKDDAKIAAGTILEAAHKLNPASVPAYLDANFEGSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPAYPLNYPLDAEAVPVSKV
Ga0193030_1031566313300018989MarineQEMHISGYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPGQVPSYLDANFESSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAESVAVGHV
Ga0193034_1005779013300019001MarineMHISGYNGADEDEIMDNIFSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPSQVPSYLDANFEGSWNHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAEAVPVTHV
Ga0193034_1015252013300019001MarineTWAGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGWLDTNFEKSWNHFDQNHEGWIRYEETHTFQRYMMGALNKFALAPGSIGDMTSGGKAYPLPYPAASESVAVGAV
Ga0193034_1018464213300019001MarineSPEFGQNDPSASGQTVWQDTIRSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPNEVGGYLDTNFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGGENYVLPYPDGAEATAVGAV
Ga0193034_1018488913300019001MarineMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLNQFALAPGTISDMTSGGKAYPLPFPAGSEAVPVGGV
Ga0193044_1025634113300019010MarineTWKEMHVSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGYLDANFEASWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDLTSGGTAYPLPYPAGSESVAVGAV
Ga0192982_1019271813300019021MarineDMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPAEVPGYLDSNFENAWSHFDQNHEGWIRYEETHTFQRFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGHDATPVGAVAPAAAV
Ga0192982_1022163323300019021MarineMKISGYNGADEDEIMDNIYSRYSREGQTPSGHKTGQKLLMKDDAKLACGTVLEAAHKLPPQSVPAFLAKNFEAAWNHFDQNHEGWIRYEETHVFQRFISGALNKFKNAPGSIMDLSSGGAQYPLPYPQGSEATPVGQV
Ga0192982_1032434013300019021MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPYPEASEATAVGSV
Ga0193535_1020603823300019024MarineMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPGQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV
Ga0193535_1028266623300019024MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDANFEGAWNHFDQNHEGWIRYEETHTFQRFLMGTLNQFAMAPGTIRYEETHTFQRFLMGTLN
Ga0193545_1007629623300019025MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLTPGSVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGNLNKFANAPGSITDLSSGGPAYPLNYPLDSESVPVGKV
Ga0192909_1013250713300019027MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLNQFALAPGTISDMTSGGKAYPLPYPAASETVAVGAV
Ga0192909_1024746413300019027MarineTQSTWGWQEMHISGYNGADEDEIMDNIFSKYSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPADVPAYLDANFETSWGHFDQNHEGWIRYEETHTFQRFLQGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVAVGKV
Ga0193516_1023427613300019031MarineMDTARWQEMHISGYNGADEDEIMDNIFSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLAPSAVPAYLDANFETSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPAYPLNYPLDAESVGVGHV
Ga0193516_1025307313300019031MarineEIMDNIFSKFSKEGMTPSGHKTGQKLLMKDEAKLAAGMILESAHKLTPAEVPGFLDDRFEEAWNHYDQNHEGWIRYEETHTFQRYLMGYLNKFTLAAGSITDMNSGGSAYPLPYSTGDSPDAPEDTPVGGV
Ga0193516_1029291713300019031MarineMDNIFSKYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLSPNQVPSYLDANFENSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVAVGHV
Ga0193516_1030029813300019031MarineRWREMHISGYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLTPGSVPAYLDANFETSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAESVPVSHV
Ga0192869_1019896723300019032MarineMHISGYNGADEDEIMDNVFSKYSKEGLTPSGHKTGEKLLMKDQAKLAAGTILEAAHKLAPADVPGYLDANFETSWGHFYQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLASGGPAYPLAYPLDAESVGVGHV
Ga0192869_1025950123300019032MarineMHISGYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPHEVPGYLDANFENSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPHYPLVYPLDAESVGVTHV
Ga0192869_1032047313300019032MarineMTLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDVKIAAGTILEAAHKLKPAEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLQGSLNKLALAPGSIGDLSSGGALYTTLPAGHDATPVGSVAPGAAAN
Ga0193037_1020171613300019033MarineLPTGSSTWKDTEKSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKIKPGEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAGAPGSIGDLNSGGGNYPLPYPEGAEATPVGSV
Ga0193037_1021495813300019033MarineMHISGYNGADEDEIMDNVYGHYSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLSPAEVQPYLDANFESSWDHFDQNHEGWIRYEETHTFQRHLNGHLNKFTNAPGSLGDMSSGGKVYPLPYPAGSEAVPVGAV
Ga0193037_1030877413300019033MarineSADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGTLNNFAMSPGSISDMTSGGKAYPLPYPAGSESVAVGAV
Ga0192945_1018555313300019036MarineSDSLGRNVDTTVHQDMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKLLMKDDAKLAAGQVLEAAHFLGPTEVPDFLNAHFEDSWNHFDQNHEGWIRYEETHTFQRFIQGSLNKFALAPGSISDLASGGAAYNTIVPVGTPVIAVGRQ
Ga0192945_1024170813300019036MarineNFDGAQTYEDMTLSGHNGADEDEIMDNIYSRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPADVPGYLDSNFENAWNHFDQNHEGWIRYEETHTFQKYLNGNLNKLALAPGSIGDLSSGGDKYVTLPAGHDATPVGSVAP
Ga0192945_1028206413300019036MarineMAPSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLASGMALEASHKLKPNEVPGYLDNNFENAWNHFDQNHEGWIRYEETHTYQRYLNGNLNKFAAAPGSIGDLNSGGVNYILPYPEGSEATAVGAV
Ga0192886_1027343113300019037MarineSGYNGADEDEIMDNVFSKYSKEGLTPSGHKTGEKLLMKDQAKLAAGTILEAAHKLKPADVPGYLDANFETSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLASGGPAYPLAYPLDAESVGVGHV
Ga0193123_1042692713300019039MarineDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLKPHEVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVGHV
Ga0193336_1018252413300019045MarineMKISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKMLMKDDAKLAAGQILEAAHFLKPDEVPDFLNTNFETAWDHFDQNHEGWIRYEETHTFQRFIQGKLNKFALAPGSISDINSGGPAYNNIVPAGTSVIAVGNQ
Ga0193336_1022321013300019045MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPAQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGNLNKFANAPGSITDLSSGGPAYPLNYPLDSESVPVGKV
Ga0193336_1046778513300019045MarineRWQEMHISGYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAYKLGPSQVPAYLEANFENSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAESVAVGHV
Ga0193336_1047997413300019045MarineYSRFSKEGLTPSGHKTGQKLLMKDEAKIAAGMVLESAHKLQPHEVPAFLEANFENAWNHYDQNHEGWIRYEETHTFQKYLNGHLNKYILAPGSISDMASGGAAYSLPYPEGSEATAVGAV
Ga0192981_1023227013300019048MarineMAPSGYNGADEDEILDNVYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYILPFPEGSEATVVGAV
Ga0192981_1023228513300019048MarineMAPSGYNGADEDEILDNVYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSYLDANFENSWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGGSNYILPFPEGSEATVVGAV
Ga0192981_1027472213300019048MarineMKVSGFNGADEDEIMDNVFSRFSKEGVTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLVPGDVPAFLNKNFETAWSHFDQNHEGWIRYEETHVFQRFLNGALNKFSGAPGSITDLSSGGSRYALPFPQGSEQTPVGQV
Ga0192981_1034835113300019048MarineGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEASHKLKPSEVPGWLDAHFEGSWDHYDQNHEGWIRYEETHTFQRHLMGSLNKFALSPGSLSDMTSGGKAYPLPFPADSEKVPVGGV
Ga0192981_1038341513300019048MarineMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPNEVPGFLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAP
Ga0193082_1071718113300019049MarineQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDSNFEAAWNHFDQNHEGWIRYEETHTFQRYLMGTLNKFALAPGSISDMTSGDKAYPLPYPAASETVAVGAV
Ga0192826_1021162913300019051MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPHQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGAHYPLTYPLGSEAVPVSHV
Ga0192826_1023750113300019051MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDQAKLAAGTALEASHKLKPNEVPGFLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAGAPGSIGDLNSGGSNYVLPYPEGSEATPVGSV
Ga0192826_1026545313300019051MarineSDPLGRNFEGAAIHQDMHISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLMKDEAKIAAGMVLESAHKLQPHEVPAFLEANFENAWNHYDQNHEGWIRYEETHTFQKYLMGHLNKYILAPGSISDMASGGAAYSLPYPEGSETTAVGAW
Ga0192826_1031042413300019051MarineMGDTARWQEMHISGYNGADEDEIMDNVFSRYSKEGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPHEVPSYLDANFETSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAESVGVTHV
Ga0192826_1032449013300019051MarineRWQEMHISGYNGADEDEIMDNIFSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPSQVPSYLDANFEASWNHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAESVGVTHV
Ga0192826_1032471313300019051MarineDKDEIMDNIFSKFSKEGMTPSGHKTGQKLLMKDEAKIAAGMVLESAHKLKPADVPSFLDERFEEAWNHYDQNHEGWIRYEETHTFQRYLMGYLNKFTLAAGSITDMNSGGSAYPLPYSTGTSPGDVENTPVGGV
Ga0192826_1033317213300019051MarineMHISGYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLSPHEVPGYLDANFENSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGAHYPLVYPLDAESVGVTHV
Ga0192826_1037540113300019051MarineMDTARWQEMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLAPSAVPSYLDANFETSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPAYPLNYPLDAESVPVSHV
Ga0192826_1038747913300019051MarineYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLSPHEVPGYLDANFENSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPHYPLVYPLDAESVGVTHV
Ga0188838_11491413300019081Freshwater LakeSGHNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGMTLEAAHKLTPAEVPAYLESNFETAWNHFDQNHEGWIRYEETHTFQKFLNGNLNKLALAPGSIGDLSSGGDKYVTLPAGHDLTPVGSVAPEKKLKTN
Ga0188866_101815623300019095Freshwater LakeMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDAVPVSHV
Ga0188866_101982923300019095Freshwater LakeMKLSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKIASGTILEAAHKMKPAEVPAYMDANFENAWNHFDQNHEGWIRYEETHTFQRFIQGNLNKLALAPGSIGDLSSGGAAYVTLPVGHDATPVGAVAPPASI
Ga0188866_102095423300019095Freshwater LakeMKLSGFNGADEDEIMDNIFSRFSKEGRTPAGHKTGQKLLMKDDAKIASGTVLEAAHKMKPAEVPAYMDANFENAWNHFDQNHEGWIRYEETHTFQRFIQGNLNKLALAPGSIGDLSSGGAAYVTLPVGHDATPVGAVAPPASI
Ga0188866_102335423300019095Freshwater LakeMTLSGHNGADEDEIMDNIYGRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDATPVGSVAPAASAXAX
Ga0188866_102348213300019095Freshwater LakeMHISGYNGADEDEIMDNIFSKYSKEGITPSGHKTGQKLLMKDQAKLAAGTILEAAHKLGPADVPGFLDANFESSWGHFDQNHEGWIRYEETHTFQRHLMGNLNKFANAPGSITDLSSGGPAYPLNYPLDSESVAVGHV
Ga0188866_102392813300019095Freshwater LakeMTLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPAEVPGYLDSNFENAWAHFDQNHEGWIRYEETHTFQRFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGHDATPVGAVGI
Ga0188866_102446123300019095Freshwater LakeMTLSGHNGADEDEIMDNIYGRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDLTPVGAVAPTAAA
Ga0193153_102381623300019097MarineMHISGYNGADEDEIMDNIFSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPSQVPAYLDANFEGSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAEAVPVTHV
Ga0193102_102703013300019099MarineADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDANFEGAWNHFDQNHEGWIRYEETHTFQRYLMGTLNQFAMAPGTISDMTSGGKAYPLPFPAGSEAVPVGGV
Ga0193157_101652013300019118MarineMHISGYNGADEDEIMDNVFSKFSKEGITPSGHKTGQKLLMKDDAKIAAGTILEAAHKLNPASVPAYLDANFEGSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAESVPVGHV
Ga0193157_103559613300019118MarineMHISGYNGADEDEIMDNIFSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLNPSQVPSYLDANFEGSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVY
Ga0193157_103633713300019118MarineLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTFQRFLMGSLNQFALAPGSISDMTSGGKAYPLPFPTGSEAVAVGAV
Ga0192980_106309223300019123MarineMAPSGYNGADEDEILDNVYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPYPEASEATAVGSV
Ga0192980_107962613300019123MarineMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPNEVPGFLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGASNYVLPSPADSEATPVGSV
Ga0193436_105367313300019129MarineDSEPEGRNMDTATWKEMHISGYNGADEDEIMDNVYSRFSREGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPHEVPAYLDANFEPSWSHFDQNHEGWIRYEETHTFQRHLQGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSHV
Ga0193089_112394213300019133MarineMAPSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLASGMALEASHKLKPNEVPGYLDNNFENAWNHFDQNHEGWIRYEETHTYQRYLNGNLNKFAAAPGSIGDLNSGGVNYILPYPEGSEATAVGA
Ga0193089_113836413300019133MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILDAAHKLQPHQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDTVAVSHV
Ga0193047_112507613300019139MarineHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPGQVPTYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV
Ga0188870_1012627913300019149Freshwater LakeMTLSGHNGADEDEIMDNIYGRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDATPVGSVAPAASA
Ga0194244_1002242023300019150MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLAPGAVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV
Ga0194244_1002312123300019150MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPAQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSHV
Ga0194244_1005947823300019150MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPAQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV
Ga0182059_111577123300019272Salt MarshMKISGYNGADEDEIMDNIYGRYSREGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPGQVPAYLAKNFESTWNHFDQNHEGWIRYEETHTFQRFLNGALNKFKNAPGSIMDLSSGGASYPLPYPQGSEATPVGQV
Ga0182059_146310513300019272Salt MarshMKVSGFNGADEDEIMDNIFSRYSREGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKAWDHFDQNHEGWIRYEETHTFQRYLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV
Ga0182059_153947213300019272Salt MarshMHVSGYNGADEDEIMDNIFSRFSNEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPAEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDLTSGGTNYPLPYPAGSEATPVS
Ga0182059_173116013300019272Salt MarshVKVTRWQSDNSPQFGQNDPSASGQTVWQDMAPSGYNGADEDEIYDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEAAHKLKPNEVPGYLDQNFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAGAPGSIGDLNSGGSNYVLPYPENSEATPVGSV
Ga0182077_149548313300019281Salt MarshMRVSGFNGADEDEIMDNIFSRYSKEGRTTSGHKTGQKLLMKDEARLAAGTILEAAHKLTPENVPKFLNANFESAWNYFDQNHEGWIRYEETHTFQRYLQGKLNKFNGAPGSITDLSSGGAVYQLQYPVGANI
Ga0182075_105156223300019282Salt MarshMKISGYNGADEDEIMDNIFGRFSKEGRTTSGHKTGQKLLMKDDAKLPAGTILEAAHKLAPKDVPGFLDAKFEGAWNHFDQNHEGWIRYEETHTFQRYLMGSLNKFSGAPGSIGDLSSGGSTYPLPYPANAEKVPVGSV
Ga0206125_1019055313300020165SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWVRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGSV
Ga0211702_1027052713300020422MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLTPGQVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDAVPVSHV
Ga0208222_106677913300020566FreshwaterIYDNIFSRFSKEGLTPSGHKTGQKLLMKDDAKIASGQSLEAAHWLSPSEVPSYLDANFENAWNHYDQNGEGWIRYEETHVFFRYLLGKLNRFTGAPGSISDLSSGGKAYKLHYSTTKREKTPVGAV
Ga0206126_1025831213300020595SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWVRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGSV
Ga0206677_1017861313300021085SeawaterMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGYLEQNFETAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGVAYPLPYPAGSEATAVGAV
Ga0206677_1027787013300021085SeawaterMHISGYNGADEDEIFDNIYSKFSSEGLTSTGHKTGQKLLMKDDAKLAAGQTLEAAHYLKPDDVPAYLNANFEDAWNHFDQNHEGWIRYEETHTFQRYVQGKLNKFALAPGSISDMSSGGVAYNNIVPAGTSS
Ga0206687_102603213300021169SeawaterMAPSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGAV
Ga0206687_122119113300021169SeawaterMHISGYNGADEDEIFDNIYSKFSSEGLTSTGHKTGQKLLMKDDAKLAAGQTLEAAHYLKPDDVPAYLNANFEDAWNHFDQNHEGWIRYEETHTFQRYVQGKLNKFALAPGSISDMSSGGVAYNNIVPAGTSSISVGNQ
Ga0206687_128313613300021169SeawaterKDQHGDMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGWLDTNFEKSWNHFDQNHEGWIRYEETHTFQRYLMGALNKFALAPGSIGDMTSGGKAYPLPFPAASEAVAVGAV
Ga0206687_133550113300021169SeawaterMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPVYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPENSEA
Ga0206687_137927813300021169SeawaterMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLQPGEVPSYLEANFENSWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGVNYPLPYPSGSEATAVGAV
Ga0206687_173391923300021169SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKMAGGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYP
Ga0206687_182730713300021169SeawaterMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGYLESNFENAWNHFDQNHEGWIRYEETHTFQRYLNGQLNKFAAAPGSLGDLTSGGAAYPLPYPAGSESVAVGAV
Ga0210301_140592713300021325EstuarineEDMKLSGFNGADEDEIMDSVYARYSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKMAPAAVPAYMDANFENAWNHFDQNKEGWIRYEESHTMQRYLQGKLNKLDKAPGSIGDLASGGDKYNTLPAGDNATPVGAVAAVAATTEAP
Ga0206691_110200313300021342SeawaterMDNVYSRFSKEGETPSGHKTGQKLLMKDDAKLASGTVLEAAHKLLPGQVPAYLDKNFEDSWNHFDQNHEGWIRYEETHTFQRFLNGKLNEFKGAPGSITDLSSGGTNYPLPFPQGSEQTPVGQV
Ga0206691_110328913300021342SeawaterETWKDQHISGYNGADEDEIMDNVYGRYSREGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLIPAKVPGYLDANFENSWAHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLSSGGAVYPLPYPAGSEAVPVGGV
Ga0206688_1003233423300021345SeawaterMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPAEVPGWLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLMGSLNKFALAPGSLGDMTSGGKAYPLPF
Ga0206688_1021938213300021345SeawaterMHLSGFNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGWLDGNFEKSWAHFDQNHEGWIRYEETHTFQRHLMGSLNGFALSPGSIGDMSSGGKNYPLPFPAASESVAVGAV
Ga0206688_1057164213300021345SeawaterMRVSGFNGADEDEIMDNVFSRYSQEGRTPSGHKTGQKLLMKDDARLAAGTILEAAHKLAPADVPKYLNSNFESAWSHFDQNHEGWIRYEETHVFQRYIQAALNKFNGAPGSITDLASGAAAYALSYPAGSEQTPIRQV
Ga0206688_1062927123300021345SeawaterMAPSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEATHKLKPSDVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRYLNGNLNRFAAAPGSIGDLNSGGSNYVLPYPDGSESVPVGAV
Ga0213862_1022016113300021347SeawaterKEGRTTSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKAWDHFDQNHEGWIRYEETHTFQRYLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV
Ga0206695_111466723300021348SeawaterMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWNHFDQNHEGWIRYEETHTFQRHLMGSLNKFALAPGSIGDMSSGGKGYPLPYPLKSEDVPVGGI
Ga0206695_165401323300021348SeawaterMAPSGYNGADEDEILDNIFSRFTKQRRSPCGYETGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGAV
Ga0206692_141283213300021350SeawaterMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPVYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPENSEATAVGAV
Ga0206692_188502913300021350SeawaterMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKMLMKDDAKLAAGQILEAAHFLKPDEVPDFLNANFETAWTYFDQNHEGWIRYEETHTFQRFIQGKLNKFALAPGSISDINSGGAAYNTIVPAGTSVIAVGNQ
Ga0206693_105795223300021353SeawaterMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSSWGHFDQNHEGWIRYEETHTFQRFLQGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSKV
Ga0206693_132823323300021353SeawaterMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLRPQEVPGWLDTHFEDSWNHYDQNHEGWIRYEETHTFQRHLQATLNKFALSPGSISDMTSGGKAYPLPWPVDSEKVPVGGV
Ga0206693_194462413300021353SeawaterMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLTPAEVPGYLDSNFENAWNHFDQNHEGWIRFEETHTFQRYLNGNLNKLALAPGSIGDLSSGGALYTTLPAGHDATAVGAVGL
Ga0206690_1023011613300021355SeawaterMHLSGYNGADEDEIMDNIFSRYAKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGTLNQFALAPGSLSDMTSGGKAYPLPYPAGSEAVPVGGV
Ga0206689_1045409223300021359SeawaterMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPSEVPGWLDGNFEKSWNHFDQNHEGWIRYEETHTFQRHLMGSLNKFALAPGSIGDMSSGGKGYPLPYPADSEKVPVGGI
Ga0206689_1110605223300021359SeawaterMDNIYSRYSREGRTPSGHKTGQKLLMKDDAKLASGTVLEAAHKLDPSKVPAYLDANFENSWNHFDQNHEGWIRYEETHTFQRYLNGPLNKFANAPGSIGDLQSGGAVYPLPYPAGS
Ga0206689_1111696913300021359SeawaterMRVSGFNGADEDEIMDNVYSRYSEEGRTTSGHKTGQKLLMKDQARLAAGTVLEAAHKLSPADVPKYLEANFESAWNHFDQNHEGWIRYEETHTFQRYLNGKLNKFNAAPGSITDLTSGGVNYALSYPAGSEQTPIRQV
Ga0206689_1112662113300021359SeawaterRNVDQSTWKDMRVSGFNGADEDEIMDNVFSRYSQEGRTPSGHKTGQKLLMKDDARLAAGTILEAAHKLAPADVPKYLNSNFESAWSHFDQNHEGWIRYEETHVFQRYIQAALNKFNGAPGSITDLASGAAAYALSYPAGSEQTPIRQV
Ga0206123_1015857113300021365SeawaterMHVSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLESAHKLKPAEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDLTSGGTAYPLPYPAGSEATAVGAV
Ga0213860_1033512613300021368SeawaterAVKVTRWQSDNSPQFGQNDPSASGQTVWQDMAPSGYNGADEDEIYDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEAAHKLKPNEVPGYLDQNFENAWNHYDQNHEGWIRYEETHTFQRYLNGNLNKFAGAPGSIGDLNSGGSNYVLPYPEGSEATPVGSV
Ga0213863_1028975323300021371SeawaterMTLSGHNGADEDEIMDNIYGRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTLPAGHDLTPVGAVAPTAAAXA
Ga0213868_1053145013300021389SeawaterMTLSGHNGADEDEIMDNIYGRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSEVPAYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKLALAPGSIGDLSSGGALYTTL
Ga0063132_10206313300021872MarineMAPSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEATHKLKPSDVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGNLNRFAAAPGSIGDLNSGGSNYVLPYPDGSEGTPVGAV
Ga0063132_10702813300021872MarineMAPSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPSDVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRFLNGNLNRFAGAPGSIGDLNSGGSNYVLPYPEGSESVPVGAV
Ga0063117_103321213300021881MarineMHLSGFNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLKPAEVPGWLDANFEKAWNHFDQNHEGWIRYEETHTFQRFLMGSLNKFAMAPGSIGDMTSGGKAYPLPFPAGAEATPVGSVGTDGV
Ga0063114_103451913300021886MarineMHISGYNGADEDEIMDNIFSKYSREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLAPAKVPGYLEANFENSWNHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAAGSITDLSSGGPAYPLVYPLNAEQVPVGSV
Ga0063089_104396213300021889MarineMAPSGYNGADEDEILDNIYSRYSHEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPYPDASEATVVGAV
Ga0063090_108315613300021890MarineREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDAVPVSHV
Ga0063142_105703513300021893MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLNKFALAPGTISDMSSGGKAYPLPYPAASEAVPVGGV
Ga0063100_108817013300021910MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAGGMALEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPFPEGSEATVVGAV
Ga0063133_101607313300021912MarineEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKLASGTVLEAAHKLNPHQVPAYLDANFENSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAETVPVGHV
Ga0063104_103670723300021913MarineMKISGYNGADEDEIMDNIYSRYSREGQTPSGHKTGQKLLMKDDAKLACGTVLEAAHKLPPQSVPAFLAKNFEAAWNHFDQNHEGWIRYEETHVFQRFISGGLNKFKNAPGSIMDLSSGGATYPLPYPQGSEATPVGQV
Ga0063104_106717313300021913MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAGGMALEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPFP
Ga0063085_104438323300021924MarineMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPAEVPGYLDSNFENAWSHFDQNHEGWIRYEETHTFQRFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGHAATAVGAVAPA
Ga0063096_100668313300021925MarineMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGTLNAFALSAGSISDMTSGGKAYPLPFPAASETVAVGAV
Ga0063096_107021313300021925MarineLSGYNGADEDEIMDNIYSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGWLDTNFEKSWNHFDQNHEGWIRYEETHTFQRYMMGALNKFALAEGSIGDMTSGGKAYPLPFPAGSEAVAVGAV
Ga0063103_105552313300021927MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKMAGGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPFPADSEATVVG
Ga0063103_112830923300021927MarineMHVSGYNGADEDEIMDNIYSRFSQEGRTPSGHKTGQKLLMKDDAKLAAGTTLESAHKLQPNEVPGYLEANFENSWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFSGAPGSIGDLTTGGTNLVLPYPAGSEATAVGAV
Ga0063145_103409313300021930MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPVYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEASEETAVGAV
Ga0063872_104039713300021932MarineMAPSGYNGADEDEILDNIYSRYSHEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPYPDASE
Ga0063139_109167613300021934MarineMAPSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPVYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVV
Ga0063139_120129413300021934MarineFSKYSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPSEVPAYLDANFEPSWGHFDQNHEGWIRYEETHTFQRHLQGQLNKFANAAGSITDLSSGGPVYPLVYPLDAESVPVGKV
Ga0063101_104612513300021950MarineMHLSGYNGADEDEIMDNVFSRYAKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHMLRPQEVPGWLDKNFEGSWSHFDQNHEGWIRYEETHTFQRHLMGTLNNFAMSPGSISDMTSGGKAYPLPSPAGSEAVAVGAV
Ga0063101_106344613300021950MarineMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKMLMKDDAKLAAGQILEAAHFLKPEEVPDFLNTNFEGSWEHFDQNHEGWIRYEETHTFQRFIQGTLNKFALAPGSISDMASGGAAYGTIVPAGTSVISVGNQ
Ga0063755_107121913300021954MarineNVDTWVHQDQYLSGYNGADEDEIMDNIFSKFSKEGITPSGHKTGQKLLMKDEAKLAAGMILESAHKLEPAEVPAFLDAGFEDAWNHYDQNHEGWIRYEETHTFQRFLMGSLNKFTLAAGSITDMNSGGAAYPLPYSTGASEDAPEATPVGGV
Ga0063755_110072923300021954MarineMDNIFGRFSKEGRTPSGHKTGQKLLLKDDAKLAAGTILEAAHKLKPAEVPGYLDSNFESAWSHFDQNHEGWIRYEETHTFQKFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGHDATPVGAVAPTAAA
Ga0063755_111884113300021954MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGAV
Ga0063755_111884213300021954MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVV
Ga0222717_1025139213300021957Estuarine WaterMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPTEVPGYLESNFENAWNHFDQNHEGWIRYEETHTFQRYLNGQLNKFAAAPGSLGDLTSGGAAYPLPYPAGSESVAVGAV
Ga0222716_1042854313300021959Estuarine WaterMDNVFSRFSREGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPKDVPAYLDANFEKSWNFFDQNHEGWIRYEETHTFQRHLQGKLNKFTAAPGSIGDLASGGSAHKLASGMDAVKVGAV
Ga0222716_1056300913300021959Estuarine WaterMHISGYNGADEDEIMDNIFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPKDVPGYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQGALNKFTAAPGSIGDLSSGGSTYPLPYPANAE
Ga0222715_1027125933300021960Estuarine WaterMHISGYNGADEDEIMDNIFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPKDVPGYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQGALNKFTAAPGSIGDLSSGGSTYPLPYPANAEKVPVGSVXVD
Ga0210310_103441313300022369EstuarineEIMDNIYAKFCKEGMTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPAEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRYMMGALNKFALAPGSIGDMTSGGKAYPLPFPAASEAVAVGAV
Ga0255781_1038690113300022934Salt MarshSKEGRTTSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPSAVPAYLEANFEKAWDHFDQNHEGWIRYEETHTFQRYLNGALNKFTGAPGSIGDLTSGGATYPLPYPANSEKVPVGGV
Ga0255778_1036461813300023084Salt MarshSGFNGADEDEIMDNIFSRYSKEGRTTSGHKTGQKLLMKDEARLAAGTILEAAHKLTPENVPKFLNANFESAWNYFDQNHEGWIRYEETHTFQRYLQGKLNKFNGAPGSITDLSSGGAVYQLQYPVGANITPIRQV
Ga0255776_1051606313300023173Salt MarshEGRNLDPTTWKDMRVSGFNGADEDEIMDNIFSRYSKEGRTTSGHKTGQKLLMKDEARLAAGTILEAAHKLTPENVPKFLNANFESAWNYFDQNHEGWIRYEETHTFQRYLMGKLNKFNGAPGSITDLTSGGAVYQLQYPVGANITPIRQV
Ga0255777_1036589323300023175Salt MarshTWADQKISGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGTILEAAHKLTPAEVPAYVDANFENSWNHFDQNKEGWIRYEETHTFQRHFMGALNKLSGAPGSIGDLASGGVQYNTLPAGHDATPVGAVAPAGGEAGATTGEGAGAPAVGP
Ga0232113_102855923300023679SeawaterMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPDESEATVVGAV
Ga0228681_104673913300023683SeawaterMHISGYNGADEDEIFDNIYSKFSSEGLTSTGHKTGQKLLMKDDAKLAAGQTLEAAHYLKPDDVPAYLNANFEDAWNHFDQNHEGWIRYEETHTFQRYVQGKLNKFALAPGSISDMSSGGVAYNNIVPAGTSSIS
Ga0228686_106357713300023685SeawaterMAPSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEATHKLKPSDVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRFLNGNLNRFAAAPGSIGDLNSGGSNYVL
Ga0228683_102421713300023694SeawaterMHISGYNGADEDEIMDNVYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSAVPAYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLTAEAVPVGHV
Ga0228687_104449013300023696SeawaterMAPSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYP
Ga0228682_105371813300023698SeawaterVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSSWGHFDQNHEGWIRYEETHTFQRFLQGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSK
Ga0228684_106734113300023704SeawaterMHISGYNGADEDEIMDNVFSKYAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPGQVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV
Ga0228684_107619913300023704SeawaterLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSSWGHFDQNHEGWIRYEETHTFQRFLQGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDAVPVSKV
Ga0228684_108305313300023704SeawaterVFSRFAREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLKPHEVPSYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSH
Ga0228672_113018413300024335SeawaterPLGRNEAKDQHGDMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGWLDTNFEKSWNHFDQNHEGWIRYEETHTFQRYLMGALNKFALAPGSIGDMTSGGKAYPLPFPAASEAVAVGAV
Ga0244777_1079633213300024343EstuarineETYKEQILSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKMAPAAVPAYMDANFENAWNHFDQNKEGWIRYEESHTMQRYLQGKLNKLDKAPGSIGDLASGGDKYNTLPAGDNATPVGAVAATAEAS
Ga0228650_119710613300024417SeawaterKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGAV
Ga0208660_112700913300025570AqueousNGADEDEIMDSVFSHYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPSEVPGYLSANFETSWDHFDQNHEGWIRYEETHTFQRHMMGALNKFTGAPGSITDLTSGGSTYPLPYPAGSEATPVGSV
Ga0209716_109564613300025626Pelagic MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGAV
Ga0209716_113682113300025626Pelagic MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATAVGAVXA
Ga0209505_115606113300025690Pelagic MarineMDNIFSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGTILEAAHKLAPAAVPAYMDANFENAWNHFDQNKEGWIRYEESHTMQRYLQGKLNKLDGASGSIGDLASGGDKYNTLPAGDAATAVGAV
Ga0209199_126369813300025809Pelagic MarineIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGA
Ga0209632_1027016123300025886Pelagic MarineSGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDAVPVSHV
Ga0209961_105283813300026130WaterMHISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPKDVPAYLDANFEKSWNFFDQNHEGWIRYEETHTFQRHLQGKLNKFTAAPGSIGDLASGGSAHKLASGMDAVKVGAV
Ga0247594_107141813300026448SeawaterMAPSGYNGADEDEIMDNIFSRFSKEGRTPSGHRTGQKLLMKDDAKLAAGTALEATHKLKPSDVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGNLNRFAAAPGSIGDLNSGGSNYVLPYPDGSESTPVGAV
Ga0247568_110462313300026462SeawaterTDQHGEMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLKPQEVPGWLDANFEKAWDHFDQNHEGWIRYEETHTFQRFLMGSLNQFALAPGSISDMTSGGKAYPLPFPTGSEAVAVGAV
Ga0247598_111961613300026466SeawaterMHISGYNGADEDEIMDNIYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTCLEAAHKLAPSTVPAYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAETVPVGKV
Ga0247598_115811513300026466SeawaterMHISGYNGADEDEIMDNVYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSAVPAYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLTAEAVPVGH
Ga0247599_111418013300026470SeawaterARWQEMHISGYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDQAKLASGTILEAAHKLKPGDVPSFLDANFENSWSHFDQNHEGWIRYEETHTFQRHLMGSLNKFANAPGSITDLSSGGVAYPLNYPLDSESVPVSHV
Ga0247602_113145813300026471SeawaterGADEDEIMDNVYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSAVPAYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLTAEAVPVGHV
Ga0247592_112987713300026500SeawaterMAPSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPFPEGSEATVVGAV
Ga0247605_114648713300026503SeawaterMDNIYAKFSKEGQTPSGHKTGQKLLMKDEAKIAAGTVLEAAHKLNPSQVPAFLDANFEKAWSHYDQNGEGWIRYEETHTFQRYLNGALNKFAGAPGSITDMASGGATYKLPYPTGSEATAVGAV
Ga0247587_118315913300026504SeawaterMHISGYNGADEDEIMDNIYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTCLEAAHKLAPSTVPAYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAETVPVGK
Ga0209279_1018898323300027771MarineYSRYSQEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPSEVPSYLEANFENSWNHYDQNHEGWIRYEETHVFQRFLNGQLNKFAAAPGSIGDTTSGGVSYPLPYPAGSEATAVGAV
Ga0209092_1054451323300027833MarineYSREGVTPSGHKTGQKLLMKDDAKLASGTVLEAAHKLAPGQVPAFLAKNFEAAWNHFDQNHEGWIRYEETHTFQRFLTGGLNKFKNAPGSIMDLSSGGATYPLPYPQGSEATPVGQV
Ga0209712_1037136213300027849MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFESAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPDASEATVVGAV
Ga0209712_1066900113300027849MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAGGMALEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDL
Ga0209712_1077815213300027849MarineDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWVRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGSV
Ga0256412_124166023300028137SeawaterMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKLLMKDEAKIAAGQILEAAHFLKPDEVPSFLDAHFEDAWTHFDQNHEGWIRYEETHVFQRYIQGSLNKFAGSPGSISDLKSGGKAYNGWLPSGGEQVAVGRQ
Ga0256412_124278213300028137SeawaterMAPSGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEATHKLKPSDVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRFLNGNLNRFAAAPGSIGDLNSGGSNYVLPYPDGSESTPVGAV
Ga0256412_125360013300028137SeawaterMTLSGHNGADEDEIMDNIYSRLSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPADVPGYLDSNFESAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKLALAPGSIGDLSSGGDKYVTLPAGHDATPVGSVAP
Ga0256412_127450923300028137SeawaterMDNIFSRFSKEGKTPSGHKTGQKLLMKDDGKIAAGTILEAAHKLEPSAVPAYMDANFENAWNHFDQNAEGWIRYEETHTFQRYFMGSLNKLAGAAGSIGDLASGGVQYNTLPAGHDATPVGAVAPDGTA
Ga0256412_133438513300028137SeawaterYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLQPSAVPAYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLTAEAVPVGHV
Ga0256417_119542413300028233SeawaterMAPSGYNGADEDEIYDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEA
Ga0228613_107307713300028279SeawaterMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGAV
Ga0256413_118077613300028282SeawaterMDNIFSKFSKEGVTPSGHKTGQKLLMKDEGKLAAGMILEAAHKLEPAQVPAFLDERFEDAWNHYDQNHEGWIRYEETHTFQRFLMGYLNKFTLAAGSITDMNSGGAAYPLPYSTGASPDAPEDTPVGGV
Ga0306909_11367423300028405Saline LakeMHVSGYNGADEDEIMDNIYSRYSKEGVTPSGHKTGQKLLMKDEARLAAGTVLEAAHKLKPVDVPTYLNANFESAWNHFDQNHEGWIRYEETHVFQRFLQGKLNKFQGAPGSITDLTSGGINYPLPYPQGSEQTPVGQV
Ga0306910_102814913300028412Saline LakeMHVSGYNGADEDEIMDNIYSRFSREGVTPSGHKTGQKLLMKDEARLASGTVLEAAHKLTPNQVPAYLNANFETAWNHFDQNHEGWIRYEETHVFQRFLQGGLNKLSNAPGSIMDLSSGGVNYPLPYPQGSEQTPVGQV
Ga0304731_1019060413300028575MarineMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPGYLDANFEAAWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDLTSGGTAYPLPYPAGSEATAV
Ga0304731_1022374913300028575MarineMRLWTTFFSKFSKEGLTPSGHKTGQKLLMKDDAKVAAGTVLEAAHKLAPSQVPSYLDANFETSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLASGGPVYPLVYPLDAESVAVGKV
Ga0304731_1043161423300028575MarineMHISGYNGADEDEIMDNIFSKYSREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLTPAKVPGYLEANFENSWNHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAAGSITDLSSGGPAYPLVYPLNAEQVPVGSV
Ga0304731_1089362313300028575MarineDPLGRNEAKDQHGDMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPAEVPGLLDTNFEKSWNHFDQNHEGWIRYEETHTFQRYLMGALNKFALAPGSIGDMTSGGKAYPLPFPAASEAVAVGAV
Ga0304731_1092498423300028575MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGTLNKFALAPGSISDMISGGKAYPLPFPAASEAVP
Ga0307402_1080785713300030653MarineMHVSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVPGYLEANFEATWNHFDQNHEGWIRYEETHTFQRYLNGQLNKFAAAPGSLGDLTSGGVAYPLPFPAGSESVAVGAV
Ga0307403_1075559713300030671MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPTYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGVNYVLPYPEASEAVVV
Ga0307403_1082049413300030671MarineIYGHYAKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVPAYLDAHFEAAWDHFDQNHEGWVRYEETHTLQRFLNGQLNKFSAAPGSLGDLSSGGKTYPLPYPAASEAVPVGG
Ga0307398_1065772223300030699MarineMHISGYHGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLHPADVPGYLDKNFETSWNHFDQNHEGWIRYEETHTFQRHIMGQLNKFAMAPGSIGDLSSGGVAYPLPYPAGSEAVPVGAV
Ga0307398_1073469913300030699MarineSDKLGRNVDKTIWEDMRVSGYNGADEDEIMDNVFSRFSKEGVTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLTPADVPAFLNKNFETAWTHFDQNHEGWIRYEETHVFQRFLNGALNKFSGAPGSITDLSSGGSRYALPFPQGSEQTPVGQV
Ga0307398_1076177313300030699MarineMHLSGYNGADEDEIMDNVFARYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLRPQEVPGWLDKNFEGSWDHFDQNHEGWIRYEETHTFQRHLMGTLNQFAMSPGSISDMTSGGKAYPLPFPVGSEAIAVGAV
Ga0307400_1096104713300030709MarineDEDEIMDNIYGHYAKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVPAYLDAHFEAAWDHFDQNHEGWVRYEETHTLQRFLNGQLNKFSAAPGSLGDLSSGGKTYPLPYPAASETVPVGGI
Ga0308133_102911913300030721MarineMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGTLNAFALSAGSISDMTSGGKAYPLPFPAKSEAVPVGGV
Ga0308137_106456713300030722MarineMILSGYNGADEDEIMDNVFARYSKEGRTPSGHKTGQKLLMKDEAKVAAGTILEAAHKLKPSEVPGWLDTNFEAAWSHFDQNHEGWIRYEETHTFQRFLMGSLNNFALAPGTLSDMTSGGKAYPLPSPVGSEAIAVGAV
Ga0073968_1179165913300030756MarineMKISGYNGADEDEIMDNIYGRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLTPAQVPAYLAKNFESSWNHFDQNHEGWIRYEETHTFQRFLNGDLNKFKNAPGSIMDLSSGGATYPLPYPQGSEQTPVGQVXE
Ga0073988_1234440813300030780MarineGRNMDTARWQEMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKVAAGTILEAAHKLAPSAVPAYLDANFETSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVTHV
Ga0073966_1117404823300030786MarineMKISGYNGADEDEIMDNIYGRYSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLTPAQVPAYLAKNFESSWNHFDQNHEGWIRYEETHTFQRFLNGDLNKFKNAPGSIMDLSSGGATYPLPYPQGSEQTPVGQV
Ga0073990_1000879713300030856MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPHEVPSYLDANFDPSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDGVPVSHV
Ga0073990_1199633613300030856MarineSGYNGADEDEIMDNVYSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLAPSAVPAYLDANFENSWGHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVTHV
Ga0073981_1165003713300030857MarineMHLSGYNGADEDEIMDNIFSRYSKEGRTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLRPQEVPGWLDANFEKSWDHFDQNHEGWIRYEETHTFQRHLMGSLNKFALAPGSISDMTSGGKAYPLPYPAGSETVAVGAV
Ga0073977_160794813300030948MarineMDSVYSHYSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLNPNQVPDYLAYSFEDAWNHFDQNHEGWIRYEETHTFQRYLNGHLNGFYGADGSITDIAHGGQANFGA
Ga0073984_1124897013300031004MarineMHISGYNGADEDEIMDNIFSRFSHEGLTPSGHKTGQKLLLKDEAKIAAGMILESAHKLQPHEVPAFLESNFENAWNHYDQNHEGWIRYEETHTFQKYLMGHLNKYILAPGSISDMASGGAAYNLPYPEGSEATAVGNW
Ga0073984_1125461623300031004MarineMHISGYNGADEDEIMDNIFSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLNPSQVPGYLDANFEGSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVTHV
Ga0073984_1128131813300031004MarineMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKLLMKDEAKIAAGQILEAAHFLTPDAVPGFLDAHFEDAWAHFDQNHEGWIRYEETHVFQRYIQGALNKFAGSPGSIGDIKSGGKAYNGWLPSGGEQVAVGRQ
Ga0073974_129226613300031005MarineDNIYGRYSREGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPADVPTFLNKNFESAWNHFDQNHEGWIRYEETHTFQRYLQGTLNKFKGAPGSITDLTSGGKAYPLPYPQGSEQTPVGQV
Ga0073980_1135749413300031032MarineMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPHEVPAYLDANFETSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAETVPVGHV
Ga0073986_1202731523300031038MarineMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPHEVPAYLDANFDPSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGAHYPLTYPLGSEAVPVSHV
Ga0073989_1000666813300031062MarineMHISGYNGADEDEIMDNIYSKFSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPHQVPGYLDANFENSWNHFDQNHEGWIRYEETHTFQRHLNGQLNKFANAPGSITDLSSGGPAYPLVYPLDAESVGVGHV
Ga0073989_1355746313300031062MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPHEVPSYLDANFDPSWSHFDQNHEGWIRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLVYPLGSDGVPVSHV
Ga0073989_1361651413300031062MarineMHISGYNGADEDEIMDNIFSKYSKEGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLKPHDVPQYLDANFESSWGHFDQNHEGWIRYEETHTFQRHLMGQLNKFANAPGSITDLSSGGPVYPLVYPLDAESVPVGKV
Ga0307388_1091346413300031522MarineMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLESAHKLQPGEVPSYLEANFENSWNHFDQNHEGWIRYEETHTFQRYLNGQLNKFAAAPGSLGDLTSGGTNYPLPYPSGSEATAVGAV
Ga0307492_1024124613300031523Sea-Ice BrineMAPSGYNGADEDEILDNIYSRFSREGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGYLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGGSNYILPFPADSEATPVGSV
Ga0307489_1025499023300031569Sackhole BrineMKLSGFNGADEDEIMDSVYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTVLEAAHKLTPESVPAYLSKNFESAWDHFDQNHEGWIRYEETHVFQRFLQGGLNKFSGAPGSITDMASGGATYPLPFPMGSERTPVGQV
Ga0308134_109238613300031579MarineMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGTLNAFALSPGSLSDMTSGGKAYPLPFPAKSEAVPVGGV
Ga0308134_110785013300031579MarineMAPSGYNGADEDEILDNIYSRYSKEGRTPSGHKTGQKLLMKDDAKLAGGMALEASHKLSPKDVPTYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPFPEGSEATVVGAV
Ga0308134_115097813300031579MarineMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLKPSEVPGWLDSNFEKSWDHFDQNHEGWIRYEETHTFQRHLMGTLNAFALSAGSISDMTSGGKAYPLPFPAASETVAVGA
Ga0308132_110420513300031580MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKMAGGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPDASEATVVGAV
Ga0307996_113790813300031589MarineISGFNGADEDEIMDNIYGHYAKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVPAYLDAHFEAAWDHFDQNHEGWVRYEETHTLQRFLNGQLNKFSAAPGSLGDLSSGGKTYPLPYPAASEAVPVGGI
Ga0302121_1006754123300031626MarineMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDVVPVSHV
Ga0307396_1056751313300031717MarineMHISGYNGADEDEIMDNVFSRYAREGLTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPHQVPAYLDANFDSSWSHFDQNHEGWVRYEETHTFQRHLMGQLNKFAGAPGSITDLSSGGPKYPLTYPLGSDTV
Ga0307396_1059454513300031717MarineMHVSGYNGADEDEIMDNVYARFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPAYLDTNFENSWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGQAYPLPYPAASEATAV
Ga0307381_1020761113300031725MarineMSISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLLKDEAKIAAGMILEAAHKLQPHEVPQYLEGSFENAWDHYDQNHEGWIRYEETHTFQRYMMAHLNKFILAPGSISDMASGGAAYSLPYPEGSETTAVGAV
Ga0307381_1036330013300031725MarineMHVSGYNGADEDEIMDNVYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPNEVPGYLDANFEASWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDLTSGGTAYPLPYPAGSESVAVG
Ga0307381_1039193113300031725MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKMAGGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPY
Ga0307391_1056419523300031729MarineMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPAEVPGYLDSNFENAWSHFDQNHEGWIRYEETHTFQRFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGHDATPVGAVAPAAAV
Ga0307391_1065519523300031729MarineMAPSGYNGADEDEILDNIYSRFSNEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLKPNEVPGYLDSNFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKCAAAPGSIGDLNSGGSNYILPFPADSEATPVGAV
Ga0307391_1077825613300031729MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPVYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGVNYVLPYPEASEAVVV
Ga0307391_1082361413300031729MarineMHVSGYNGADEDEIMDNVFSRYAQEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPSEVPSYLEANFENSWNHYDQNHEGWIRYEETHTFQRYMMGALNKFALAPGSIGDMATGGKAYPLPFPAASEAVV
Ga0307391_1090992723300031729MarineMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTVLESAHKLQPSEVPSYLEANFENSWNHFDQNHEGWIRYEETHVFQRFLNGQLNKFAAAPGSLGDLTSGGVNYPLPYPAGSEATAVG
Ga0307397_1036756613300031734MarineMHLSGYNGADEDEIMDNVFSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEASHKLKPSEVPGWLDAHFEGSWDHYDQNHEGWIRYEETHTFQRHLMGSLNKFALSPGSLSDMTSGGKAYPLPFPADSEKVPVGGV
Ga0307397_1038370613300031734MarineMHVSGYNGADEDEIMDNVYARFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLKPAEVPAYLDTNFENSWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGVAYPLPYPAASEATAVGAV
Ga0307394_1032288013300031735MarineMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPNEVPGFLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGGANYVLPYPEASEATAVGSV
Ga0307394_1033206113300031735MarineMAPSGYNGADEDEILDNIYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPYPDASEATPVGSV
Ga0307394_1037319913300031735MarineMAPSGYNGADEDEILDNVYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYVLPYPAGSEATVVGSV
Ga0307394_1039162513300031735MarineMTLSGYNGADEDEIMDNVYSRYSKEGRTPSGHKTGQKLLMKDEAKIAAGTILEAAHKLRPQEVPGWLDKNFEAAWSHFDQNHEGWIRYEETHTYQRYLMGTLNQFAMSPGSISDMTSGGKAYPLPFPVGSETLAVGAV
Ga0307394_1040128013300031735MarineMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLESAHKLQPGEVPSYLEANFENSWNHFDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSLGDLTSGGTNYPLPYPSGSEATAVGAVXISNDK
Ga0307387_1084577913300031737MarineMHVSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLKPTEVPSYLEANFENSWNHYDQNHEGWIRYEETHTFQRFLNGQLNKFAAAPGSIGDTTSGGTNYPLPYPSGSEATAVGAV
Ga0307384_1035650713300031738MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKMAGGMALEASHKLTPKDVPSYLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGAV
Ga0307383_1035097723300031739MarineMHISGYNGADEDEIMDNIYSKFSSEGLTSTGHKTGQKLLMKDDAKLASGQTLEAAHFLHPEDVPSYLNANFEDAWSHFDQNHEGFIRYEETHTFQRFIQGKLNHFALAPGSISDLSSGGVAYNTIVPAGTGSISVGNQ
Ga0307383_1044313423300031739MarineMHISGYNGADEDEIMDNIFSKYSKEGITPSGHKTGQKLLMKDQAKLACGTILEAAHKLSPADVPGFLDGNFENSWSHFDQNHEGWIRYEETHTFQRHLMGNLNKFANAPGSITDLSSGGPAYPLNYPLDSESVSVGHV
Ga0307383_1063362013300031739MarineMAPSGYNGADEDEILDNIFSRYSKEGRTPSGHKTGQKLLMKDDAKLAAGMSLEASHKLSPKDVPVYLDSNFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPFPEDSEATVV
Ga0307383_1067900013300031739MarineMAPSGYNGADEDEILDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPNEVPGFLDANFENAWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGASNYVLPYPADSE
Ga0307395_1040375613300031742MarineMHVSGYNGADEDELMDNVYSRYSQEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLKPNEVPSCLEANFENSWNHYDQNHEGWIRYEETHVFQRFISGALNKFKNAPGSIMDLSSGGAQYPLPYPQGSEATPVGQV
Ga0307395_1047746613300031742MarineMAPSGYNGADEDEILDNIYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPQDVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGANYILPYPEASEATP
Ga0307395_1051856313300031742MarineMKVSGFNGADEDEIMDNVFSRFSKEGVTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLVPGDVPAFLNKNFETAWSHFDQNHEGWIRYEETHVFQRFLNGALNKFSGAPGSITDLSSGGSRYALPFPQGSEQTPV
Ga0307382_1045775713300031743MarineNVDQTVHQDMHISGYNGADEDEIMDNIYSKFSSEGLTSTGHETGQKLLMKDDAKLASGQTLEAAHFLHPEDVPSYLNANFEDAWSHFDQNHEGFIRYEETHTFQRFIQGKLNHFALAPGSISDLSSGGVAYNTIVPAGTGSISVGNQ
Ga0307404_1046784913300031752MarineMAPSGYNGADEDEILDNIYSRFSHEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPGFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGTNYVLPYP
Ga0315270_1061053213300032275SedimentGRNVDKYTHKDIKISGYNGADEDEIYDNVFSRFSKEGLTPSGHKTGQKLLMKDDAKLASGQSLEAAHWLSPAEVPSYLDANFENAWNHYDQNGEGWIRYEETHTFMRFLLGKLNRFTGAAGSISDLSSGGKAYKLHYSTTKREKTPVGAV
Ga0314670_1059417313300032470SeawaterTLSGHNGADEDEIMDNIYSRFSKEGRAPSGHTTGQKLLMKDDAKIAAGTVLEAAHKLKPTEVPGYLDSNFEGAWNHFDQNHEGWIRYEETHTFQKFLNGNLNKLAAAPGSIGDLSSGGDKYVTLLAGHDQTPVGSVAPPS
Ga0314675_1054076613300032491SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATAVGAV
Ga0314679_1044726113300032492SeawaterMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQIFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDAVPVSHV
Ga0314679_1056979413300032492SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGS
Ga0314688_1048594713300032517SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPADSEAVPVGAV
Ga0314688_1077002813300032517SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVL
Ga0314689_1068544713300032518SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYV
Ga0314667_1071928613300032520SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATVVGA
Ga0314680_1065745923300032521SeawaterMHISGYNGADEDEIMDNIFSKYSKEGITPSGHTTGQKLLMKDQAKLAAGTILEAAHKLGPADVPGFLDANFESSWGHFDQNHEGWIRYEETHTFQRHLMGNLNKFANAPGSITDLSSGGPAYPLNYPLDSESVAVGHV
Ga0314680_1103008413300032521SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYP
Ga0314677_1056508513300032522SeawaterANGKNFDGAQTYADMTLSGHNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGMTLEAAHKLSPAEVPAYLESNFETAWNHFDQNHEGWIRYEETHVFQRFLNGNLNKLALAPGSIGDLSSGGDKYVTLPAGHDATPVGSVAP
Ga0314682_1070365423300032540SeawaterMHISGYNGADEDEIMDNIFSKYSKEGITPSGHKTGQKLLMKDQAKLAAGTILEAAHKLGPADVPGFLDANFESSWGHFDQNHEGWIRYEETHTFQRHLMGNLNKFANAPGSITDLSSGGPAYPLNYPLDSESVPVGHV
Ga0314674_1058517213300032615SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLSSGGALYTTLPAGHDATAVGAVGL
Ga0314671_1066958013300032616SeawaterKNEAKDQHGEMHLSGYNGADEDEIMDNVFSRFSKEGRTPSGHKTGQKLLLKDDAKLAAGTILEAAHKLKPAEVPGYLDSNFESAWSHFDQNHEGWIRYEETHTFQKFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGHDATPVGAVAPTAAA
Ga0314671_1075552513300032616SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLP
Ga0314683_1063100413300032617SeawaterMTLSGHNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGMTLEAAHKLSPAEVPAYLESNFETAWNHFDQNHEGWIRYEETHVFQRFLNGNLNKLALAPGSIGDLSSGGDKYVTLPAGHDATPVGSVAP
Ga0314673_1048795823300032650SeawaterMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPAEVPGYLDSNFENAWSHFDQNHEGWIRYEETHTFQRFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGHEATAVGAVAPAAAA
Ga0314678_1057623913300032666SeawaterEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQNHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDAVPVSHV
Ga0314669_1077450613300032708SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEG
Ga0314695_140706813300032724SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLSSGGDKYVTLPAG
Ga0314696_1051290023300032728SeawaterMHISGYNGADEDEIMDNVFSRYSREGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLQPYQVPAYLDANFDSAWSHFDQDHEGWVRYEETHTFQRFLMGQLNKFAGAPGSITDLSSGGPKYPLAYPLGSDAVPVSHV
Ga0314696_1055747913300032728SeawaterDEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDDGKIAAGMTLEAAHKLTPAEVPAYLESNFETAWNHFDQNHEGWIRYEETHTFQKFLNGNLNKLALAPGSIGDLSSGGDKYVTLPAGHDLTPVGSVAP
Ga0314714_1073097613300032733SeawaterSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLTPAEVPTYLDSNFENAWNHFDQNHEGWIRFEETHTFQRYLNGNLNKLALAPGSIGDLSSGGALYTTLPAGHDATAVGAVGL
Ga0314707_1051766313300032743SeawaterVDTWTHQDQYLSGYNGADEDEIMDNIFSKFSKEGITPSGHKTGQKLLMKDEAKLAAGMILESAHKLEPAQVPAFLDERFEDAWNHYDQNHEGWIRYEETHTFQRFLMGSLNKFTLAAGSITDMNSGGVAYPLPYSTGTSPDAPEDTPVGGV
Ga0314704_1047356813300032745SeawaterMTLSGHNGADEDEIMDNIYSRFSKEGRAPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPTEVPGYLDSNFEGAWNHFDQNHEGWIRYEETHTFQKFLNGNLNKLAAAPGSIGDLSSGGDKYVTLPAGHDQTPVGSVAPPS
Ga0314701_1050861813300032746SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATAVGA
Ga0314708_1028352613300032750SeawaterMTLSGHNGADEDEIMDNIYSRFSKEGRAPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPTEVPGYLDSNFEGAWNHFDQNHEGWIRYEENHTFQKFLNGNLNKLAAAPGSIGDLSSGGDKYVTLLAGHDQTPVGSVAPPS
Ga0314694_1051871013300032751SeawaterMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPAEVPGYLDSNFENAWSHFDQNHEGWIRYEETHTFQRFLNGNLNKLALAPGSIGDLSSGGDNYKTLPAGH
Ga0314709_1074097413300032755SeawaterMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSFLDANFETAWNHFDQNHEGWIRYEETHTFQRFLNGNLNKFAAAPGSIGDLNSGGSNYVLPYPEGSEATARCRMSKLLR
Ga0307390_1086509813300033572MarineMAPSGYNGADEDEILDNIYSRFSKEGRTPSGHKTGQKLLMKDDAKLASGTALEASHKLKPNEVPSYLDANFENSWNHFDQNHEGWIRYEETHTFQRYLNGNLNKFAAAPGSIGDLNSGGVNYILPYPADSEATKVGAV
Ga0307390_1096435913300033572MarineDATTWEDMHISGYNGADEDEIMDNVYGHFSKEGRTPSGHKTGQKLLMKEQAKLAAGTVLEAAHKLKPAEVPAFLDGQFEAAWDHFDQNHEGWIRYEETHTFQRYLNGHLNKLTNAPGSLGDMNSGGKVYPLPYPAGSESVAVGAV
Ga0335035_0464124_243_6983300034105FreshwaterLGRNVDKYTHKDTHISGYNGADEDEIYDNIFSRFSKEGLTPSGHKTGQKLLMKDDAKIASGQSLEAAHWLSPSEVPSYLDANFENAWNHYDQNGEGWIRYEETHVFFRYLLGKLNRFTGAPGSISDLSSGGKAYKLHYSTTKREKTPVGAV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.