NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F000533

Metagenome / Metatranscriptome Family F000533

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F000533
Family Type Metagenome / Metatranscriptome
Number of Sequences 1045
Average Sequence Length 40 residues
Representative Sequence WMWTLAFGHHEDRTPTHGYEATREAAMAAFAKSWRRE
Number of Associated Samples 315
Number of Associated Scaffolds 1045

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 25.88 %
% of genes near scaffold ends (potentially truncated) 60.57 %
% of genes from short scaffolds (< 2000 bps) 88.80 %
Associated GOLD sequencing projects 291
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.493 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.249 % of family members)
Environment Ontology (ENVO) Unclassified
(41.531 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.301 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.15%    β-sheet: 0.00%    Coil/Unstructured: 53.85%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 1045 Family Scaffolds
PF04392ABC_sub_bind 6.41
PF00313CSD 2.78
PF03401TctC 0.96
PF01068DNA_ligase_A_M 0.86
PF07045DUF1330 0.67
PF13676TIR_2 0.67
PF00072Response_reg 0.57
PF05050Methyltransf_21 0.57
PF00149Metallophos 0.48
PF02518HATPase_c 0.48
PF13505OMP_b-brl 0.48
PF00589Phage_integrase 0.48
PF12071DUF3551 0.38
PF00239Resolvase 0.38
PF13358DDE_3 0.29
PF01565FAD_binding_4 0.29
PF07883Cupin_2 0.29
PF03928HbpS-like 0.29
PF00346Complex1_49kDa 0.29
PF01734Patatin 0.29
PF06779MFS_4 0.29
PF02705K_trans 0.19
PF06289FlbD 0.19
PF13417GST_N_3 0.19
PF01548DEDD_Tnp_IS110 0.19
PF01527HTH_Tnp_1 0.19
PF00550PP-binding 0.19
PF03797Autotransporter 0.19
PF07369DUF1488 0.19
PF13493DUF4118 0.19
PF00805Pentapeptide 0.19
PF13289SIR2_2 0.19
PF01344Kelch_1 0.19
PF13531SBP_bac_11 0.19
PF12697Abhydrolase_6 0.19
PF08734GYD 0.19
PF07859Abhydrolase_3 0.19
PF13467RHH_4 0.19
PF00753Lactamase_B 0.19
PF030614HBT 0.19
PF00892EamA 0.19
PF04780DUF629 0.19
PF07978NIPSNAP 0.19
PF02735Ku 0.19
PF03466LysR_substrate 0.19
PF00536SAM_1 0.19
PF03734YkuD 0.19
PF13356Arm-DNA-bind_3 0.10
PF00582Usp 0.10
PF00994MoCF_biosynth 0.10
PF03551PadR 0.10
PF00107ADH_zinc_N 0.10
PF13602ADH_zinc_N_2 0.10
PF01588tRNA_bind 0.10
PF13565HTH_32 0.10
PF01494FAD_binding_3 0.10
PF02371Transposase_20 0.10
PF01722BolA 0.10
PF01740STAS 0.10
PF01909NTP_transf_2 0.10
PF00211Guanylate_cyc 0.10
PF08327AHSA1 0.10
PF02668TauD 0.10
PF05694SBP56 0.10
PF06035Peptidase_C93 0.10
PF04909Amidohydro_2 0.10
PF10217DUF2039 0.10
PF13271DUF4062 0.10
PF05658YadA_head 0.10
PF04546Sigma70_ner 0.10
PF09339HTH_IclR 0.10
PF01266DAO 0.10
PF09926DUF2158 0.10
PF13328HD_4 0.10
PF05425CopD 0.10
PF04851ResIII 0.10
PF13426PAS_9 0.10
PF06411HdeA 0.10
PF04632FUSC 0.10
PF03050DDE_Tnp_IS66 0.10
PF06267DUF1028 0.10
PF14319Zn_Tnp_IS91 0.10
PF00596Aldolase_II 0.10
PF13305TetR_C_33 0.10
PF14235DUF4337 0.10
PF00378ECH_1 0.10
PF12706Lactamase_B_2 0.10
PF12153CAP18_C 0.10
PF01612DNA_pol_A_exo1 0.10
PF13546DDE_5 0.10
PF13384HTH_23 0.10
PF02796HTH_7 0.10
PF04828GFA 0.10
PF08352oligo_HPY 0.10
PF13683rve_3 0.10
PF07311Dodecin 0.10
PF064393keto-disac_hyd 0.10
PF02515CoA_transf_3 0.10
PF104171-cysPrx_C 0.10
PF14234DUF4336 0.10
PF07287AtuA 0.10
PF00440TetR_N 0.10
PF03167UDG 0.10
PF00255GSHPx 0.10
PF16363GDP_Man_Dehyd 0.10
PF13333rve_2 0.10
PF12686DUF3800 0.10
PF07758DUF1614 0.10
PF12728HTH_17 0.10
PF00872Transposase_mut 0.10
PF03992ABM 0.10
PF00355Rieske 0.10
PF09361Phasin_2 0.10
PF00528BPD_transp_1 0.10
PF11003DUF2842 0.10
PF05930Phage_AlpA 0.10
PF13304AAA_21 0.10
PF08447PAS_3 0.10
PF00326Peptidase_S9 0.10
PF12833HTH_18 0.10
PF10028DUF2270 0.10
PF05532CsbD 0.10
PF00034Cytochrom_C 0.10
PF14367DUF4411 0.10
PF01575MaoC_dehydratas 0.10
PF09084NMT1 0.10
PF08818DUF1801 0.10
PF07715Plug 0.10
PF03237Terminase_6N 0.10
PF00266Aminotran_5 0.10
PF05175MTS 0.10
PF07528DZF 0.10
PF02798GST_N 0.10
PF00664ABC_membrane 0.10
PF02656DUF202 0.10
PF13560HTH_31 0.10
PF13751DDE_Tnp_1_6 0.10
PF02146SIR2 0.10
PF13538UvrD_C_2 0.10
PF13365Trypsin_2 0.10
PF07394DUF1501 0.10
PF13817DDE_Tnp_IS66_C 0.10
PF07885Ion_trans_2 0.10

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 1045 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 6.41
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.96
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.86
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.86
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.67
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.38
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.38
COG0649NADH:ubiquinone oxidoreductase 49 kD subunit (chain D)Energy production and conversion [C] 0.29
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.29
COG3261Ni,Fe-hydrogenase III large subunitEnergy production and conversion [C] 0.29
COG3547TransposaseMobilome: prophages, transposons [X] 0.29
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.29
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.29
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.19
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.19
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 0.19
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.19
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 0.19
COG1582Swarming motility protein SwrDCell motility [N] 0.19
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 0.19
COG3158K+ uptake protein KupInorganic ion transport and metabolism [P] 0.19
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.19
COG0073tRNA-binding EMAP/Myf domainTranslation, ribosomal structure and biogenesis [J] 0.10
COG0386Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxidesDefense mechanisms [V] 0.10
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.10
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.10
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.10
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.10
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.10
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.10
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 0.10
COG1276Putative copper export proteinInorganic ion transport and metabolism [P] 0.10
COG1289Uncharacterized membrane protein YccCFunction unknown [S] 0.10
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.10
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.10
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.10
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.10
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.10
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.10
COG2149Uncharacterized membrane protein YidH, DUF202 familyFunction unknown [S] 0.10
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.10
COG2517Predicted RNA-binding protein, contains C-terminal EMAP domainGeneral function prediction only [R] 0.10
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.10
COG3311DNA-binding transcriptional regulator AlpATranscription [K] 0.10
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.10
COG3342Uncharacterized conserved protein, Ntn-hydrolase superfamilyGeneral function prediction only [R] 0.10
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 0.10
COG3436TransposaseMobilome: prophages, transposons [X] 0.10
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.10
COG3672Predicted transglutaminase-like proteinPosttranslational modification, protein turnover, chaperones [O] 0.10
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.10
COG4089Uncharacterized membrane proteinFunction unknown [S] 0.10
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.10
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.10
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.10
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.10


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.59 %
UnclassifiedrootN/A6.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309004|prs_FHA1B5K04ZB9O5All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
2170459002|FZY7DQ102H3LSUAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
2170459003|FZN2CUW02HSIPEAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
2170459016|G1P06HT02JEN0NAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium626Open in IMG/M
2228664022|INPgaii200_c0851051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
2228664022|INPgaii200_c1198655Not Available733Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0534116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium766Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100489202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1053375All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10001806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5576Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10025156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1622Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10050469All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1082Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10054668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71031Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10115581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10118267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria647Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10165436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. ARS1019528Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1102632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10031885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1233Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10053083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium902Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10064640All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10105732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium592Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10107648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10137588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium508Open in IMG/M
3300000891|JGI10214J12806_11872912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300000955|JGI1027J12803_100607969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1201Open in IMG/M
3300000955|JGI1027J12803_101170070All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300000955|JGI1027J12803_101999856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300000955|JGI1027J12803_102233856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1018Open in IMG/M
3300000955|JGI1027J12803_103188534All Organisms → cellular organisms → Bacteria → Proteobacteria1484Open in IMG/M
3300000955|JGI1027J12803_107820889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium759Open in IMG/M
3300000955|JGI1027J12803_109665710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum655Open in IMG/M
3300000956|JGI10216J12902_100619295All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300000956|JGI10216J12902_103424845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense587Open in IMG/M
3300000956|JGI10216J12902_109334652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1557Open in IMG/M
3300000956|JGI10216J12902_114665133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium926Open in IMG/M
3300000956|JGI10216J12902_115982613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300000956|JGI10216J12902_116117782All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium2721Open in IMG/M
3300000956|JGI10216J12902_116611328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1215Open in IMG/M
3300000956|JGI10216J12902_121285651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium859Open in IMG/M
3300001431|F14TB_104234342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300001867|JGI12627J18819_10025840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2416Open in IMG/M
3300002911|JGI25390J43892_10162833All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300002917|JGI25616J43925_10195148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium785Open in IMG/M
3300004268|Ga0066398_10208975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300004463|Ga0063356_104423450All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300004633|Ga0066395_10179038All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300004633|Ga0066395_10221120All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1002Open in IMG/M
3300005171|Ga0066677_10670664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300005178|Ga0066688_10529075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium758Open in IMG/M
3300005330|Ga0070690_100166172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter winogradskyi1516Open in IMG/M
3300005332|Ga0066388_100492825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1862Open in IMG/M
3300005332|Ga0066388_100704380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium leguminosarum1616Open in IMG/M
3300005332|Ga0066388_101021349All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300005332|Ga0066388_101478297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1186Open in IMG/M
3300005332|Ga0066388_101683924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1121Open in IMG/M
3300005332|Ga0066388_102032399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1031Open in IMG/M
3300005332|Ga0066388_102283307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium978Open in IMG/M
3300005332|Ga0066388_102357571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium964Open in IMG/M
3300005332|Ga0066388_102383527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium959Open in IMG/M
3300005332|Ga0066388_103218051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium834Open in IMG/M
3300005332|Ga0066388_103969882All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005332|Ga0066388_104208845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi733Open in IMG/M
3300005332|Ga0066388_105262881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300005332|Ga0066388_105487817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300005332|Ga0066388_105911413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300005332|Ga0066388_105986952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300005332|Ga0066388_106101747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium608Open in IMG/M
3300005332|Ga0066388_107316561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300005332|Ga0066388_108318309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300005332|Ga0066388_108708144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300005332|Ga0066388_108758292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300005363|Ga0008090_10104928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium853Open in IMG/M
3300005363|Ga0008090_15559175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300005363|Ga0008090_15656243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium860Open in IMG/M
3300005406|Ga0070703_10166708All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300005434|Ga0070709_10659360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300005434|Ga0070709_11758598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300005439|Ga0070711_101268751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium639Open in IMG/M
3300005447|Ga0066689_10689981All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium639Open in IMG/M
3300005536|Ga0070697_100525052Not Available1037Open in IMG/M
3300005536|Ga0070697_100656708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp.924Open in IMG/M
3300005536|Ga0070697_100988009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300005540|Ga0066697_10240694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1073Open in IMG/M
3300005546|Ga0070696_101438352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300005546|Ga0070696_101829273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300005553|Ga0066695_10507676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300005553|Ga0066695_10603827All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium658Open in IMG/M
3300005553|Ga0066695_10640352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300005555|Ga0066692_10922062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300005556|Ga0066707_10284062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1083Open in IMG/M
3300005558|Ga0066698_10665471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium692Open in IMG/M
3300005562|Ga0058697_10131400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1074Open in IMG/M
3300005566|Ga0066693_10112280All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300005568|Ga0066703_10514967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium708Open in IMG/M
3300005574|Ga0066694_10156466All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300005713|Ga0066905_100057820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2418Open in IMG/M
3300005713|Ga0066905_100079725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT01692146Open in IMG/M
3300005713|Ga0066905_100111107All Organisms → cellular organisms → Bacteria → Proteobacteria1887Open in IMG/M
3300005713|Ga0066905_100114816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1864Open in IMG/M
3300005713|Ga0066905_100208982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1466Open in IMG/M
3300005713|Ga0066905_100526932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium987Open in IMG/M
3300005713|Ga0066905_100568524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales954Open in IMG/M
3300005713|Ga0066905_100577795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium948Open in IMG/M
3300005713|Ga0066905_100884837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium780Open in IMG/M
3300005713|Ga0066905_100941362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium758Open in IMG/M
3300005713|Ga0066905_101039139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium724Open in IMG/M
3300005713|Ga0066905_101101132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium705Open in IMG/M
3300005713|Ga0066905_101288734All Organisms → cellular organisms → Bacteria → Proteobacteria657Open in IMG/M
3300005713|Ga0066905_101427377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300005713|Ga0066905_101485378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria616Open in IMG/M
3300005713|Ga0066905_101745239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300005713|Ga0066905_101959888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300005713|Ga0066905_102047075All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Thermogemmata → Thermogemmata fonticola532Open in IMG/M
3300005713|Ga0066905_102092028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300005764|Ga0066903_100145159All Organisms → cellular organisms → Bacteria3389Open in IMG/M
3300005764|Ga0066903_100301657All Organisms → cellular organisms → Bacteria → Proteobacteria2535Open in IMG/M
3300005764|Ga0066903_100343741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2405Open in IMG/M
3300005764|Ga0066903_100540041All Organisms → cellular organisms → Bacteria1994Open in IMG/M
3300005764|Ga0066903_100620515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1880Open in IMG/M
3300005764|Ga0066903_100666094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1824Open in IMG/M
3300005764|Ga0066903_100733261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis1750Open in IMG/M
3300005764|Ga0066903_100874771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1621Open in IMG/M
3300005764|Ga0066903_101040701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1502Open in IMG/M
3300005764|Ga0066903_101060457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1489Open in IMG/M
3300005764|Ga0066903_101061822All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300005764|Ga0066903_101229630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → unclassified Xanthobacteraceae → Xanthobacteraceae bacterium1393Open in IMG/M
3300005764|Ga0066903_101286159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1365Open in IMG/M
3300005764|Ga0066903_101436440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1298Open in IMG/M
3300005764|Ga0066903_101572492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1245Open in IMG/M
3300005764|Ga0066903_101643691Not Available1220Open in IMG/M
3300005764|Ga0066903_101712768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1197Open in IMG/M
3300005764|Ga0066903_101749774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1185Open in IMG/M
3300005764|Ga0066903_101892544All Organisms → cellular organisms → Bacteria → Proteobacteria1142Open in IMG/M
3300005764|Ga0066903_101910746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1137Open in IMG/M
3300005764|Ga0066903_101914383All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1136Open in IMG/M
3300005764|Ga0066903_101928291Not Available1132Open in IMG/M
3300005764|Ga0066903_101961062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1123Open in IMG/M
3300005764|Ga0066903_101961650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1123Open in IMG/M
3300005764|Ga0066903_101964998All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300005764|Ga0066903_102112348All Organisms → cellular organisms → Bacteria → Proteobacteria1084Open in IMG/M
3300005764|Ga0066903_102136591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1078Open in IMG/M
3300005764|Ga0066903_102137349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1078Open in IMG/M
3300005764|Ga0066903_102322129Not Available1036Open in IMG/M
3300005764|Ga0066903_102462334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1007Open in IMG/M
3300005764|Ga0066903_102545313All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium991Open in IMG/M
3300005764|Ga0066903_102631689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium975Open in IMG/M
3300005764|Ga0066903_102816326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium943Open in IMG/M
3300005764|Ga0066903_103054064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria906Open in IMG/M
3300005764|Ga0066903_103060574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium905Open in IMG/M
3300005764|Ga0066903_103095247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium900Open in IMG/M
3300005764|Ga0066903_103122900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium896Open in IMG/M
3300005764|Ga0066903_103187465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium887Open in IMG/M
3300005764|Ga0066903_103474048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium849Open in IMG/M
3300005764|Ga0066903_103817592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium809Open in IMG/M
3300005764|Ga0066903_103857112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium805Open in IMG/M
3300005764|Ga0066903_103938492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium797Open in IMG/M
3300005764|Ga0066903_104244802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium766Open in IMG/M
3300005764|Ga0066903_104300154Not Available761Open in IMG/M
3300005764|Ga0066903_104444720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300005764|Ga0066903_104841516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae715Open in IMG/M
3300005764|Ga0066903_104946917All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300005764|Ga0066903_105345464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium678Open in IMG/M
3300005764|Ga0066903_105596419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium661Open in IMG/M
3300005764|Ga0066903_106088434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium631Open in IMG/M
3300005764|Ga0066903_106122979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300005764|Ga0066903_106321947All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300005764|Ga0066903_106322228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300005764|Ga0066903_106338894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium617Open in IMG/M
3300005764|Ga0066903_106397875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300005764|Ga0066903_106471347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium611Open in IMG/M
3300005764|Ga0066903_106494494Not Available609Open in IMG/M
3300005764|Ga0066903_106511761Not Available608Open in IMG/M
3300005764|Ga0066903_107008601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300005764|Ga0066903_107298704All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300005764|Ga0066903_107393629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300005764|Ga0066903_107700385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300005764|Ga0066903_107771232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300005764|Ga0066903_107998133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300005764|Ga0066903_108208037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300005764|Ga0066903_108339033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300005764|Ga0066903_108802334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300005764|Ga0066903_109149166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300005937|Ga0081455_10002248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales22987Open in IMG/M
3300005937|Ga0081455_10169285Not Available1666Open in IMG/M
3300005981|Ga0081538_10106191Not Available1395Open in IMG/M
3300006028|Ga0070717_10036115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4005Open in IMG/M
3300006028|Ga0070717_10042121All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3724Open in IMG/M
3300006028|Ga0070717_10093550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2541Open in IMG/M
3300006028|Ga0070717_10209914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1708Open in IMG/M
3300006028|Ga0070717_10434043Not Available1182Open in IMG/M
3300006028|Ga0070717_10507078Not Available1091Open in IMG/M
3300006028|Ga0070717_10800148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium waimense858Open in IMG/M
3300006028|Ga0070717_12113822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300006031|Ga0066651_10403934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium728Open in IMG/M
3300006038|Ga0075365_10341218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1056Open in IMG/M
3300006046|Ga0066652_100162684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1884Open in IMG/M
3300006046|Ga0066652_100314827All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300006050|Ga0075028_100709515All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium606Open in IMG/M
3300006058|Ga0075432_10369978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300006163|Ga0070715_10137021All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300006163|Ga0070715_10378811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium780Open in IMG/M
3300006163|Ga0070715_10818723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300006163|Ga0070715_10869333All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas vasicola553Open in IMG/M
3300006172|Ga0075018_10333184All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium757Open in IMG/M
3300006172|Ga0075018_10717771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300006173|Ga0070716_100437206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria950Open in IMG/M
3300006175|Ga0070712_100040696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3187Open in IMG/M
3300006175|Ga0070712_100151281Not Available1782Open in IMG/M
3300006175|Ga0070712_100235284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1457Open in IMG/M
3300006578|Ga0074059_12101035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1029Open in IMG/M
3300006755|Ga0079222_11773746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber596Open in IMG/M
3300006791|Ga0066653_10340742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300006797|Ga0066659_10045311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2743Open in IMG/M
3300006797|Ga0066659_10836792Not Available764Open in IMG/M
3300006797|Ga0066659_11418410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga antarctica580Open in IMG/M
3300006800|Ga0066660_10715679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium820Open in IMG/M
3300006844|Ga0075428_101067871Not Available853Open in IMG/M
3300006844|Ga0075428_101838548All Organisms → cellular organisms → Bacteria → Proteobacteria630Open in IMG/M
3300006844|Ga0075428_101902754All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium618Open in IMG/M
3300006844|Ga0075428_101934246Not Available612Open in IMG/M
3300006845|Ga0075421_100687498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1191Open in IMG/M
3300006845|Ga0075421_101353714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium786Open in IMG/M
3300006845|Ga0075421_101979314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium621Open in IMG/M
3300006845|Ga0075421_102563803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300006847|Ga0075431_100207932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2000Open in IMG/M
3300006853|Ga0075420_101936008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300006854|Ga0075425_100059039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4300Open in IMG/M
3300006854|Ga0075425_101155417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae881Open in IMG/M
3300006854|Ga0075425_101392002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium794Open in IMG/M
3300006854|Ga0075425_101877588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300006854|Ga0075425_102546883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300006903|Ga0075426_10155985All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1648Open in IMG/M
3300006953|Ga0074063_10051043All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300006953|Ga0074063_13248394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1154Open in IMG/M
3300006953|Ga0074063_14116264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1535Open in IMG/M
3300009012|Ga0066710_102050618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium844Open in IMG/M
3300009012|Ga0066710_102562373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300009038|Ga0099829_10767255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria801Open in IMG/M
3300009088|Ga0099830_10865867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300009088|Ga0099830_11777667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300009100|Ga0075418_11548533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium720Open in IMG/M
3300009100|Ga0075418_11674442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300009100|Ga0075418_12027365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300009147|Ga0114129_10293954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2167Open in IMG/M
3300009147|Ga0114129_10324022All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → Janthinobacterium lividum2048Open in IMG/M
3300009147|Ga0114129_11020814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1040Open in IMG/M
3300009147|Ga0114129_11486158All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium833Open in IMG/M
3300009147|Ga0114129_11703726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium769Open in IMG/M
3300009147|Ga0114129_12664526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300009147|Ga0114129_12788892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria581Open in IMG/M
3300009162|Ga0075423_10279050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1751Open in IMG/M
3300009162|Ga0075423_11146982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium828Open in IMG/M
3300009162|Ga0075423_11196048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300009553|Ga0105249_11657561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium712Open in IMG/M
3300009792|Ga0126374_10187649All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1295Open in IMG/M
3300009792|Ga0126374_10191597Not Available1284Open in IMG/M
3300009792|Ga0126374_10191955All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300009792|Ga0126374_10355766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1006Open in IMG/M
3300009792|Ga0126374_10394625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria965Open in IMG/M
3300009792|Ga0126374_10490287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium883Open in IMG/M
3300009792|Ga0126374_10654706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium783Open in IMG/M
3300009792|Ga0126374_10804536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium718Open in IMG/M
3300009792|Ga0126374_11623560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300009792|Ga0126374_11645953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300009792|Ga0126374_11788849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300009792|Ga0126374_11858828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300010043|Ga0126380_10033311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2626Open in IMG/M
3300010043|Ga0126380_10102026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1724Open in IMG/M
3300010043|Ga0126380_10240606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1245Open in IMG/M
3300010043|Ga0126380_11622122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium578Open in IMG/M
3300010043|Ga0126380_12268755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300010046|Ga0126384_10039847All Organisms → cellular organisms → Bacteria3176Open in IMG/M
3300010046|Ga0126384_10058316All Organisms → cellular organisms → Bacteria → Proteobacteria2693Open in IMG/M
3300010046|Ga0126384_10164428All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300010046|Ga0126384_10449896All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300010046|Ga0126384_10586929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium973Open in IMG/M
3300010046|Ga0126384_10613877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium954Open in IMG/M
3300010046|Ga0126384_10800757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BRP22843Open in IMG/M
3300010046|Ga0126384_10814362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium837Open in IMG/M
3300010046|Ga0126384_11437017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300010046|Ga0126384_11486069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium634Open in IMG/M
3300010046|Ga0126384_11523816All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter627Open in IMG/M
3300010046|Ga0126384_11702955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300010046|Ga0126384_12145334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300010046|Ga0126384_12319874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300010046|Ga0126384_12403870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300010047|Ga0126382_10048324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2474Open in IMG/M
3300010047|Ga0126382_10099160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. MC11877Open in IMG/M
3300010047|Ga0126382_10111606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1792Open in IMG/M
3300010047|Ga0126382_10144062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1621Open in IMG/M
3300010047|Ga0126382_10729715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium835Open in IMG/M
3300010047|Ga0126382_10975089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300010047|Ga0126382_11120483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria699Open in IMG/M
3300010047|Ga0126382_11757629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium581Open in IMG/M
3300010047|Ga0126382_11809799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300010048|Ga0126373_10487715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium neotropicale1273Open in IMG/M
3300010048|Ga0126373_10521565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1233Open in IMG/M
3300010048|Ga0126373_10833790All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium985Open in IMG/M
3300010048|Ga0126373_11014094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria895Open in IMG/M
3300010048|Ga0126373_11171532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium835Open in IMG/M
3300010048|Ga0126373_11230563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium815Open in IMG/M
3300010048|Ga0126373_11687614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium698Open in IMG/M
3300010048|Ga0126373_12382549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300010048|Ga0126373_12521367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300010159|Ga0099796_10246838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300010304|Ga0134088_10584329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300010320|Ga0134109_10495894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300010329|Ga0134111_10125574All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1001Open in IMG/M
3300010329|Ga0134111_10522722All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300010358|Ga0126370_10064985All Organisms → cellular organisms → Bacteria2386Open in IMG/M
3300010358|Ga0126370_10147815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1708Open in IMG/M
3300010358|Ga0126370_10334992All Organisms → cellular organisms → Bacteria → Proteobacteria1216Open in IMG/M
3300010358|Ga0126370_10512119All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300010358|Ga0126370_10553913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium983Open in IMG/M
3300010358|Ga0126370_10843206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium822Open in IMG/M
3300010358|Ga0126370_11656862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300010358|Ga0126370_11828768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300010358|Ga0126370_11867633Not Available583Open in IMG/M
3300010358|Ga0126370_12323559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300010359|Ga0126376_10183578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1715Open in IMG/M
3300010359|Ga0126376_10253635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1498Open in IMG/M
3300010359|Ga0126376_10348333Not Available1312Open in IMG/M
3300010359|Ga0126376_10567144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1066Open in IMG/M
3300010359|Ga0126376_11085393Not Available807Open in IMG/M
3300010359|Ga0126376_12454987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium569Open in IMG/M
3300010359|Ga0126376_13114651All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300010359|Ga0126376_13266655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300010360|Ga0126372_10445582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1198Open in IMG/M
3300010360|Ga0126372_10783601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium942Open in IMG/M
3300010360|Ga0126372_10799671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium934Open in IMG/M
3300010360|Ga0126372_10889559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium892Open in IMG/M
3300010360|Ga0126372_11201950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium782Open in IMG/M
3300010360|Ga0126372_11338721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300010360|Ga0126372_11387637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300010360|Ga0126372_11870713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium645Open in IMG/M
3300010360|Ga0126372_12026968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium622Open in IMG/M
3300010360|Ga0126372_12455291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300010360|Ga0126372_12744440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300010360|Ga0126372_13008913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300010360|Ga0126372_13287108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300010361|Ga0126378_10882734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1001Open in IMG/M
3300010361|Ga0126378_11410209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium789Open in IMG/M
3300010361|Ga0126378_11504299Not Available763Open in IMG/M
3300010361|Ga0126378_11556228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium750Open in IMG/M
3300010361|Ga0126378_12279696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300010361|Ga0126378_12383569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300010361|Ga0126378_12420028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium600Open in IMG/M
3300010361|Ga0126378_12517105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium588Open in IMG/M
3300010361|Ga0126378_12621186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0182576Open in IMG/M
3300010361|Ga0126378_13020411All Organisms → cellular organisms → Bacteria → Proteobacteria536Open in IMG/M
3300010361|Ga0126378_13281673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300010362|Ga0126377_10170489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2062Open in IMG/M
3300010362|Ga0126377_10300361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1583Open in IMG/M
3300010362|Ga0126377_10305972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1569Open in IMG/M
3300010362|Ga0126377_11682603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium709Open in IMG/M
3300010362|Ga0126377_12938316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300010362|Ga0126377_13218971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300010366|Ga0126379_10604680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1182Open in IMG/M
3300010366|Ga0126379_10729317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1086Open in IMG/M
3300010366|Ga0126379_10778922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1055Open in IMG/M
3300010366|Ga0126379_10944039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium966Open in IMG/M
3300010366|Ga0126379_11056413All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium918Open in IMG/M
3300010366|Ga0126379_11485668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria783Open in IMG/M
3300010366|Ga0126379_11510814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium777Open in IMG/M
3300010366|Ga0126379_11560396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium766Open in IMG/M
3300010366|Ga0126379_11986850Not Available684Open in IMG/M
3300010366|Ga0126379_13397877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium533Open in IMG/M
3300010366|Ga0126379_13672112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium514Open in IMG/M
3300010376|Ga0126381_100463384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1780Open in IMG/M
3300010376|Ga0126381_101019173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1195Open in IMG/M
3300010376|Ga0126381_101278183Not Available1060Open in IMG/M
3300010376|Ga0126381_102010029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium833Open in IMG/M
3300010376|Ga0126381_103066614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300010376|Ga0126381_103090963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium660Open in IMG/M
3300010376|Ga0126381_103727444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium596Open in IMG/M
3300010376|Ga0126381_103791495All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300010376|Ga0126381_103989627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300010376|Ga0126381_104100790All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300010376|Ga0126381_104812882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300010376|Ga0126381_104985033Not Available509Open in IMG/M
3300010398|Ga0126383_10075789All Organisms → cellular organisms → Bacteria2915Open in IMG/M
3300010398|Ga0126383_10146083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2198Open in IMG/M
3300010398|Ga0126383_10290604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1627Open in IMG/M
3300010398|Ga0126383_10394004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1419Open in IMG/M
3300010398|Ga0126383_10496624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1278Open in IMG/M
3300010398|Ga0126383_10702883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1089Open in IMG/M
3300010398|Ga0126383_10753176Not Available1055Open in IMG/M
3300010398|Ga0126383_11036015All Organisms → cellular organisms → Bacteria → Proteobacteria909Open in IMG/M
3300010398|Ga0126383_11166332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium septicum860Open in IMG/M
3300010398|Ga0126383_11272392All Organisms → cellular organisms → Bacteria → Proteobacteria826Open in IMG/M
3300010398|Ga0126383_11280561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium823Open in IMG/M
3300010398|Ga0126383_11581822All Organisms → cellular organisms → Bacteria → Proteobacteria745Open in IMG/M
3300010398|Ga0126383_11617097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria737Open in IMG/M
3300010398|Ga0126383_11631316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium734Open in IMG/M
3300010398|Ga0126383_11671152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300010398|Ga0126383_11855110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium691Open in IMG/M
3300010398|Ga0126383_11919889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium680Open in IMG/M
3300010398|Ga0126383_12153994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales644Open in IMG/M
3300010398|Ga0126383_12474687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300010398|Ga0126383_12825275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300010398|Ga0126383_12838201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium566Open in IMG/M
3300010398|Ga0126383_13515930Not Available512Open in IMG/M
3300010863|Ga0124850_1048380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1336Open in IMG/M
3300010863|Ga0124850_1102515Not Available794Open in IMG/M
3300010868|Ga0124844_1248989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300011269|Ga0137392_10248457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1464Open in IMG/M
3300011271|Ga0137393_10134122All Organisms → cellular organisms → Bacteria2053Open in IMG/M
3300012199|Ga0137383_10249247All Organisms → cellular organisms → Bacteria → Proteobacteria1301Open in IMG/M
3300012199|Ga0137383_10300854All Organisms → cellular organisms → Bacteria → Proteobacteria1175Open in IMG/M
3300012199|Ga0137383_10790520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium693Open in IMG/M
3300012199|Ga0137383_11112437Not Available571Open in IMG/M
3300012199|Ga0137383_11135518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300012200|Ga0137382_10151431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1572Open in IMG/M
3300012200|Ga0137382_10632478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria765Open in IMG/M
3300012201|Ga0137365_10113602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2036Open in IMG/M
3300012201|Ga0137365_11138797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria560Open in IMG/M
3300012202|Ga0137363_10640609All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300012202|Ga0137363_10984324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium716Open in IMG/M
3300012202|Ga0137363_11156687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium658Open in IMG/M
3300012204|Ga0137374_10710027Not Available754Open in IMG/M
3300012205|Ga0137362_10458115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1104Open in IMG/M
3300012205|Ga0137362_10934594All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300012205|Ga0137362_11296840All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300012205|Ga0137362_11589282Not Available541Open in IMG/M
3300012206|Ga0137380_10152513All Organisms → cellular organisms → Bacteria2107Open in IMG/M
3300012206|Ga0137380_10229687All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1677Open in IMG/M
3300012208|Ga0137376_11249742All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300012209|Ga0137379_10443064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1208Open in IMG/M
3300012209|Ga0137379_11775825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300012210|Ga0137378_10946254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium775Open in IMG/M
3300012212|Ga0150985_100845021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300012212|Ga0150985_104364545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300012285|Ga0137370_10032049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2738Open in IMG/M
3300012285|Ga0137370_10547710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium711Open in IMG/M
3300012349|Ga0137387_10404248All Organisms → cellular organisms → Bacteria → Proteobacteria990Open in IMG/M
3300012350|Ga0137372_10253609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1383Open in IMG/M
3300012354|Ga0137366_10068911All Organisms → cellular organisms → Bacteria → Proteobacteria2696Open in IMG/M
3300012354|Ga0137366_10227905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1386Open in IMG/M
3300012354|Ga0137366_10647646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria755Open in IMG/M
3300012355|Ga0137369_10330871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1119Open in IMG/M
3300012355|Ga0137369_10765193Not Available661Open in IMG/M
3300012356|Ga0137371_10021534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4959Open in IMG/M
3300012356|Ga0137371_10498928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium939Open in IMG/M
3300012357|Ga0137384_10372268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1182Open in IMG/M
3300012357|Ga0137384_10386431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1157Open in IMG/M
3300012359|Ga0137385_10610604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium916Open in IMG/M
3300012360|Ga0137375_10341111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1335Open in IMG/M
3300012360|Ga0137375_11137130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300012361|Ga0137360_10217628All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1554Open in IMG/M
3300012361|Ga0137360_10627663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria921Open in IMG/M
3300012362|Ga0137361_10133607All Organisms → cellular organisms → Bacteria → Proteobacteria2200Open in IMG/M
3300012362|Ga0137361_10495569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → unclassified Tardiphaga → Tardiphaga sp. vice2781122Open in IMG/M
3300012362|Ga0137361_10527653Not Available1084Open in IMG/M
3300012362|Ga0137361_10767109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium879Open in IMG/M
3300012532|Ga0137373_10931899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium635Open in IMG/M
3300012917|Ga0137395_10476593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium898Open in IMG/M
3300012918|Ga0137396_10105407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2017Open in IMG/M
3300012923|Ga0137359_10592734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium973Open in IMG/M
3300012923|Ga0137359_10868884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria779Open in IMG/M
3300012930|Ga0137407_10906536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium834Open in IMG/M
3300012948|Ga0126375_10140875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1504Open in IMG/M
3300012948|Ga0126375_10411120All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300012948|Ga0126375_10795477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300012951|Ga0164300_10719810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium607Open in IMG/M
3300012951|Ga0164300_11000661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300012958|Ga0164299_10552590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria777Open in IMG/M
3300012960|Ga0164301_11079549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum637Open in IMG/M
3300012971|Ga0126369_10084130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2833Open in IMG/M
3300012971|Ga0126369_10158702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2136Open in IMG/M
3300012971|Ga0126369_10357824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1484Open in IMG/M
3300012971|Ga0126369_10929242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae956Open in IMG/M
3300012971|Ga0126369_11048813All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300012971|Ga0126369_11541387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium754Open in IMG/M
3300012971|Ga0126369_11592858All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300012971|Ga0126369_11923683All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300012971|Ga0126369_13616745All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300012971|Ga0126369_13669697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300012977|Ga0134087_10382168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300012984|Ga0164309_10807939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium756Open in IMG/M
3300012985|Ga0164308_11262998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300012987|Ga0164307_10760452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium766Open in IMG/M
3300012989|Ga0164305_10973051All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria719Open in IMG/M
3300012989|Ga0164305_12163998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300013102|Ga0157371_10714682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7751Open in IMG/M
3300013297|Ga0157378_12333675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300013308|Ga0157375_12780239All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium585Open in IMG/M
3300014487|Ga0182000_10213265All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300014745|Ga0157377_11286974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium571Open in IMG/M
3300015371|Ga0132258_11219075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1902Open in IMG/M
3300015371|Ga0132258_13402342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1092Open in IMG/M
3300015374|Ga0132255_105360524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300016270|Ga0182036_10247681All Organisms → cellular organisms → Bacteria1332Open in IMG/M
3300016270|Ga0182036_10435112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1028Open in IMG/M
3300016270|Ga0182036_10536014All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300016270|Ga0182036_10598892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium883Open in IMG/M
3300016270|Ga0182036_11472922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium mercantei571Open in IMG/M
3300016270|Ga0182036_11513364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300016270|Ga0182036_11816935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300016294|Ga0182041_10113794All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300016294|Ga0182041_11078392All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300016294|Ga0182041_11556018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300016294|Ga0182041_12043302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium534Open in IMG/M
3300016319|Ga0182033_10070203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2464Open in IMG/M
3300016319|Ga0182033_10374056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1198Open in IMG/M
3300016319|Ga0182033_10808648All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium826Open in IMG/M
3300016341|Ga0182035_10073855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2410Open in IMG/M
3300016341|Ga0182035_10321432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1276Open in IMG/M
3300016341|Ga0182035_10851299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium802Open in IMG/M
3300016341|Ga0182035_11178283All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300016357|Ga0182032_10125647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1858Open in IMG/M
3300016357|Ga0182032_10250309All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300016357|Ga0182032_11190839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300016357|Ga0182032_11645486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium559Open in IMG/M
3300016357|Ga0182032_11754500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300016371|Ga0182034_10191711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1573Open in IMG/M
3300016371|Ga0182034_10339359All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1217Open in IMG/M
3300016371|Ga0182034_10840943All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300016371|Ga0182034_11702919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium555Open in IMG/M
3300016371|Ga0182034_11705319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300016387|Ga0182040_10238529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1360Open in IMG/M
3300016387|Ga0182040_10256085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1317Open in IMG/M
3300016387|Ga0182040_10643660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium862Open in IMG/M
3300016387|Ga0182040_11016340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium692Open in IMG/M
3300016387|Ga0182040_11177851All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300016387|Ga0182040_11248244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium626Open in IMG/M
3300016404|Ga0182037_10132651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WSM25981851Open in IMG/M
3300016404|Ga0182037_10766555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium830Open in IMG/M
3300016404|Ga0182037_10796406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria814Open in IMG/M
3300016404|Ga0182037_11059424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium708Open in IMG/M
3300016404|Ga0182037_11206454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria665Open in IMG/M
3300016404|Ga0182037_11288686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300016422|Ga0182039_10243100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1462Open in IMG/M
3300016422|Ga0182039_10537299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1014Open in IMG/M
3300016422|Ga0182039_10641566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium932Open in IMG/M
3300016422|Ga0182039_11924206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300016445|Ga0182038_10099774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2106Open in IMG/M
3300016445|Ga0182038_11121519All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300018066|Ga0184617_1161357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium australiense661Open in IMG/M
3300018067|Ga0184611_1285447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300018073|Ga0184624_10285065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium741Open in IMG/M
3300018431|Ga0066655_10026378All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2779Open in IMG/M
3300018433|Ga0066667_10268122All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300018433|Ga0066667_11608044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium579Open in IMG/M
3300018433|Ga0066667_11734743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300018469|Ga0190270_12039247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300018482|Ga0066669_10109510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1940Open in IMG/M
3300020579|Ga0210407_10164290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1715Open in IMG/M
3300020580|Ga0210403_10038483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3823Open in IMG/M
3300020580|Ga0210403_10969443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium667Open in IMG/M
3300020580|Ga0210403_11307958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300020580|Ga0210403_11512763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300021088|Ga0210404_10419693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria750Open in IMG/M
3300021088|Ga0210404_10560626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium648Open in IMG/M
3300021168|Ga0210406_10166983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831841Open in IMG/M
3300021168|Ga0210406_10301125All Organisms → cellular organisms → Bacteria → Proteobacteria1304Open in IMG/M
3300021168|Ga0210406_11342029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300021178|Ga0210408_10312852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1252Open in IMG/M
3300021432|Ga0210384_10757908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium867Open in IMG/M
3300021432|Ga0210384_10776413Not Available855Open in IMG/M
3300021475|Ga0210392_11271154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300021475|Ga0210392_11432756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria516Open in IMG/M
3300021478|Ga0210402_10849317All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae839Open in IMG/M
3300021478|Ga0210402_10954512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium784Open in IMG/M
3300021478|Ga0210402_11110750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium RH AL1718Open in IMG/M
3300021559|Ga0210409_11329310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium595Open in IMG/M
3300021560|Ga0126371_10239950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1923Open in IMG/M
3300021560|Ga0126371_10331329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1654Open in IMG/M
3300021560|Ga0126371_10598652All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1251Open in IMG/M
3300021560|Ga0126371_10926731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1014Open in IMG/M
3300021560|Ga0126371_10996092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium980Open in IMG/M
3300021560|Ga0126371_11467031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300021560|Ga0126371_11574758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium784Open in IMG/M
3300021560|Ga0126371_11858479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium722Open in IMG/M
3300021560|Ga0126371_13634992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300021560|Ga0126371_13721355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300021968|Ga0193698_1053761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300022533|Ga0242662_10267609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300025898|Ga0207692_10053832All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300025898|Ga0207692_10554267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium735Open in IMG/M
3300025905|Ga0207685_10113630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1178Open in IMG/M
3300025910|Ga0207684_10004467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria13165Open in IMG/M
3300025910|Ga0207684_10105518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2410Open in IMG/M
3300025910|Ga0207684_10927032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium731Open in IMG/M
3300025910|Ga0207684_11213427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber624Open in IMG/M
3300025915|Ga0207693_10018915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium5483Open in IMG/M
3300025915|Ga0207693_10404371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1067Open in IMG/M
3300025915|Ga0207693_10695656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria788Open in IMG/M
3300025916|Ga0207663_10547408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium904Open in IMG/M
3300025916|Ga0207663_11108826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300025922|Ga0207646_10101597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2578Open in IMG/M
3300025922|Ga0207646_10960681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium756Open in IMG/M
3300025928|Ga0207700_10763062All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300025938|Ga0207704_11517210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300026285|Ga0209438_1188005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria547Open in IMG/M
3300026304|Ga0209240_1051386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1553Open in IMG/M
3300026305|Ga0209688_1063152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300026317|Ga0209154_1212442All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300026319|Ga0209647_1004395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales10621Open in IMG/M
3300026319|Ga0209647_1025203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3590Open in IMG/M
3300026330|Ga0209473_1163427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens889Open in IMG/M
3300026490|Ga0257153_1090521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300026498|Ga0257156_1029069All Organisms → cellular organisms → Bacteria1116Open in IMG/M
3300026538|Ga0209056_10144679All Organisms → cellular organisms → Bacteria → Proteobacteria1834Open in IMG/M
3300026538|Ga0209056_10476391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium674Open in IMG/M
3300026547|Ga0209156_10322309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium689Open in IMG/M
3300026551|Ga0209648_10343755All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1032Open in IMG/M
3300026552|Ga0209577_10167103All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300026552|Ga0209577_10553529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium730Open in IMG/M
3300027071|Ga0209214_1031332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium702Open in IMG/M
3300027502|Ga0209622_1049479Not Available762Open in IMG/M
3300027502|Ga0209622_1090419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300027527|Ga0209684_1055130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300027548|Ga0209523_1094715All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300027846|Ga0209180_10525907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium660Open in IMG/M
3300027874|Ga0209465_10030382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2542Open in IMG/M
3300027909|Ga0209382_12298775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium507Open in IMG/M
3300028047|Ga0209526_10018384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4860Open in IMG/M
3300028047|Ga0209526_10033013All Organisms → cellular organisms → Bacteria3641Open in IMG/M
3300028047|Ga0209526_10299258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1089Open in IMG/M
3300028047|Ga0209526_10816736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300028708|Ga0307295_10105185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium763Open in IMG/M
3300028713|Ga0307303_10080001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria728Open in IMG/M
3300028714|Ga0307309_10035737All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300028719|Ga0307301_10013928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2296Open in IMG/M
3300028720|Ga0307317_10097014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium975Open in IMG/M
3300028754|Ga0307297_10194744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium707Open in IMG/M
3300028768|Ga0307280_10167430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium765Open in IMG/M
3300028791|Ga0307290_10389755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300028807|Ga0307305_10410720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium611Open in IMG/M
3300028824|Ga0307310_10162311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1037Open in IMG/M
3300028878|Ga0307278_10035238All Organisms → cellular organisms → Bacteria → Proteobacteria2282Open in IMG/M
3300028878|Ga0307278_10325029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium679Open in IMG/M
3300028878|Ga0307278_10348140Not Available653Open in IMG/M
3300028878|Ga0307278_10485215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300028885|Ga0307304_10384620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300030905|Ga0308200_1159980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300030989|Ga0308196_1030681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium674Open in IMG/M
3300031231|Ga0170824_112248954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300031421|Ga0308194_10075797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium919Open in IMG/M
3300031543|Ga0318516_10009241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4700Open in IMG/M
3300031543|Ga0318516_10056926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2140Open in IMG/M
3300031543|Ga0318516_10103760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1608Open in IMG/M
3300031543|Ga0318516_10105461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1595Open in IMG/M
3300031543|Ga0318516_10110983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1556Open in IMG/M
3300031543|Ga0318516_10127772All Organisms → cellular organisms → Bacteria → Proteobacteria1452Open in IMG/M
3300031543|Ga0318516_10336019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium872Open in IMG/M
3300031543|Ga0318516_10358139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium842Open in IMG/M
3300031543|Ga0318516_10810712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300031544|Ga0318534_10073852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1932Open in IMG/M
3300031544|Ga0318534_10140887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1390Open in IMG/M
3300031544|Ga0318534_10320296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium893Open in IMG/M
3300031544|Ga0318534_10568190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium645Open in IMG/M
3300031544|Ga0318534_10884998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300031545|Ga0318541_10007897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4642Open in IMG/M
3300031545|Ga0318541_10022722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3021Open in IMG/M
3300031545|Ga0318541_10037787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2431Open in IMG/M
3300031545|Ga0318541_10049140All Organisms → cellular organisms → Bacteria2159Open in IMG/M
3300031545|Ga0318541_10076627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1763Open in IMG/M
3300031545|Ga0318541_10157973All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1246Open in IMG/M
3300031545|Ga0318541_10209581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1079Open in IMG/M
3300031545|Ga0318541_10278846All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300031545|Ga0318541_10305898All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium886Open in IMG/M
3300031545|Ga0318541_10560455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium639Open in IMG/M
3300031545|Ga0318541_10595890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300031545|Ga0318541_10645873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium591Open in IMG/M
3300031545|Ga0318541_10733418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium551Open in IMG/M
3300031545|Ga0318541_10746381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300031546|Ga0318538_10066292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1804Open in IMG/M
3300031546|Ga0318538_10215456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1027Open in IMG/M
3300031546|Ga0318538_10325884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria829Open in IMG/M
3300031546|Ga0318538_10429232All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium715Open in IMG/M
3300031546|Ga0318538_10597904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium598Open in IMG/M
3300031561|Ga0318528_10062554All Organisms → cellular organisms → Bacteria1903Open in IMG/M
3300031561|Ga0318528_10159812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae1202Open in IMG/M
3300031561|Ga0318528_10205865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1053Open in IMG/M
3300031561|Ga0318528_10209153All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300031561|Ga0318528_10230381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium993Open in IMG/M
3300031561|Ga0318528_10375384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium763Open in IMG/M
3300031561|Ga0318528_10433613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium706Open in IMG/M
3300031561|Ga0318528_10657527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BRP22561Open in IMG/M
3300031564|Ga0318573_10027494All Organisms → cellular organisms → Bacteria2630Open in IMG/M
3300031564|Ga0318573_10243890All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300031564|Ga0318573_10308877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium847Open in IMG/M
3300031564|Ga0318573_10555103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300031564|Ga0318573_10750241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300031572|Ga0318515_10071018All Organisms → cellular organisms → Bacteria → Proteobacteria1788Open in IMG/M
3300031572|Ga0318515_10122140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1377Open in IMG/M
3300031572|Ga0318515_10687806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300031573|Ga0310915_10019308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4121Open in IMG/M
3300031573|Ga0310915_10076172All Organisms → cellular organisms → Bacteria → Proteobacteria2221Open in IMG/M
3300031573|Ga0310915_10077466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2203Open in IMG/M
3300031573|Ga0310915_10409183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium963Open in IMG/M
3300031573|Ga0310915_10510887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium853Open in IMG/M
3300031573|Ga0310915_10734982All Organisms → cellular organisms → Bacteria → Proteobacteria696Open in IMG/M
3300031573|Ga0310915_10763401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300031573|Ga0310915_11197258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300031640|Ga0318555_10236358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium986Open in IMG/M
3300031640|Ga0318555_10523551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300031640|Ga0318555_10814836All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031668|Ga0318542_10272864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium863Open in IMG/M
3300031668|Ga0318542_10635170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium557Open in IMG/M
3300031679|Ga0318561_10052586All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2042Open in IMG/M
3300031679|Ga0318561_10210146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1056Open in IMG/M
3300031679|Ga0318561_10281249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. BRP22909Open in IMG/M
3300031679|Ga0318561_10659126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300031679|Ga0318561_10754927All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300031679|Ga0318561_10798590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300031679|Ga0318561_10838096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300031680|Ga0318574_10172380All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300031680|Ga0318574_10627677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300031681|Ga0318572_10024668All Organisms → cellular organisms → Bacteria3065Open in IMG/M
3300031681|Ga0318572_10055406All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2146Open in IMG/M
3300031681|Ga0318572_10173874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1251Open in IMG/M
3300031681|Ga0318572_10623440All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300031681|Ga0318572_10776497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300031682|Ga0318560_10034468All Organisms → cellular organisms → Bacteria2417Open in IMG/M
3300031682|Ga0318560_10049426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2067Open in IMG/M
3300031682|Ga0318560_10064560All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1834Open in IMG/M
3300031682|Ga0318560_10110917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1427Open in IMG/M
3300031682|Ga0318560_10585415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300031713|Ga0318496_10066180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1897Open in IMG/M
3300031713|Ga0318496_10274519All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium930Open in IMG/M
3300031713|Ga0318496_10544676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium641Open in IMG/M
3300031713|Ga0318496_10780758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300031719|Ga0306917_10066954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2476Open in IMG/M
3300031719|Ga0306917_10222520All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1437Open in IMG/M
3300031719|Ga0306917_10280057All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1284Open in IMG/M
3300031719|Ga0306917_11040590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300031719|Ga0306917_11145209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium605Open in IMG/M
3300031719|Ga0306917_11178194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium595Open in IMG/M
3300031719|Ga0306917_11413170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300031723|Ga0318493_10837855All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300031724|Ga0318500_10574209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300031724|Ga0318500_10691209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300031724|Ga0318500_10744349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria501Open in IMG/M
3300031740|Ga0307468_102561599All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300031744|Ga0306918_10164598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1648Open in IMG/M
3300031744|Ga0306918_10335126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1171Open in IMG/M
3300031744|Ga0306918_10401348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1068Open in IMG/M
3300031744|Ga0306918_10751511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium762Open in IMG/M
3300031744|Ga0306918_10825164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium723Open in IMG/M
3300031744|Ga0306918_11554834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300031747|Ga0318502_10364982Not Available856Open in IMG/M
3300031747|Ga0318502_10769796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300031748|Ga0318492_10407420All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300031751|Ga0318494_10537267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria682Open in IMG/M
3300031751|Ga0318494_10717164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium585Open in IMG/M
3300031763|Ga0318537_10064489All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300031763|Ga0318537_10120170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium976Open in IMG/M
3300031763|Ga0318537_10282476All Organisms → cellular organisms → Bacteria → Proteobacteria615Open in IMG/M
3300031764|Ga0318535_10073515All Organisms → cellular organisms → Bacteria1465Open in IMG/M
3300031764|Ga0318535_10119571All Organisms → cellular organisms → Bacteria → Proteobacteria1163Open in IMG/M
3300031764|Ga0318535_10246852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300031765|Ga0318554_10057778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2133Open in IMG/M
3300031765|Ga0318554_10068924All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1957Open in IMG/M
3300031765|Ga0318554_10474500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium709Open in IMG/M
3300031765|Ga0318554_10648987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M
3300031768|Ga0318509_10237356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1017Open in IMG/M
3300031768|Ga0318509_10352575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium823Open in IMG/M
3300031768|Ga0318509_10779159All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031768|Ga0318509_10829297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium511Open in IMG/M
3300031768|Ga0318509_10859010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300031769|Ga0318526_10233775Not Available752Open in IMG/M
3300031770|Ga0318521_10204381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1142Open in IMG/M
3300031770|Ga0318521_10349706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium876Open in IMG/M
3300031771|Ga0318546_10033803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3070Open in IMG/M
3300031771|Ga0318546_10167131All Organisms → cellular organisms → Bacteria → Proteobacteria1490Open in IMG/M
3300031771|Ga0318546_10204849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1348Open in IMG/M
3300031771|Ga0318546_10449517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium902Open in IMG/M
3300031771|Ga0318546_10755739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium684Open in IMG/M
3300031771|Ga0318546_10881460All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300031771|Ga0318546_11269099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300031777|Ga0318543_10259681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium775Open in IMG/M
3300031777|Ga0318543_10379978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium633Open in IMG/M
3300031778|Ga0318498_10102662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1297Open in IMG/M
3300031778|Ga0318498_10443709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300031778|Ga0318498_10459261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300031779|Ga0318566_10016689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3184Open in IMG/M
3300031779|Ga0318566_10513574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300031779|Ga0318566_10667198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300031780|Ga0318508_1238488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300031780|Ga0318508_1238783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300031781|Ga0318547_10225714All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1124Open in IMG/M
3300031781|Ga0318547_10864717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300031782|Ga0318552_10360280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium741Open in IMG/M
3300031782|Ga0318552_10743680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300031792|Ga0318529_10193543Not Available942Open in IMG/M
3300031792|Ga0318529_10301604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300031792|Ga0318529_10397797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium641Open in IMG/M
3300031793|Ga0318548_10058483Not Available1779Open in IMG/M
3300031793|Ga0318548_10085878Not Available1493Open in IMG/M
3300031793|Ga0318548_10450016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium630Open in IMG/M
3300031794|Ga0318503_10147962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens757Open in IMG/M
3300031794|Ga0318503_10274255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300031795|Ga0318557_10137009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1102Open in IMG/M
3300031795|Ga0318557_10515333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300031796|Ga0318576_10366762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium680Open in IMG/M
3300031796|Ga0318576_10465381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales597Open in IMG/M
3300031796|Ga0318576_10494058All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300031796|Ga0318576_10562680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300031797|Ga0318550_10284310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium802Open in IMG/M
3300031797|Ga0318550_10321036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium751Open in IMG/M
3300031797|Ga0318550_10499873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300031798|Ga0318523_10248917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium888Open in IMG/M
3300031798|Ga0318523_10429667All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300031798|Ga0318523_10586335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis549Open in IMG/M
3300031805|Ga0318497_10142924All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300031805|Ga0318497_10533966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium657Open in IMG/M
3300031805|Ga0318497_10787990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium533Open in IMG/M
3300031819|Ga0318568_10519523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium742Open in IMG/M
3300031819|Ga0318568_10621237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium673Open in IMG/M
3300031821|Ga0318567_10704563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium573Open in IMG/M
3300031821|Ga0318567_10714532All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300031821|Ga0318567_10887362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300031832|Ga0318499_10050838Not Available1550Open in IMG/M
3300031832|Ga0318499_10237354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium709Open in IMG/M
3300031832|Ga0318499_10415324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300031833|Ga0310917_10018943Not Available3926Open in IMG/M
3300031833|Ga0310917_10108762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1792Open in IMG/M
3300031833|Ga0310917_10163866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1473Open in IMG/M
3300031833|Ga0310917_10296684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1093Open in IMG/M
3300031833|Ga0310917_10394030Not Available941Open in IMG/M
3300031833|Ga0310917_10985337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300031835|Ga0318517_10110863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1209Open in IMG/M
3300031835|Ga0318517_10124991All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300031835|Ga0318517_10563347All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031845|Ga0318511_10119636Not Available1133Open in IMG/M
3300031846|Ga0318512_10048216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1893Open in IMG/M
3300031846|Ga0318512_10338228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium752Open in IMG/M
3300031846|Ga0318512_10502791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300031859|Ga0318527_10256412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium743Open in IMG/M
3300031879|Ga0306919_10005781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6599Open in IMG/M
3300031879|Ga0306919_10005966All Organisms → cellular organisms → Bacteria → Proteobacteria6526Open in IMG/M
3300031879|Ga0306919_10107352All Organisms → cellular organisms → Bacteria1975Open in IMG/M
3300031879|Ga0306919_10424496All Organisms → cellular organisms → Bacteria → Proteobacteria1021Open in IMG/M
3300031879|Ga0306919_10519167All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium918Open in IMG/M
3300031879|Ga0306919_10658021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium807Open in IMG/M
3300031879|Ga0306919_10667110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium801Open in IMG/M
3300031879|Ga0306919_11041131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300031879|Ga0306919_11140475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium593Open in IMG/M
3300031879|Ga0306919_11334415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300031879|Ga0306919_11351632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300031879|Ga0306919_11384801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium531Open in IMG/M
3300031879|Ga0306919_11396810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300031880|Ga0318544_10047785All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300031880|Ga0318544_10081489All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300031880|Ga0318544_10156043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium876Open in IMG/M
3300031880|Ga0318544_10402911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium532Open in IMG/M
3300031890|Ga0306925_10249327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1913Open in IMG/M
3300031890|Ga0306925_10273250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1820Open in IMG/M
3300031890|Ga0306925_10547541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1227Open in IMG/M
3300031890|Ga0306925_10767219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1004Open in IMG/M
3300031890|Ga0306925_11115007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium796Open in IMG/M
3300031890|Ga0306925_11204272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium759Open in IMG/M
3300031890|Ga0306925_11698419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300031890|Ga0306925_11741775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300031893|Ga0318536_10075346All Organisms → cellular organisms → Bacteria1665Open in IMG/M
3300031893|Ga0318536_10095326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1487Open in IMG/M
3300031893|Ga0318536_10128550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1282Open in IMG/M
3300031893|Ga0318536_10461101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300031893|Ga0318536_10555561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300031893|Ga0318536_10592886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300031894|Ga0318522_10171985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium818Open in IMG/M
3300031894|Ga0318522_10238388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium689Open in IMG/M
3300031896|Ga0318551_10400589All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria780Open in IMG/M
3300031897|Ga0318520_10123442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1477Open in IMG/M
3300031897|Ga0318520_10883178All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300031897|Ga0318520_11059159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300031910|Ga0306923_10124697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2926Open in IMG/M
3300031910|Ga0306923_10351010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1682Open in IMG/M
3300031910|Ga0306923_10612415All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300031910|Ga0306923_11036947All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium888Open in IMG/M
3300031910|Ga0306923_11192168All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300031910|Ga0306923_11427980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium727Open in IMG/M
3300031910|Ga0306923_11992333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium590Open in IMG/M
3300031910|Ga0306923_12075893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300031912|Ga0306921_10040092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5282Open in IMG/M
3300031912|Ga0306921_10060740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4313Open in IMG/M
3300031912|Ga0306921_10402074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1599Open in IMG/M
3300031912|Ga0306921_11153754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium865Open in IMG/M
3300031912|Ga0306921_11354791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria784Open in IMG/M
3300031912|Ga0306921_12075334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium603Open in IMG/M
3300031912|Ga0306921_12469737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter540Open in IMG/M
3300031941|Ga0310912_10018037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4615Open in IMG/M
3300031941|Ga0310912_10072025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2491Open in IMG/M
3300031941|Ga0310912_10173898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1636Open in IMG/M
3300031941|Ga0310912_10393107Not Available1079Open in IMG/M
3300031941|Ga0310912_10478993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium970Open in IMG/M
3300031941|Ga0310912_10690825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium791Open in IMG/M
3300031941|Ga0310912_10716270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium775Open in IMG/M
3300031941|Ga0310912_10728836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium768Open in IMG/M
3300031941|Ga0310912_10960856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300031942|Ga0310916_10039400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3542Open in IMG/M
3300031942|Ga0310916_10153892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1899Open in IMG/M
3300031942|Ga0310916_10295999All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1370Open in IMG/M
3300031942|Ga0310916_10983666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria704Open in IMG/M
3300031945|Ga0310913_11031050All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300031945|Ga0310913_11048703All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300031946|Ga0310910_10048179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2992Open in IMG/M
3300031946|Ga0310910_10250325All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300031946|Ga0310910_10649357All Organisms → cellular organisms → Bacteria → Proteobacteria836Open in IMG/M
3300031946|Ga0310910_10713473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria792Open in IMG/M
3300031946|Ga0310910_10858117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium713Open in IMG/M
3300031947|Ga0310909_10027942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4149Open in IMG/M
3300031947|Ga0310909_10127072All Organisms → cellular organisms → Bacteria2077Open in IMG/M
3300031947|Ga0310909_10770041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium796Open in IMG/M
3300031947|Ga0310909_10815251All Organisms → cellular organisms → Bacteria → Proteobacteria770Open in IMG/M
3300031947|Ga0310909_10901169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Limibaculum → Limibaculum sediminis726Open in IMG/M
3300031947|Ga0310909_11104598All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300031947|Ga0310909_11331978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300031947|Ga0310909_11571358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300031954|Ga0306926_10092111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3705Open in IMG/M
3300031954|Ga0306926_10142908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2961Open in IMG/M
3300031954|Ga0306926_11501869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium777Open in IMG/M
3300031954|Ga0306926_11556070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium760Open in IMG/M
3300031954|Ga0306926_11658660All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum731Open in IMG/M
3300031954|Ga0306926_11778186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium700Open in IMG/M
3300031954|Ga0306926_12057044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300031959|Ga0318530_10076621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1302Open in IMG/M
3300031959|Ga0318530_10121926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1047Open in IMG/M
3300031959|Ga0318530_10299052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium665Open in IMG/M
3300031981|Ga0318531_10152299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1036Open in IMG/M
3300031981|Ga0318531_10287607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium742Open in IMG/M
3300031981|Ga0318531_10319814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium701Open in IMG/M
3300031981|Ga0318531_10340054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium678Open in IMG/M
3300031981|Ga0318531_10500315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300032001|Ga0306922_10013788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ghvi7967Open in IMG/M
3300032001|Ga0306922_10094700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3151Open in IMG/M
3300032001|Ga0306922_12112559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7545Open in IMG/M
3300032001|Ga0306922_12306257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300032010|Ga0318569_10307908All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300032025|Ga0318507_10100579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1205Open in IMG/M
3300032025|Ga0318507_10100993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1203Open in IMG/M
3300032025|Ga0318507_10102023All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1197Open in IMG/M
3300032025|Ga0318507_10129661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium neotropicale1068Open in IMG/M
3300032025|Ga0318507_10130775All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300032025|Ga0318507_10302841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium695Open in IMG/M
3300032025|Ga0318507_10522996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300032035|Ga0310911_10185210All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT02831180Open in IMG/M
3300032035|Ga0310911_10478967Not Available721Open in IMG/M
3300032035|Ga0310911_10627656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium623Open in IMG/M
3300032035|Ga0310911_10802119All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300032035|Ga0310911_10863270All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300032041|Ga0318549_10002341All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5570Open in IMG/M
3300032041|Ga0318549_10302191All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300032042|Ga0318545_10372311All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300032043|Ga0318556_10647525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300032043|Ga0318556_10721570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium518Open in IMG/M
3300032044|Ga0318558_10022275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2581Open in IMG/M
3300032044|Ga0318558_10091204All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1416Open in IMG/M
3300032044|Ga0318558_10138028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1167Open in IMG/M
3300032044|Ga0318558_10692079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300032051|Ga0318532_10057210All Organisms → cellular organisms → Bacteria1344Open in IMG/M
3300032052|Ga0318506_10014028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2774Open in IMG/M
3300032052|Ga0318506_10139723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1056Open in IMG/M
3300032052|Ga0318506_10326655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium680Open in IMG/M
3300032052|Ga0318506_10437334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium580Open in IMG/M
3300032054|Ga0318570_10006849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3743Open in IMG/M
3300032054|Ga0318570_10018938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2580Open in IMG/M
3300032054|Ga0318570_10242367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium817Open in IMG/M
3300032054|Ga0318570_10291077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium742Open in IMG/M
3300032054|Ga0318570_10315842All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300032054|Ga0318570_10399401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium627Open in IMG/M
3300032054|Ga0318570_10402494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300032054|Ga0318570_10542763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300032055|Ga0318575_10104251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1378Open in IMG/M
3300032055|Ga0318575_10547958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300032059|Ga0318533_10272990All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1223Open in IMG/M
3300032059|Ga0318533_10346617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → unclassified Microvirga → Microvirga sp. HBU652071081Open in IMG/M
3300032059|Ga0318533_10450123Not Available942Open in IMG/M
3300032059|Ga0318533_10861933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium664Open in IMG/M
3300032059|Ga0318533_10953499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium629Open in IMG/M
3300032060|Ga0318505_10012897Not Available3075Open in IMG/M
3300032060|Ga0318505_10082402Not Available1434Open in IMG/M
3300032060|Ga0318505_10133398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1143Open in IMG/M
3300032063|Ga0318504_10097576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1312Open in IMG/M
3300032064|Ga0318510_10035423All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1697Open in IMG/M
3300032064|Ga0318510_10241085All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300032064|Ga0318510_10447720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300032064|Ga0318510_10530795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300032065|Ga0318513_10148700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1117Open in IMG/M
3300032066|Ga0318514_10108596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71414Open in IMG/M
3300032066|Ga0318514_10144397All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300032066|Ga0318514_10763383All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300032076|Ga0306924_10929984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium960Open in IMG/M
3300032076|Ga0306924_12376331All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300032076|Ga0306924_12474345All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300032090|Ga0318518_10072696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1678Open in IMG/M
3300032090|Ga0318518_10204124All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300032090|Ga0318518_10208681All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1000Open in IMG/M
3300032091|Ga0318577_10082707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1486Open in IMG/M
3300032091|Ga0318577_10136185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1165Open in IMG/M
3300032091|Ga0318577_10268392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium817Open in IMG/M
3300032094|Ga0318540_10103488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1340Open in IMG/M
3300032094|Ga0318540_10218712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium919Open in IMG/M
3300032094|Ga0318540_10288866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium791Open in IMG/M
3300032094|Ga0318540_10307977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria764Open in IMG/M
3300032094|Ga0318540_10410532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium654Open in IMG/M
3300032094|Ga0318540_10576985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300032159|Ga0268251_10577798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300032180|Ga0307471_100346776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1593Open in IMG/M
3300032180|Ga0307471_102354083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria672Open in IMG/M
3300032205|Ga0307472_100154244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1683Open in IMG/M
3300032261|Ga0306920_100080532All Organisms → cellular organisms → Bacteria4791Open in IMG/M
3300032261|Ga0306920_100270339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2534Open in IMG/M
3300032261|Ga0306920_101232965All Organisms → cellular organisms → Bacteria → Proteobacteria1079Open in IMG/M
3300032261|Ga0306920_101712032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium890Open in IMG/M
3300032261|Ga0306920_101883571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium841Open in IMG/M
3300032261|Ga0306920_102375787Not Available732Open in IMG/M
3300032261|Ga0306920_102931869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300032261|Ga0306920_103093641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria625Open in IMG/M
3300032261|Ga0306920_104393955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300033289|Ga0310914_10548985All Organisms → cellular organisms → Bacteria → Proteobacteria1044Open in IMG/M
3300033289|Ga0310914_10594500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium998Open in IMG/M
3300033289|Ga0310914_10607943All Organisms → cellular organisms → Bacteria → Proteobacteria985Open in IMG/M
3300033289|Ga0310914_10639441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium957Open in IMG/M
3300033289|Ga0310914_11153318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300033289|Ga0310914_11170418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium670Open in IMG/M
3300033290|Ga0318519_10013936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3409Open in IMG/M
3300033290|Ga0318519_10026570All Organisms → cellular organisms → Bacteria2673Open in IMG/M
3300033290|Ga0318519_10026811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2664Open in IMG/M
3300033290|Ga0318519_10061147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1921Open in IMG/M
3300033290|Ga0318519_10463116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria760Open in IMG/M
3300033290|Ga0318519_10487311All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300033290|Ga0318519_10541392All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300033290|Ga0318519_10563582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium690Open in IMG/M
3300033290|Ga0318519_10853432All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300033290|Ga0318519_10891701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil15.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.39%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil11.39%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.87%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.34%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.38%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.29%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.29%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.29%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.29%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.19%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.19%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.19%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.19%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.10%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.10%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.10%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.10%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.10%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.10%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.10%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.10%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.10%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
2189573000Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006578Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010863Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021968Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c1EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027071Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030989Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032159Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2)Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
prs_041245302070309004Green-Waste CompostMWTLAFGCHEDRTPTHGYAASREAAMAAFAKSWRRGRKAL
E1_035675602170459002Grass SoilRQRPLPALSVGSAWMWTLLYDHHEDRTRTHGYETTREGAVAEFAKSWRRE
E4A_035456002170459003Grass SoilTPWTWTLAFGHREDRTPTHGYEATREAAMGAFGKSWRRRE
2ZMR_043203702170459016Switchgrass, Maize And Mischanthus LitterMWTLAFGHHEDRTPTHGYTATREAAMAAFAKSWRRE
N55_057660402189573000Grass SoilTPWMWTLAYGDHEDRTPTHGNEATQEAAMQAFARSWHRET
INPgaii200_085105122228664022SoilWMWTLAFGHHENRTPTHGYAATREAAMATFAKSWRRE
INPgaii200_119865522228664022SoilGCPRLWQHEDRTPTHGYTATPEAAMSAFAKSWRRE
ICChiseqgaiiDRAFT_053411613300000033SoilVGTPWMWTLAYGDREIRTPTHGYEATRHGAMQAFA
INPhiseqgaiiFebDRAFT_10048920213300000364SoilMWTLDIGHHEHRSPTHGYAATRETAMAAFAKSWRRE*
AF_2010_repII_A01DRAFT_105337523300000580Forest SoilMWTLAFGHHEDRTPICGYAATREAAMAAFAKSWRR
AF_2010_repII_A1DRAFT_1000180633300000597Forest SoilMWMLAFGHHEDRTPTHGYEPTREGAMAAFAKSWRRE*
AF_2010_repII_A1DRAFT_1002515633300000597Forest SoilMWTLGFGHHEDRTPTHGYAETREAAMAAFAKSWRGE*
AF_2010_repII_A1DRAFT_1005046943300000597Forest SoilMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWRRE*
AF_2010_repII_A1DRAFT_1005466823300000597Forest SoilVFGEHEDRTPTHGYEATREAAMAAFAKSWRREEF*
AF_2010_repII_A1DRAFT_1011558123300000597Forest SoilMWTLAFGQHEDRTPTHGYAATRGDAMAAFAKSWRRE*
AF_2010_repII_A1DRAFT_1011826723300000597Forest SoilMWTLAFGYHEDRTPTHGYAATREAAMSAFAKSWRRE*
AF_2010_repII_A1DRAFT_1016543623300000597Forest SoilVHAAPVGTPWMWTLAFEQHEDRAPTHGYAATREAAMAAFVKS*
AF_2010_repII_A100DRAFT_110263213300000655Forest SoilAAPVGAPWLWTLAYGQHEDRSPIYGYEATREAAMAAFAKSWRQE*
AF_2010_repII_A001DRAFT_1003188533300000793Forest SoilWTLMFGHHEDRTPTHGYAATREAAMTAFAKSWRRE*
AF_2010_repII_A001DRAFT_1005308323300000793Forest SoilMWTLAFGHHEDRTPTHGYADTREAAMAAFAKSWRRE*
AF_2010_repII_A001DRAFT_1006464033300000793Forest SoilMIKLATLMFGYHEDRTPTHGYAKSREAAMAAFAKSWRRE*
AF_2010_repII_A001DRAFT_1010573233300000793Forest SoilEGTPWMWTLAFGQHEDRTPTYGYAATREAAMAAFAKSWRRE*
AF_2010_repII_A001DRAFT_1010764813300000793Forest SoilGRRGMWTLASEHHEDRKPTHGYAATREAAMAAFAKSWRRK*
AF_2010_repII_A001DRAFT_1013758813300000793Forest SoilRIMKAAAVPAGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWQRE*
JGI10214J12806_1187291213300000891SoilGSPRFWTLAYGYHYDCTPIHGYEATREAAMAAFAKSWRRE*
JGI1027J12803_10060796923300000955SoilMPWLWALTFEHYKDRHPTHGYAATREAAMAAFAKSWRRE*
JGI1027J12803_10117007033300000955SoilPVGTPWMWTLGFGHHEDRTPTHGYEATREAAMAAFAKTWRKE*
JGI1027J12803_10199985623300000955SoilMWTLLFGQHEDRTPTHGHEATREAAMPAFAKSWRRE*
JGI1027J12803_10223385613300000955SoilMQAFGSHEDRTPTHGYAETREAAMAAFAKSWRRGAS
JGI1027J12803_10318853433300000955SoilWTLAFRHHEDRTPPTHGYAPTREAAMAAFRKSWQRE*
JGI1027J12803_10782088923300000955SoilANAAPVGSPWMWTLAFGHHEDRTPTHGYAATREAAMTAFAKSWRRE*
JGI1027J12803_10966571013300000955SoilMWTLAFDCHEDRMPTHGYAATREAAMEAFAKSWRR
JGI10216J12902_10061929533300000956SoilMWTLTLGHREDRWPTHGYEPTREAAMAAFAKSWRR
JGI10216J12902_10342484513300000956SoilMWMWTLAFGHHEDRTPTHGYAATREAAMAAFARSWRRE
JGI10216J12902_10933465223300000956SoilMRLIGSPWMWTLAFGHHEDRTPTHGYEATREAAMAAFTKSWRRE*
JGI10216J12902_11466513323300000956SoilSPWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE*
JGI10216J12902_11598261323300000956SoilMWTLAFGHHEDRAPTHGYEATREAAMAAFAKSWRRES*
JGI10216J12902_11611778213300000956SoilMLSTLGLKHHEDRTPTHGYESTREAAMAAFAKSWRRES*
JGI10216J12902_11661132813300000956SoilWMWTLAFGHHEDRIPTHGYAETREAGMAAFAKSWRRE*
JGI10216J12902_12128565133300000956SoilWMWTLAFGHHEDRTPTHGYAETRETAMAAFAKSWRREQ*
F14TB_10423434213300001431SoilMWTLGFGYHENRTPTRDYXXXXXXAMAAFAKSWRRE*
JGI12627J18819_1002584063300001867Forest SoilWTLAFGHHEDRTPTHGYAESREAAMAAFAKSWRRKKIA*
JGI25390J43892_1016283313300002911Grasslands SoilRRGTLAFGHHEDRTPTHGYEATREAAMAAFAKSWWREPSLPS*
JGI25616J43925_1019514813300002917Grasslands SoilAPQGTPWMWTLAFGHHEDRTPTHGYEPTREVAMAAFAKSWRRE*
Ga0066398_1020897513300004268Tropical Forest SoilVGSPWMWTLAFGHHQDRTPRHGYAVTRKAAMAALAKSWRRE*
Ga0063356_10442345013300004463Arabidopsis Thaliana RhizosphereMKAAAAPLGTPWMWTLGFGHHEDRTPTHGYEATREAAMAAFAKTWRKE*
Ga0066395_1017903813300004633Tropical Forest SoilPWLWTLAYGHHEDCWPTHGYAAPREAAMAAFVKSWRRESF*
Ga0066395_1022112023300004633Tropical Forest SoilMATPRLWTLAFGQHEDRWPTHCYEPTREAAMAAFAKSWRRE*
Ga0066677_1067066413300005171SoilASPVGASWMWTLALGHHEDRTPTHGYAATREDAMAAFAKSWRRE*
Ga0066688_1052907513300005178SoilKATASPVGTPWMWTLAYAYHEDRSPTHGFEADRAAAMKAFAKSWRRA*
Ga0070690_10016617223300005330Switchgrass RhizosphereMPEDGKWFWGLAYGQHEDRSPTHGYAATREAAMAAFAKSWRRE*
Ga0066388_10049282523300005332Tropical Forest SoilMSWMWTLAFGYYEDRTPTHGYAATREAAMSSVAKSWRRE*
Ga0066388_10070438013300005332Tropical Forest SoilMKAASPEGTPRMWTLAFGHHEDRTPTHGYEPTREAAMAAFAQSWRREEF*
Ga0066388_10102134933300005332Tropical Forest SoilMLWMWRLAFDYHEDRTPTRGYAATRENAMAAFAKSWRRV*
Ga0066388_10147829713300005332Tropical Forest SoilPRMWTLAFGHHEDRTPTHGNEPTREAAMAAFAKSWPCTH*
Ga0066388_10168392433300005332Tropical Forest SoilMWTLAFGYHEDRTPTHGYEPTREAARAAFAKSWRREGVPND*
Ga0066388_10203239933300005332Tropical Forest SoilVPVGQSWMWTLAFGYHEDRTPTHGYAATREAALVAFGRSWRRE*
Ga0066388_10228330713300005332Tropical Forest SoilAAPVGTPWFWTLAYSHLEDRTPTHGYEPTREAAMAAFAKSWRRE*
Ga0066388_10235757113300005332Tropical Forest SoilPVETPWYWTLAYGYHYARWPTHGYEATREAAMAAFAKSWRRQ*
Ga0066388_10238352713300005332Tropical Forest SoilMSATRQHRVPWMWTLLLYHEGRTPTHGYEATREAAMAAFAKSWRRE*
Ga0066388_10321805133300005332Tropical Forest SoilVGSPGMWTLAFGQHEDGTPPHGYAATREAAMAAFAKSWRQEEF*
Ga0066388_10396988213300005332Tropical Forest SoilMPSAPVGTPWLWTLAFGQHEDRTPTHGYEPTREAAMAAFAKSWRWE*
Ga0066388_10420884523300005332Tropical Forest SoilGMPWLWALAFGHYEGRHPTHGYAATREAAMAAFAKSWRRE*
Ga0066388_10526288123300005332Tropical Forest SoilVSWMWTLAFGQHEDRTPTHGYAESREAAMAAFAQSWRPE*
Ga0066388_10548781713300005332Tropical Forest SoilIGTPWMWILTYRDQEDRTPTHGYKATREAAMAAFAKSWRRE*
Ga0066388_10591141313300005332Tropical Forest SoilMSWLWTLAFGYHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0066388_10598695223300005332Tropical Forest SoilPVGTPWFWTLAYAHLEDRTPTHGYEPTREATMAAFAKSWRRE*
Ga0066388_10610174713300005332Tropical Forest SoilAAVPVGMSWMWTLAFGYHEDRTPTHGYEPTREAAMAAFAKSWRRE*
Ga0066388_10731656113300005332Tropical Forest SoilMSWMWAHAFLHHEDRTPTHGDEPTREAAMAAFAKSWRRE*
Ga0066388_10831830913300005332Tropical Forest SoilVPVGMSWMWTLAFGYHEDRTPWHGYAATREAAMAAFAKSWRRGSARIGR*
Ga0066388_10870814423300005332Tropical Forest SoilMPWMWTLEIEHCGDRRATYGYAATRDAATAAFAKSWRRE*
Ga0066388_10875829223300005332Tropical Forest SoilSSKSASAVETPWMWTVASLHHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0008090_1010492833300005363Tropical Rainforest SoilMPAGMSWMWTLAFGYHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0008090_1555917533300005363Tropical Rainforest SoilKAAAAPVGTPWAWTLAFGHHEDRTPIYGYEPTRKAAMAAFAKSWRRE*
Ga0008090_1565624333300005363Tropical Rainforest SoilMPWMWTLLYDFYENRMPTHGYAATREAAMAAFAKSWRRE*
Ga0070703_1016670813300005406Corn, Switchgrass And Miscanthus RhizosphereGASWMWTLALGHHEDRTPTHGYAATREDAMAAFAKSWRRE*
Ga0070709_1065936013300005434Corn, Switchgrass And Miscanthus RhizosphereAAPVGSPWMWTLFFPPHEGRVPIHGYAATREWAMVALAESWRRE*
Ga0070709_1175859823300005434Corn, Switchgrass And Miscanthus RhizospherePVGQSWMWTLAFGHHEDRTPTHGYAATREGAMEAFAKSWRRE*
Ga0070711_10126875123300005439Corn, Switchgrass And Miscanthus RhizosphereVGTSWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0066689_1068998113300005447SoilGMSWMWTLAFEHHEDRIPTRGYAATREAAMAAFAKSWRRE*
Ga0070684_10143663823300005535Corn RhizosphereASQWVWTLSYDYHEDRSPTHGYAATRDAALHAFARSWNRET*
Ga0070697_10052505223300005536Corn, Switchgrass And Miscanthus RhizosphereMRAAADAPVDAPWMWTLAYGHHEDPTPTHGYAATREAAMAAFAK
Ga0070697_10065670823300005536Corn, Switchgrass And Miscanthus RhizosphereMTLAAAPVGMPWMWTLAFGHHEDSTPTHGYAESREAAMTAFAKS*
Ga0070697_10098800913300005536Corn, Switchgrass And Miscanthus RhizosphereVGMAWMWTLAFGYHEDRTPTHGYAETREAAMAAFAKSWRRE*
Ga0066697_1024069433300005540SoilMWTLAFGHHEDRTPIHGYEPTRKAAMAAFAKSWRRE*
Ga0070696_10143835213300005546Corn, Switchgrass And Miscanthus RhizospherePVGAPWLWTLAFGHHEDRTPTHGYAATRQAAMAAFAKSWRRE*
Ga0070696_10182927323300005546Corn, Switchgrass And Miscanthus RhizosphereAAPVGMSWMWAHAFLHHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0066695_1050767613300005553SoilPLGMEKDYLILKRHHEDRTPTHGYAATREAAMRAFAKSWRRE*
Ga0066695_1060382713300005553SoilMWTLAFGHHEDRTPTYGYAVSREAAMAAFSKSWRRE*
Ga0066695_1064035213300005553SoilWMWTLALGHHEDRTPTHGYAATREDAMAAFAKSWRRE*
Ga0066692_1092206213300005555SoilMWTLGFGYHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0066707_1028406213300005556SoilAPVGSPWMWTLAFGHHEDRAPTHGYAATREDAMAAFANSWRRE*
Ga0066698_1066547113300005558SoilWMWTLAFGHHEDRTPTHGYEAVREAAMAAFAKIWRRE*
Ga0058697_1013140033300005562AgaveMALDRVDLPWLWTLAFGHREDRTPSHGYEATREDAMAAFAKSWRRE*
Ga0066693_1011228013300005566SoilPWMWTLAFGHHEDRTATHGYAATREAAMAAFAKSWRRY*
Ga0066703_1051496713300005568SoilKRRLGQRWMWTLALGHHEDRTPTHGYAATREDAMAAFAKNWRRE*
Ga0066694_1015646623300005574SoilMPWMWTLGFGYHEDRTPTHGYEATREAAMAAFAKTWRKE*
Ga0066905_10005782013300005713Tropical Forest SoilMWTIAYVHHEDRTPTRGYEPTREAAMAAFAKSWRQG*
Ga0066905_10007972523300005713Tropical Forest SoilMWNLGFGHHEDRTPTHGYEATREATMAAFASGRKHALTKPKL*
Ga0066905_10011110743300005713Tropical Forest SoilMWTLAFGHHKDCTPTHGGEPTREAAMATFTKSWRRE*
Ga0066905_10011481643300005713Tropical Forest SoilMWTLAFGYHEDRTPTHGYAATREAALVAFGRSWRRE*
Ga0066905_10020898243300005713Tropical Forest SoilVGMSWMWTLAFGYHEDRTPTHGYAATREAAMGAFANSSRRE*
Ga0066905_10052693213300005713Tropical Forest SoilASTAPVGSPWIWTLAFGHHEDRTPTHGYEATREAAMAAFARSWRRE*
Ga0066905_10056852413300005713Tropical Forest SoilAPVGSAWMWTLAFWHHEDRTPTHGYAANREAAMAAFAKSWRRE*
Ga0066905_10057779533300005713Tropical Forest SoilMWTLAYGQYEDRTPTHGYAAMREAAMAAFAKSWRRE*
Ga0066905_10088483713300005713Tropical Forest SoilMAWTLAYGFHEDRTPTRGYAPTREAAMAAFAKSWRRG*
Ga0066905_10094136213300005713Tropical Forest SoilMPWIWTLIFGYHEDRSPPHEATREAAMAAFAKSWRCK
Ga0066905_10103913913300005713Tropical Forest SoilAAVPVGMSWMWTLAYGYHEDRTPTHGYAATREAATTAFAKSWRRE*
Ga0066905_10110113223300005713Tropical Forest SoilMWTLAFGHHEDRTPIYGYEATREAAMAAFAKSWRRE*
Ga0066905_10125072623300005713Tropical Forest SoilMWTLAYGQHEDRTPTHGHEATREAAMQAFARSWHRET*
Ga0066905_10128873423300005713Tropical Forest SoilAPVGTPWMWTLAFGQHEDRTPTHGYAATREAAMAAFAKSWRRS*
Ga0066905_10142737733300005713Tropical Forest SoilPWMWTVAFGHHEDRWPTHGYEASREAAMAAFAKSWRRQWPR*
Ga0066905_10148537813300005713Tropical Forest SoilMWTLAYGHHEDRSPIHGYETTREAAMVAFAKSWRQE*
Ga0066905_10174523923300005713Tropical Forest SoilPWLWTLAYGQHEDRTPTHGYEATREAAMAAFAKSWRS*
Ga0066905_10195988813300005713Tropical Forest SoilLWTLAYGHHEDRTPIHGYEATREAAMAAFAKSWRRE*
Ga0066905_10204707513300005713Tropical Forest SoilMWALAFDYREDHTPTHGYEATREAAMAAFAKSWRREQF*
Ga0066905_10209202813300005713Tropical Forest SoilMWTLAFGHHEDCTATHGYEPTREAAMAAFAKSWRQQRPR*
Ga0066903_10014515933300005764Tropical Forest SoilMWTLAFGYHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0066903_10030165723300005764Tropical Forest SoilMPWMWTLMLGYHEDRTPTHGYEPTREAAMAAFAKGWRGSS*
Ga0066903_10034374133300005764Tropical Forest SoilMDKAFGYHEDPTPTHGYEPTRKAAMAAFAKSWRRE*
Ga0066903_10054004143300005764Tropical Forest SoilMPWMWTLAFGHHEDRTPTHGYERTREAAMAAFAKSWRRE*
Ga0066903_10062051533300005764Tropical Forest SoilMRTLAFGYHEDRTPTHGYEPTREATMAGIRQELAAFANSSRRS*
Ga0066903_10066609413300005764Tropical Forest SoilMKVHAAPVGSPWMWMLAFGHHEDRTPTHGYAATREDAMTAFAKSWRRE*
Ga0066903_10073326123300005764Tropical Forest SoilVFGAAVGTPWLWTLAYGHHEDRTLIHGYAATREDAMAAFAKSWRRE*
Ga0066903_10087477153300005764Tropical Forest SoilMWTLAFGHEDRSPTHGYATTREDAMAAFAKSWRRE*
Ga0066903_10087753243300005764Tropical Forest SoilTPWLWTLAYGQHEDRTPTHGHEPTREAAMQAFARSWHRET*
Ga0066903_10104070113300005764Tropical Forest SoilWMWTLAFGQHEDRSPTHGYAESREAAMAAFAKSWRRE*
Ga0066903_10106045713300005764Tropical Forest SoilMLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0066903_10106182223300005764Tropical Forest SoilMWALAFGRHEDRTPTHGYDATREAAMAASAKNRRRW*
Ga0066903_10122963033300005764Tropical Forest SoilMWTLAFGHHEDRTPTAGYEPTREEAMAAFTKSWRRE*
Ga0066903_10128615923300005764Tropical Forest SoilMWTLAFGHHEDCRPAHGYEPTREAAMAAFTKSWRRE*
Ga0066903_10143644013300005764Tropical Forest SoilARPWMWTLIFPRHEDLTPTHGYAVTREAAMAAFAKCWRRE*
Ga0066903_10157249243300005764Tropical Forest SoilSAAAPVGMPWLWTLAYGHHEDRTPIYGYEPTREEAMTAFAKSWRRE*
Ga0066903_10164369113300005764Tropical Forest SoilPWLWTYGFNPLERRPTHGYAPTREAAMAAFAKSWRRE*
Ga0066903_10171276823300005764Tropical Forest SoilMPWLWTLACGHHEDRTPIYGYEPTRVAAMAAFAKGWRRE*
Ga0066903_10174977433300005764Tropical Forest SoilIKSAAAPVGQPWLWTLIYGYYEDRTPTHGYAATREDAMTAFAKSWRRE*
Ga0066903_10189254443300005764Tropical Forest SoilMWTLAFGHHKDRTPTHGYEPPREAAMAAFAKSWRRE*
Ga0066903_10191074613300005764Tropical Forest SoilPAGMPWLWVLAFGHYEGRHPTRGYAATREAAMVAFAKSWRRE*
Ga0066903_10191438313300005764Tropical Forest SoilVHSAPVGTPWMWTLAFGHHEDRWPTHGYEPTREAAMAAFAKSWRRQWPR*
Ga0066903_10192829133300005764Tropical Forest SoilMWTLAFGHYEDRSPTHGYEATREAAMAAFAKSWRRE*
Ga0066903_10196106223300005764Tropical Forest SoilMWTLAFGHHEDRTPIYGYAETREAAMAAFAKSWRRE*
Ga0066903_10196165013300005764Tropical Forest SoilAHAAPAGSPWMWTLMFGHHEDRTPTHGYEPTREAAMAAFAKSW*
Ga0066903_10196499823300005764Tropical Forest SoilSPWMWTLAFGYHEDRTPTHGYEPTREAAMAAFAKSWQRE*
Ga0066903_10211234823300005764Tropical Forest SoilMWTLAYGHHEDRTPTHGYEPTREAAMPAFAKSWRRE*
Ga0066903_10213659133300005764Tropical Forest SoilVGTPWLWMLGYGHHEDRTPIYGYEATREAAMEAFAKSWRRE*
Ga0066903_10213734933300005764Tropical Forest SoilMWTLISPHHEGRTPTHGYAESREAAMAAFAKSWRRE*
Ga0066903_10232212923300005764Tropical Forest SoilMDKAFGYHEDPTPTHGYEPTRKATMAAFAKSWRREYRR*
Ga0066903_10246233433300005764Tropical Forest SoilMWTLMFGYHEDRTHGYASTREAAMAAFAKSWRRG*
Ga0066903_10254531333300005764Tropical Forest SoilMQILAVAVAMWTLIFPHHESRTPTHRNEPTREATMSAFAKSWRQE*
Ga0066903_10263168933300005764Tropical Forest SoilMPWMWTLAYGHHEDRTPTHGYEPTREAAMAAFAKSWRREWPR*
Ga0066903_10281632633300005764Tropical Forest SoilMPSAPVGTPWLWTLAFGQHEDRTPTHGYAPTREAVMAAFAKSWRRE*
Ga0066903_10305406413300005764Tropical Forest SoilMWTLAFERTEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0066903_10306057433300005764Tropical Forest SoilMWTLMFGHHEDRTPTHGYAATREAAMTAFAKSWRRE*
Ga0066903_10309524713300005764Tropical Forest SoilMSWMWRLAYDYHEDRTLTHGYAATREDAVAAFAKSWRRE*
Ga0066903_10312290023300005764Tropical Forest SoilMSWMWTLAFGYHEDGTPSHGYAATREAAMAAFAKSWRRE*
Ga0066903_10318746533300005764Tropical Forest SoilMWTLAGGRHEDGTATHGYAATREAAMAAFAKSWRRE*
Ga0066903_10347404823300005764Tropical Forest SoilMPWLWTLAFGHHEDRSPTRGYAATREAAMSSFAKSWRRE*
Ga0066903_10381759243300005764Tropical Forest SoilWMWTLAFGHHEDRTPTHGYAATREAAMSAFAKSWRRE*
Ga0066903_10385711223300005764Tropical Forest SoilMWTLAFGQHQDRTHGYAATREAAMAAFAKSWRRE*
Ga0066903_10393849223300005764Tropical Forest SoilMWTLIFGYHEDRSPTHGYEASREAAMAAFAKSWRR*
Ga0066903_10424480213300005764Tropical Forest SoilMWTLAFKHHEDRTPTHGYAQTREAAMAAFAKSWRRE*
Ga0066903_10430015433300005764Tropical Forest SoilAAPVGAPWLWTLAFGYHEDRAPTHGYEATREAAMVALAKSWRQDENARAKRP*
Ga0066903_10444472023300005764Tropical Forest SoilMWMLVFSHHEDRTPTHGYEPTREAAMTAFAKSWRRE*
Ga0066903_10484151613300005764Tropical Forest SoilARIAFGQHEDRTPTHGYEATRETAMAAFAKSWRRE*
Ga0066903_10494691723300005764Tropical Forest SoilMLTFAFGHHEDRTPTHGYEPTREAAMAALAKSWRK*
Ga0066903_10534546423300005764Tropical Forest SoilSWMWTLAFGHHEDRTPTRGFRYAATREAAMAAFAKRWRRE*
Ga0066903_10559641923300005764Tropical Forest SoilMWTLAFGYHEDRTPIHGYAETREAAMAAFAKSWRRE*
Ga0066903_10569870513300005764Tropical Forest SoilMPWQWTLAYGEHEDRLPTNGYEPTREAAMRAFARSWH
Ga0066903_10608843423300005764Tropical Forest SoilMWTLTFGHHEDRTPTHGYADSREAAMAAFAKSWRRE*
Ga0066903_10612297933300005764Tropical Forest SoilMWTLAFGQHEDRTPTHGYTASREDAMAAFAKSWRRE*
Ga0066903_10632194723300005764Tropical Forest SoilMWTLAFGHHEDRTPTHGYEATREAAVAAFAKSWRREEF*
Ga0066903_10632222823300005764Tropical Forest SoilMPWLWTLAYGHHENRTPIYGCEPTREAAMAAFAKSWRRVWP*
Ga0066903_10633889423300005764Tropical Forest SoilMWSLAIGHHEDRTPAHDYAATREAAMAAFAKRWRRE*
Ga0066903_10639787523300005764Tropical Forest SoilMWTLGFGHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0066903_10647134723300005764Tropical Forest SoilMWTLIFPHHEGRTPTHGYEATREAAMAAFAKSWRRE*
Ga0066903_10649449423300005764Tropical Forest SoilVVGVWTLAYGYREERTPTHGSAATREAAIAAFTKSWRRK*
Ga0066903_10651176123300005764Tropical Forest SoilMDKALWYHEDPTPTHGYEPTRKAAMAAFAKSWRRE*
Ga0066903_10700860123300005764Tropical Forest SoilMWMLVFGHHEDRTPTHGYEATREGAMAAFAKSWRRE*
Ga0066903_10729870423300005764Tropical Forest SoilVGTPWLWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRR*
Ga0066903_10739362923300005764Tropical Forest SoilMWMLVFGHHQDRTPTHGCEPTREGAMAAFAKSRRRE*
Ga0066903_10770038513300005764Tropical Forest SoilPVGSPWMWKLAFDFRGDRTPTHGYAETREAAMNAFAKSWRRK*
Ga0066903_10777123223300005764Tropical Forest SoilMWTPAFGHHEDRAPTHGYGAAREAAMAAFAKSWRRNDV*
Ga0066903_10799813323300005764Tropical Forest SoilSPWMWTLAFGHHEDRTPTHGYAATREAAMAAFARSWRRE*
Ga0066903_10820803713300005764Tropical Forest SoilMWTVAYGHHEDRSPIYGYAATREAAMTAFAKSWRRE*
Ga0066903_10833903323300005764Tropical Forest SoilMWTLMFGHHEDRTPTHGYEATREAAMSAFAKSWRRE*
Ga0066903_10880233413300005764Tropical Forest SoilLKSAAAPVGMPWLWTLAYGHHEDRTPIYGYETTREAAMAAFAKSWRRE*
Ga0066903_10914916623300005764Tropical Forest SoilMPAGMSWMWTLAFGYHEDRTPTHGYEATREAEMAAFAKSWRRE*
Ga0081455_10002248173300005937Tabebuia Heterophylla RhizosphereMALDRVDLPWLWTLAFGHHEDRTPSHGYEVTREDAMAAFAKSWRRE*
Ga0081455_1016928513300005937Tabebuia Heterophylla RhizosphereMWTIAYGHHEGLAPTRGYEHTHEAAMAAFAKSWRQKS*
Ga0081538_1010619133300005981Tabebuia Heterophylla RhizosphereMWTIGCDHHKDRTPTHGYEPTRDAAMAAFAKSGRGQR*
Ga0070717_1003611553300006028Corn, Switchgrass And Miscanthus RhizosphereMWTLSFGHHEDRTPTHGYAATRETAMAAFAKSWRRE*
Ga0070717_1004212193300006028Corn, Switchgrass And Miscanthus RhizosphereMRTLAFGHHEDRTPTYGYAVSREAAMAAFSKSWRRE*
Ga0070717_1009355083300006028Corn, Switchgrass And Miscanthus RhizosphereMWTLAYGYHEDRTPTHGYEPTREAAMAAFAKSWRRE*
Ga0070717_1020991433300006028Corn, Switchgrass And Miscanthus RhizosphereMRLIGSPWMWTLAFGHHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0070717_1043404343300006028Corn, Switchgrass And Miscanthus RhizosphereMWSLDFWHHEDRTPTHGYEPTREAAMAAFAKSWRRQ*
Ga0070717_1050707823300006028Corn, Switchgrass And Miscanthus RhizosphereMWTLTFWHHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0070717_1080014813300006028Corn, Switchgrass And Miscanthus RhizosphereGRWPSAHHGDRTPTYGYAETREAAMAAFAKSWRRE*
Ga0070717_1211382223300006028Corn, Switchgrass And Miscanthus RhizosphereMWTLAFGYHEDRTPTHGYAESREAAMGAFAKSWRRE*
Ga0066651_1040393413300006031SoilKLVFWHHEDRTPTHGYEATREAAMQAFARSWHRET*
Ga0075365_1034121823300006038Populus EndosphereSWMWTLIIPHHEGRSPTHGYEATREAAMAAFAKSWRRE*
Ga0066652_10016268443300006046SoilMWTLALGHHEDRSPAHGYAATREAAMAAFAKSWRRE*
Ga0066652_10031482713300006046SoilWMWTLAFGHHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0075028_10070951513300006050WatershedsMPSMCTLAFGYHEDRTPTHGYEATREAAMAAFARSWRRE*
Ga0075432_1036997813300006058Populus RhizosphereSWMWTLAFEHHEDRIPTRGYAATREAAMAAFAKSWRRE*
Ga0070715_1013702113300006163Corn, Switchgrass And Miscanthus RhizosphereEGTPWLWTLAFGHHEDRTPTSGYEATREAAMAPFAKSWRWE*
Ga0070715_1037881113300006163Corn, Switchgrass And Miscanthus RhizospherePWMWTLASGHHKDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0070715_1081872323300006163Corn, Switchgrass And Miscanthus RhizosphereLWTLAFGHHHDRAPTHGYEPTREAAMAAFAASWRRE*
Ga0070715_1086933313300006163Corn, Switchgrass And Miscanthus RhizosphereVGSPWMWTLAFAHDEDRTPTHGYAESREAAMAAFAKSWRRE*
Ga0075018_1033318433300006172WatershedsWMWTLAFGHREDRTPTHGYEATRHAAMAAFAKSWRRRE*
Ga0075018_1071777113300006172WatershedsMWALAFGQHKDRTATHGYEATREAAMAAFAKSWRRE*
Ga0070716_10043720633300006173Corn, Switchgrass And Miscanthus RhizosphereSPWLWTLAYGHHEDRTPTHGYEATREGAMAAFARSWRRE*
Ga0070712_10004069653300006175Corn, Switchgrass And Miscanthus RhizosphereMWTLAFGHHEDRTPTHGYAESREAAMAAFAKSWRRE*
Ga0070712_10015128143300006175Corn, Switchgrass And Miscanthus RhizosphereMWTLASGHHKDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0070712_10023528433300006175Corn, Switchgrass And Miscanthus RhizosphereVELAFGHHEDRTPTSGYEATREAAMAPFAKSWRWE*
Ga0074059_1210103533300006578SoilAAVPVGMSWMWTLAFGHHEDRTPAHGYAATREAAMAAFAKSWRR*
Ga0079222_1177374613300006755Agricultural SoilMGTLAFGYHEDRTPTHGYAEAREAAMGAFAKSWRRE*
Ga0066653_1034074223300006791SoilMWTLAFGHHEDRTPIHGYEPTREAAMAAFAKSWRRE*
Ga0066659_1004531133300006797SoilMWTLAFGHHADRTPTHGYEPTRKAAMAAFAKSWRRE*
Ga0066659_1083679213300006797SoilAAAPIGTPWMWTLAFGYHEDRIATHGYEPTREAAMTAFAKSWRRE*
Ga0066659_1141841013300006797SoilGMPWMWTLAFGHHEDRTPTHGYEPKREAAMAAFAKSWRRET*
Ga0066660_1071567913300006800SoilRVGGRTPWMWTLASGQHKDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0075428_10106787123300006844Populus RhizosphereMKIHPVAYGQHENRAPTYGYEATREAAMAAFAKSWRRES*
Ga0075428_10183854833300006844Populus RhizosphereVDPSLGQDEDRTPTHGYAETREAAMSAFAKSWRRA*
Ga0075428_10190275413300006844Populus RhizosphereLAFGHHEDRTPTHGYAAMRGAGMAAFAKSWRREQA*
Ga0075428_10193424613300006844Populus RhizosphereIWTLSYGHHEDRTPTHGYEATREAAAAFAKSWRRQ*
Ga0075421_10068749853300006845Populus RhizospherePWIWTLAYGDHEDRTPTHGYEPSREAAMAAFAKSWRRE*
Ga0075421_10135371413300006845Populus RhizosphereMWMLAYGYHEDRTPTHGYELTREAAMAAFAKSWRRE
Ga0075421_10197931413300006845Populus RhizospherePVGSPWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKS*
Ga0075421_10256380333300006845Populus RhizosphereNAAPVGSPWMWTLIFPHHEGHSPTHGYEGTREAAMAVFAKSWQRE*
Ga0075431_10020793213300006847Populus RhizosphereSWMWTLAFGHHEDRTATHGYAATREAAMAAFAKSWRRG*
Ga0075420_10193600813300006853Populus RhizosphereTPWMWTLAYGQHEDRTPTHGYEPTREQAMAAFAKSWRRE*
Ga0075425_10005903923300006854Populus RhizosphereMWTLDIHKDRTPTHGYEPTREAAMAAFAKSWRRE*
Ga0075425_10115541723300006854Populus RhizosphereMWTLAFGHHEDRAPTHGYAATREAAMTAFAKSWRRE*
Ga0075425_10139200223300006854Populus RhizosphereWMWTLAFGYHEDRAPTHGYEATREAAMAAFAKSWRRE*
Ga0075425_10187758823300006854Populus RhizosphereMRAAPVGTPWMWTLAFGYHEDRTPTHGYVETREAAMGSFAKSWVRE*
Ga0075425_10254688323300006854Populus RhizosphereWMWTLAFGHHEDRTTTHGYEATREAAMAAFAKSWRRE*
Ga0075426_1015598513300006903Populus RhizosphereWMWTLAFGYHRNRATNHGYAATREVAMAAFAKSWRRL*
Ga0074063_1005104313300006953SoilMWTLAFGHHENRTPTHGYGPTREAMAAFAKSWRLE*
Ga0074063_1324839443300006953SoilVPVGQSWMWMLAFEHHEDRTPTHSYAATREAAMAGVAKSWRRE*
Ga0074063_1411626413300006953SoilLRPASPSGHHEDRTPTHGYEPTREAAMAAFAKSWRRE*
Ga0066710_10205061813300009012Grasslands SoilAPVGQPWMWTLAFGHHEDRTPTHGLSATREAAMSAFAKSWRRG
Ga0066710_10256237323300009012Grasslands SoilQQLKRCLVAFGHHEDRAPRHGYEATREAALMAFAKSWRRE
Ga0099829_1076725523300009038Vadose Zone SoilMWTLAFGHHEDRTPTHGYAETREEAMAAFAKSWRRE*
Ga0099830_1086586713300009088Vadose Zone SoilMWTLAYEHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0099830_1177766723300009088Vadose Zone SoilAAASVGTLWLWTLAFGHHKDRTPTHGYEAKREAAMTTFAKSWRK*
Ga0075418_1154853313300009100Populus RhizosphereTDPSRPAFGHHEDRTPTHGYAETREAAMAAFAKSWRRG*
Ga0075418_1167444213300009100Populus RhizosphereMRALAFGHQEDRTPTHGYEATRKTAMAAFAKSWQRQ*
Ga0075418_1202736513300009100Populus RhizosphereAAAAPEGTPWLWTLAFGHHKDRTPTHGYESTREAAMAAFAKSWRRE*
Ga0114129_1029395443300009147Populus RhizospherePWMWTLLFGYHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0114129_1032402223300009147Populus RhizosphereMPQMWTLAFGHHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0114129_1102081413300009147Populus RhizosphereMLRPVGASWMWTLAFGHHGDRTPTHDYAATREDAMAAFAKSWRRE
Ga0114129_1148615833300009147Populus RhizosphereWMWTLAFGHHEDRTPTHGYEATREAAVTAFRKSWRRE*
Ga0114129_1170372623300009147Populus RhizosphereHEMIHAASVGTPWMWTLAFGHHEDRAPTHGYAATREAAMTAFAKSWRRE*
Ga0114129_1266452623300009147Populus RhizosphereMWTLAFGYHEDRTPTHGYVETREAAMGSFAKSWVRE*
Ga0114129_1278889213300009147Populus RhizosphereTLAFWHHEDRTPTHGYEATREAAMAAFAKSWWRE*
Ga0075423_1027905013300009162Populus RhizosphereMIHAASVGTPWMWTLAFGHHEDRAPTHGYAATREAAMTAFAKSWRRE*
Ga0075423_1036305023300009162Populus RhizosphereRRGCGHSLSGIHKDRTPTHGYEPTREAAMAAFAKSWRRE*
Ga0075423_1114698233300009162Populus RhizosphereAVPVGMSWMWTLAFGHHEDRAKTHGYAATREAAMAAFAKSWRHE*
Ga0075423_1119604833300009162Populus RhizosphereVSPVGTPWMWTLLLYHEGRTPTHGYEPTREAAMAAFAKSWRRE*
Ga0105249_1165756113300009553Switchgrass RhizosphereWTVSYGDHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0126374_1018764933300009792Tropical Forest SoilMWMLAFGYHQDRMPTHGYAETREAAMAAFAKSWRRE*
Ga0126374_1019159713300009792Tropical Forest SoilMWTLAYGHQEDRTPTHGYEPTREAAMAAFAKSWRRQ*
Ga0126374_1019195513300009792Tropical Forest SoilGTPWLWTLAFSQHEDRTPTHGYEPTREAAMAAFAKSGRRE*
Ga0126374_1035576613300009792Tropical Forest SoilAPVGTPWFWTLAYAHLEDRTPTHGYEPTREATMAAFAKSWRRE*
Ga0126374_1039462513300009792Tropical Forest SoilMWMLVFGHHEDRTPTHGYEPTREGAMAAFAKSWRRE*
Ga0126374_1049028713300009792Tropical Forest SoilWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0126374_1065470623300009792Tropical Forest SoilWMWTLAFGHHEDRWPTHGYEPTREAAMAAFAKSWRRE*
Ga0126374_1080453623300009792Tropical Forest SoilWTLAFGHHEDRWPTHGYEPTREAAMATFAKSWRREEF*
Ga0126374_1162356023300009792Tropical Forest SoilMPWMWTLTFGHHEDRTPTHGYEATRESAMAAFAKSWRRE*
Ga0126374_1164595323300009792Tropical Forest SoilAAPVGTPWMWTLAFGQHEDRTPTHGYAETREAAMTAFAKSWRRQ*
Ga0126374_1178884913300009792Tropical Forest SoilAPAGMPWLWALTFGHYEGRHPTRGYAATREAAMAAFAKSWRRQ*
Ga0126374_1185882823300009792Tropical Forest SoilPSMWTLAFGHEDRSPTHGYATTREDAMAAFAKSWRRE*
Ga0126380_1003331123300010043Tropical Forest SoilMWTLMFGHHEDRTPTHGYTATREAAMAAFAKGWGRK*
Ga0126380_1010202613300010043Tropical Forest SoilTLEPFEHHEDRTPTHGYAATREAAMAAFAKSWRRGS*
Ga0126380_1024060613300010043Tropical Forest SoilMWTLMFGYHEDRTPTRGYAATREDAMAAFAKNWPRK*
Ga0126380_1162212223300010043Tropical Forest SoilMWALTFGYHEDRMPTHGYAATREPAMAAFAKNWMRE*
Ga0126380_1226875523300010043Tropical Forest SoilAPAGMPWLWALAFGHYEGRHPTRGYAATREDAMAAFAKSWRRE*
Ga0126384_1003984733300010046Tropical Forest SoilMWTLAFGHHEDRTSTHGYEPTREAAMAAFAKSWRWEEF*
Ga0126384_1005831623300010046Tropical Forest SoilMWTLAFWHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0126384_1016442833300010046Tropical Forest SoilLWTLAFGHHEDRTPTHGYEPTRETAMAAFAKGWWREQF*
Ga0126384_1044989623300010046Tropical Forest SoilMWALAFGHHEDRTPTHGYEATREAAMAAFAKSWRRQ*
Ga0126384_1058692923300010046Tropical Forest SoilMWTLAFGHHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0126384_1061387723300010046Tropical Forest SoilMWTLAFGQHEDRTPTHGFATTREAAMAAFAKSWRRE*
Ga0126384_1080075723300010046Tropical Forest SoilGQSWMWTLAFGYHEDRTPTHGYAATREAALVAFGRSWRRE*
Ga0126384_1081436223300010046Tropical Forest SoilSAAPVGSPWMWTLAVGHHEDRTPTHGYDATREAAMAAFAKSWRSE*
Ga0126384_1143701723300010046Tropical Forest SoilRPRRSMRLGMWTLAFGQHEDRTPTHAYATSREAAMAAFAKSWQRQ*
Ga0126384_1148606923300010046Tropical Forest SoilMWTLAFGYHEDRMPTHGYEPTREAAMAAFAKSWRWE*
Ga0126384_1152381613300010046Tropical Forest SoilMWTLAFGHHEDRTPTHGYEPTREVAMAAFAKSWRRGIIYI
Ga0126384_1170295513300010046Tropical Forest SoilMWTLAFGHHEDRTPTHGYERTREAAMAAFAKSWRRE*
Ga0126384_1214533413300010046Tropical Forest SoilMWTLAFGHHEGHTPTYGYAATREAAIAAFANSYRR
Ga0126384_1231987423300010046Tropical Forest SoilMWTLMFGYHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0126384_1240387023300010046Tropical Forest SoilMWTLGYGYHEGRTPIHGYATTREDAMTAFAKSWRRE*
Ga0126382_1004832423300010047Tropical Forest SoilMLAYGYHEDRTPIYGYEPTREAAMAAFAKSWRRQ*
Ga0126382_1009916013300010047Tropical Forest SoilAPAGMPWLWALAFGHYEGRHPTRGYAATREAAMAAFAKSWRRE*
Ga0126382_1011160613300010047Tropical Forest SoilMWTLMFGHHEDRTPTHGYTATREAAMAAFAKSWRRE*
Ga0126382_1014406223300010047Tropical Forest SoilMWTLAFGYHEDRTPTHGYGPAREAAMAAFAKSWRRQ*
Ga0126382_1072971523300010047Tropical Forest SoilMKANAAPGGSPWMWNLGFGHHEDRTPTHGYEATREATMAAFASGRKHALTKPKL*
Ga0126382_1097508923300010047Tropical Forest SoilMWTLAFGYHEERTPTHGYAATREAALVAFGRSWRRE*
Ga0126382_1112048333300010047Tropical Forest SoilVGSPWMWTLAFGHHENRRPTHGYAATREAAMAAFAKSWRQE*
Ga0126382_1175762913300010047Tropical Forest SoilMWTLAFPRHEDRMPMHGYAAPREAAMAAFAKGLRRE*
Ga0126382_1180979923300010047Tropical Forest SoilSPWKWTLVFGHHEDRIPTHGHAATREAAMTAFAKSWRRE*
Ga0126373_1048771543300010048Tropical Forest SoilAAVPVGMSWMWTLAFGYHEDRTPTHGYEPTCEAAMAAFAKSWRRE*
Ga0126373_1052156523300010048Tropical Forest SoilMLAFGQHEDRTRTHGYSATREAAMAAFAKSWRRE*
Ga0126373_1083379023300010048Tropical Forest SoilMWTLAFGHHEDCTPTHGYEPTREAAMAAFAKSWRRE*
Ga0126373_1101409423300010048Tropical Forest SoilMWMLAFGHHEDRTPTHGYEPTREGPMAAFAKSWRRE*
Ga0126373_1117153233300010048Tropical Forest SoilMPWMWTLLYDFYENRMPTHGYAATREAAMAAFAKS
Ga0126373_1123056323300010048Tropical Forest SoilWTLAFGHHEDRTPTHGYAETREAAMAAFAKSWRRE*
Ga0126373_1168761413300010048Tropical Forest SoilGSPWFWTLAYGYHYDCTPIHGYEARREAAMAAFAKSWRRE*
Ga0126373_1238254913300010048Tropical Forest SoilVPAGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWQRE*
Ga0126373_1252136723300010048Tropical Forest SoilMWTLDFWHHEDRTPIYGYEATRETAMAAFAKSWRQE*
Ga0099796_1024683813300010159Vadose Zone SoilRPWFWTLAYGYHYDCTPIHGYEATREAAMAAFAKSWRRE*
Ga0134088_1058432913300010304Grasslands SoilMWTLAFGHHEDRTPIHGYEPTSKAAMAAFAKSWRRE*
Ga0134109_1049589413300010320Grasslands SoilAAPVGSPWMWTLAFGHHEDRAPTHGYAATREDAMAAFANSWRRE*
Ga0134111_1012557433300010329Grasslands SoilSIFKVHAAPVGSPWMWTLAFGHYGYAATREDAMAAFAKSWRRE*
Ga0134111_1052272213300010329Grasslands SoilAAAPVGTPWMWTLGFGHHEDRTPTHGYEATREAAMAAFAKTWRKE*
Ga0126370_1006498543300010358Tropical Forest SoilVLEYRQWMWALAFDYREDHTPTHGYEAAREAAMAAFAKSWRRE*
Ga0126370_1014781533300010358Tropical Forest SoilMWMLVFGHHEDRTPTHGYEPTREGAMAAFDKSWRRE*
Ga0126370_1033499223300010358Tropical Forest SoilMLTLAFGHHEDRTPTHGYEPTREAAMAALAKSWRK*
Ga0126370_1051211913300010358Tropical Forest SoilMPWMWTLAFGHHEDRTPICGYAATREAAMAAFAKSWRRE*
Ga0126370_1055391313300010358Tropical Forest SoilTLAFGHHEDHTPTHRYEATREAAMAAFAKSWRRE*
Ga0126370_1084320633300010358Tropical Forest SoilLAFLLLTRLWKLVFGHHEDRTPTHGYEATCEAAMAAFAKSWRRE*
Ga0126370_1165686223300010358Tropical Forest SoilMWTLAFGYYEDRTPTHGYAATREAAMSSVAKSWRRE*
Ga0126370_1182876813300010358Tropical Forest SoilSAAAPVGTPWFWTLAYAHLEDRTPTHGYEATCEAAMAAFAKSWRRK*
Ga0126370_1186763323300010358Tropical Forest SoilMWTLAFGQHEDRTPIHGYAATREAAMAAFAKSWRRE*
Ga0126370_1232355913300010358Tropical Forest SoilMRTLAFGHHKDRTPTHGYEPTRDAAMAAFAKSWRRE*
Ga0126376_1018357813300010359Tropical Forest SoilMWAPAFGHYEDRTPTHDYEPTRAAAMAAFAKSWRREQF*
Ga0126376_1025363513300010359Tropical Forest SoilSPGGTPRMWTLAFGHHEDRTPTHCSQRTREAPMAAFAKSWRRE*
Ga0126376_1034833313300010359Tropical Forest SoilAPQGKRWLWTLAFWHHEDRTPTRGYELTLEAAMATFAKSWWRK*
Ga0126376_1056714423300010359Tropical Forest SoilMWTLAFAHHEDRMPTHGYAATREAAMTAFAKGLRRE*
Ga0126376_1108539313300010359Tropical Forest SoilILQTEAAPVASTFMWSLALAQQEERTPTHGYAESREAAMAAFAKSWRRE*
Ga0126376_1245498723300010359Tropical Forest SoilPVGMPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRRD*
Ga0126376_1311465123300010359Tropical Forest SoilPIGTPWLWTLAFGHHEDRTPIYGYEPTREAAMAAFAKSWRRE*
Ga0126376_1326665523300010359Tropical Forest SoilAAPVGTPWFWTLAYSHLEDRTPTHGYQATREAAMAAFAKSWRRE*
Ga0126372_1044558213300010360Tropical Forest SoilTPWLWTLTFGQHEDRTPTHSYEATREAAMAAFAKSWRRE*
Ga0126372_1078360113300010360Tropical Forest SoilPGGTPWMWTLAFGHHEDRMPTPGFAATREAAMAAFAKSWRWG*
Ga0126372_1079967113300010360Tropical Forest SoilMWTLAFGYHEDRTTMHGYGPTREAAMAAFAKSWRRQ*
Ga0126372_1088955923300010360Tropical Forest SoilGSSWMWTLVFWHHEDRTPTHGYEATREAAMAAFAKSWRPQ*
Ga0126372_1120195033300010360Tropical Forest SoilPVGSPWMWTLAFGQHEDRTPTHGYEPTREAAMAAFAKSWPRE*
Ga0126372_1133872133300010360Tropical Forest SoilMWTLMFGYHEDRTPTHGYAESREAAMAAFAKSWRRE*
Ga0126372_1138763713300010360Tropical Forest SoilMWTLAFGHHEDRTPTHGYQPTREGAMAAFAKSWPRE*
Ga0126372_1187071313300010360Tropical Forest SoilMSTLAFGNHEDRTPTHGYAATREDAMAAFAKGSRRE*
Ga0126372_1202696833300010360Tropical Forest SoilWLWTLGYSRHKDRTPIYGYEPTREAAMAAFAKSWRRE*
Ga0126372_1245529113300010360Tropical Forest SoilMWILAFGHLEDRTRTHGYEATREAAMATFAKSWRRQ*
Ga0126372_1274444013300010360Tropical Forest SoilMWTLAVGYHEDRTPTHGYEPTREAAMAAFVKPWRRE*
Ga0126372_1300891313300010360Tropical Forest SoilTPRQQERHGTLAFGHHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0126372_1328710823300010360Tropical Forest SoilMRRPVPVGMSWLWTLAFGYHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0126378_1088273423300010361Tropical Forest SoilAPVGMPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFAESWRRE*
Ga0126378_1141020923300010361Tropical Forest SoilMWRLTFGHHEDRTPTHGYEPTREAAMAAFAKSWRRE*
Ga0126378_1150429933300010361Tropical Forest SoilMWTLAYGHHEDRTPTHGYEPTRKAAMAAFAKSWRRQ*
Ga0126378_1155622823300010361Tropical Forest SoilMWTLMFGYHEDRTPTHGYEPTREAAMSAFAKSWRRE*
Ga0126378_1227969623300010361Tropical Forest SoilPEGTPWMWTLAFGHHEDRTPTYGYAASRETAMAAFAESWRRE*
Ga0126378_1238356923300010361Tropical Forest SoilMWTLACEHHEDRTPTHGYAATREAAMAAVAKSWRRE*
Ga0126378_1242002813300010361Tropical Forest SoilGTPWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0126378_1251710523300010361Tropical Forest SoilMWTLAFGHHQDRTPTHGYEATREAAMAAFAKSWRRD*
Ga0126378_1262118613300010361Tropical Forest SoilPWMCTLAFGHHEDRTATHGYSATREAAMGAFAKSWRRK*
Ga0126378_1302041123300010361Tropical Forest SoilMTAAAPVGMPWLWTLAYGHHEDRWPTHGYEPTREAAMATFAKSWRRE*
Ga0126378_1328167323300010361Tropical Forest SoilMWTLAVGYHEDRTPTHGYEPTREAAMAAFAKSWQRE*
Ga0126377_1017048913300010362Tropical Forest SoilGSPWFWTLAFGYHRDRRPTHGYAATREAATAAFAKSWRRK*
Ga0126377_1030036143300010362Tropical Forest SoilTLAFGYHCDRRPTHGYAATREAAMAAFAKSWRRE*
Ga0126377_1030597233300010362Tropical Forest SoilAPVGSPWMWTLAFGHHEDRTPTHGYAETREAAMAAFAKSWR*
Ga0126377_1168260323300010362Tropical Forest SoilAPVGTPWLWTLAFGHHEDRTPTHGYAATREAAMAAFAKGWRRS*
Ga0126377_1293831623300010362Tropical Forest SoilWTLIYGYHEDRTPTHGYEPTRESAMAALTKSGRRE*
Ga0126377_1321897123300010362Tropical Forest SoilKAAAAPVGTPWMWTLAFGHHEDRTPTHGYAESREAAMTAFAKSWRRE*
Ga0126379_1060468033300010366Tropical Forest SoilMKAAAVPIGMSWMWTLAFGYHEDRTPTHGYGPTREAAMAAF
Ga0126379_1072931713300010366Tropical Forest SoilTLAFGHHEDRTPRHGYAATREAAMAAFAKSWRWE*
Ga0126379_1077892233300010366Tropical Forest SoilMPWMRTLLYDFYENRMPTHGYAATREAAMAAFAKSWRRE*
Ga0126379_1094403913300010366Tropical Forest SoilMWTLMFGYHEDRTPTRGYAATREDAMAAFAKSWRRE*
Ga0126379_1105641313300010366Tropical Forest SoilHAAPVGAPWMWTLAFGQHEDRTPTHGYAATREDAMAAFAKSWRSEQA*
Ga0126379_1148566813300010366Tropical Forest SoilCASGKPWMWTLLLGQYEDRTPTHGHEATREAAIAAFAKSWRRE*
Ga0126379_1151081423300010366Tropical Forest SoilWTLAFGHHEDRTPTHGYAQTREAAMAAFAKSWRRE*
Ga0126379_1156039613300010366Tropical Forest SoilPWLWTLAFCQHEDCTPTYGYEPTREAAMAALGKSWRRE*
Ga0126379_1198685013300010366Tropical Forest SoilWMWILTYRDQEDRTPTHGYKATREAAMAAFAKSWRRE*
Ga0126379_1339787713300010366Tropical Forest SoilPVGSPWLWTLAFGHHEDRTPRHGYAATREAAMAAFAKSWRRE*
Ga0126379_1367211223300010366Tropical Forest SoilAAPVGQPWLWTLAYGHHEDRTPTHGYEATRGAAMAAFAKS*
Ga0126381_10046338413300010376Tropical Forest SoilPWTWTLAFGHHEDRTPTHGYAESHEEAMAAFAKSWRRE*
Ga0126381_10101917313300010376Tropical Forest SoilMWTLAFGYHEDRTPTHGYAATREAAMVAFAKSWRREEF*
Ga0126381_10127818323300010376Tropical Forest SoilKAHAAPAGSPWMWTLMFGHHEDRTPTHGYEPTREAAMAAFAKSWRRG*
Ga0126381_10201002913300010376Tropical Forest SoilPVGMPWLWTLAYGHHEDRTPIYGYEPTREEAMTAFAKSWRRK*
Ga0126381_10306661413300010376Tropical Forest SoilVGTPWAWTLAFGHHEDRTPICGYEPTRKAAMAAFAKSWRRE*
Ga0126381_10309096333300010376Tropical Forest SoilGPVGSPWMWTLMVGYEDRTPTHGYEPTREAAMAAFAKSWRRQE*
Ga0126381_10372744413300010376Tropical Forest SoilAAVPAGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWQRE*
Ga0126381_10379149513300010376Tropical Forest SoilKSLAAPAGMPWLWALAFGHYEGRHPTHGYAATREDAMTAFAKSWRRG*
Ga0126381_10398962713300010376Tropical Forest SoilMWTLAFGHHQDRTPTQGYEATREAAMAAFAKSWRRD*
Ga0126381_10410079023300010376Tropical Forest SoilMWTLAFGHHEDRRPIHGYEATREAAMAAFSKGLRRG*
Ga0126381_10481288213300010376Tropical Forest SoilAPVGTPWMWTLAFGHHEDRWPTHGYEPTREAAMAAFAKSWRRE*
Ga0126381_10498503323300010376Tropical Forest SoilMPWLWALTFGHYEGRHPTRGYAATREAAMAAFAKSWRRQ*
Ga0126383_1007578913300010398Tropical Forest SoilMWTLAFGHHEDRTPPHGYEATREAAMAAFAKSWRRE*
Ga0126383_1014608323300010398Tropical Forest SoilVPRLWTLAYGHHEDRTPMHGYEATRKAAMGAFAKSWRRE*
Ga0126383_1029060433300010398Tropical Forest SoilVPAGMSWMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE*
Ga0126383_1039400423300010398Tropical Forest SoilMLAFGYHEDRTPTHGYAESREAAMAAFAKSWRRE*
Ga0126383_1049662433300010398Tropical Forest SoilMWTLAFWHYEDRTPTHGYEAMREAAMAAFAKSWRRE*
Ga0126383_1070288333300010398Tropical Forest SoilLTWTLAFGQHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0126383_1075317613300010398Tropical Forest SoilLGAPVGQPLLWTLAYGYHEDRTPTHGYGATREAAMAAFARSRRRE*
Ga0126383_1103601513300010398Tropical Forest SoilMWALAFGHHEDRTPTHGYAATRETAMAAFAKSWRRE*
Ga0126383_1116633213300010398Tropical Forest SoilMKAAAAPVGTPWMWTMLFNYRWPTHGYEPTREAAMAAFA
Ga0126383_1127239223300010398Tropical Forest SoilMWTAFGHHEDRTPTHGYAETREAAMAAFAKTWRRI*
Ga0126383_1128056133300010398Tropical Forest SoilAPVGTPWMWTLAFGHHEDRTPTHGYAESREAAMTAFAKSWRRE*
Ga0126383_1158182213300010398Tropical Forest SoilTPWLWTLAYGHHGERKPTHGYEPTREAAMAAFAKSWRRE*
Ga0126383_1161709713300010398Tropical Forest SoilIIHLEHHKDRTRTHGYEPTREAAMAAFAKTWRRE*
Ga0126383_1163131613300010398Tropical Forest SoilAAPVGSPWMWTLDFWHYEDRMPTHGYAATREAAMTAFAKSWRRE*
Ga0126383_1167115213300010398Tropical Forest SoilMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRR
Ga0126383_1185511013300010398Tropical Forest SoilMWTLTFGHREDRTPTHGHEPTREATMAAFAKGWRRQYF*
Ga0126383_1191988913300010398Tropical Forest SoilPLAYGHHEDRWPMHGYESTREEAMTAFAKSWRRQWPR*
Ga0126383_1215399413300010398Tropical Forest SoilSPWLWTLGYSRHKDRTPIYGYEATRDAAMAAFAKSWRRE*
Ga0126383_1247468713300010398Tropical Forest SoilMWTLAFWHHEDRTPTHGYAETREAAMAAFAKSWRLE*
Ga0126383_1282527523300010398Tropical Forest SoilGMPWIWTLIFGYHEDRSPPHEATREAAMAAFAKSWRWER*
Ga0126383_1283820113300010398Tropical Forest SoilWTLGHHEDRTPTHGYAATREAAMAAFAKSWRTKPV*
Ga0126383_1351593013300010398Tropical Forest SoilLAVPDSVHEDGTPTHGYEPTREAAMAAFAKSWRRE
Ga0124850_104838043300010863Tropical Forest SoilANAAPVDEPWLRTLAFGHHEDRTPTHGYEATREEAMAAFAKSWRRE*
Ga0124850_110251513300010863Tropical Forest SoilAGAQACTPTHGYEATREAAMAAFATSWRRDSSVL*
Ga0124844_124898913300010868Tropical Forest SoilKVRVGGRTPWMWTLALGHHEDRTPTHGYAATRAAAMAAFAKSWRRE*
Ga0137392_1024845713300011269Vadose Zone SoilFRTLAYGYHYDCTPIHGYEATREAAMAAFAKSWRRE*
Ga0137393_1013412213300011271Vadose Zone SoilHAAPIGTPWMWTLAFGQHEDRTPMHGYEATREAAMAAFARSWWRE*
Ga0137383_1024924713300012199Vadose Zone SoilAAPVGQPWLWTLAYGYHEDRTPTHGYEPTREAAMTAFAKSWRRE*
Ga0137383_1030085433300012199Vadose Zone SoilMPWMWTLGFGYHEDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0137383_1079052013300012199Vadose Zone SoilHQSAHHWMWTLAYGYHEDRTPTHGYEATREGVISAFAKSWLRE*
Ga0137383_1111243723300012199Vadose Zone SoilEGKPWMWTVLISHHEDRTGYEPTREAAMAAFVKSWRRE*
Ga0137383_1113551813300012199Vadose Zone SoilASPVGASWMWTLAFGYHEDRTPTHGYATREAAMAAFAKSWRRE*
Ga0137382_1015143143300012200Vadose Zone SoilMKVHAAAPVGTPWMWTFAFGQHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0137382_1063247813300012200Vadose Zone SoilMWTLAFWRHEDRTPTQGYEATREAAMQAFVRSWHRET*
Ga0137365_1011360253300012201Vadose Zone SoilAPVGTPWMWTLAFGQHEDRTPTHGYEATREAAMAAFAKSWRGRP*
Ga0137365_1073894113300012201Vadose Zone SoilGRIFKTSTSPAGTPWMWTLSYAERGVHGYEATREAAMAAFEKSWQRQ*
Ga0137365_1113879713300012201Vadose Zone SoilMWTLIFDYHEDRTPTHGYEATREAAMAAFAKSWRREN*
Ga0137363_1064060913300012202Vadose Zone SoilMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0137363_1098432423300012202Vadose Zone SoilVDSPWLWTLAFGQHEDRTPTHGYEATREDAMAAMAAFAKSWRR
Ga0137363_1115668723300012202Vadose Zone SoilMGILAFGYHGDRTPTHGYELTREAAMAAFAKAWRREG*
Ga0137374_1071002713300012204Vadose Zone SoilMRILAFWHHEGRTPTRYAATREAAMAAFAKSWRRE*
Ga0137362_1045811533300012205Vadose Zone SoilVWTLAFGHHEDGTPTHGYAATRAVAMAAFAKSWRRE
Ga0137362_1093459423300012205Vadose Zone SoilMWTLDFGHHEDRTPTRGYEPTCDAAMAAFAKSWRRE*
Ga0137362_1129684023300012205Vadose Zone SoilMWTLIFGHHRTPTHGYEATREAAMAAFAKSWRRE*
Ga0137362_1158928223300012205Vadose Zone SoilWMWTLAFLVSRRIREPTHSYAETREAAMAAFAKSWRRE*
Ga0137380_1015251313300012206Vadose Zone SoilLAFGQHEDRTPTHGYAATREAAMAAFAKSWRRES*
Ga0137380_1022968753300012206Vadose Zone SoilWTLAFGHHEDRTPTHGYEATREAAMGAFAKSWRRV*
Ga0137376_1124974223300012208Vadose Zone SoilMWTLAFGHHEDRKPTHGYAATREAAMAAFAKSWRRE*
Ga0137379_1044306423300012209Vadose Zone SoilMWTLAFGHHEDRTPTHGYEPTREGAMAAFAKSWRRE*
Ga0137379_1177582513300012209Vadose Zone SoilAPVGMSWMWAHAFLRHEDRTPTHGYGAAREAAMAVFAKSWRRE*
Ga0137378_1094625433300012210Vadose Zone SoilPWLWTLAYGYHEDHTPTHGYEPTREAAMTAFARSWRRE*
Ga0150985_10084502113300012212Avena Fatua RhizosphereAAPVGSPWMWILAFGYHEDRSPTHGYAESREAAMAAFAKSWRRE*
Ga0150985_10436454513300012212Avena Fatua RhizosphereAQFPWVWTLTYGYHEDRTPTHGYEPTREAAMLAFARSWLRE*
Ga0137370_1003204913300012285Vadose Zone SoilMWTLAFGHHEDRTPAHGYAATREAAMEAFAKSWRRE*
Ga0137370_1054771033300012285Vadose Zone SoilWTLAFGHHEDRAPTHGYAATREHAMAAFANSWRRE*
Ga0137387_1040424823300012349Vadose Zone SoilPWTLAFGHHEDRTPTRGYEPTCDAAMAAFAKSWRRE*
Ga0137372_1025360923300012350Vadose Zone SoilMWTLAFGHHEDRTPTHGLEPMREAAMAAFAKSWRRE*
Ga0137366_1006891153300012354Vadose Zone SoilMWTLAYGDHEDRTPTHGYEATREAAMKAFAKSWRREN*
Ga0137366_1022790513300012354Vadose Zone SoilSPWFWTLAYGYHYDRRPTHGYATTREAAMAAFAKSWRRE*
Ga0137366_1064764623300012354Vadose Zone SoilVNAAPIGMPWMWTLAFAHHEVRTPTHGYAATREDAMAAFEKS*
Ga0137369_1033087133300012355Vadose Zone SoilMWTLAFGHHKDRSPTHGYEATREAAMTAFAKSWRQE*
Ga0137369_1076519313300012355Vadose Zone SoilKWTLAFGNHDRTPIHGYEATHEAAMVAFAKSWRRK*
Ga0137371_1002153443300012356Vadose Zone SoilMWTLDYLYHEDRTPTHGYAATREAAMIAFARGWRWQQAMAVADPR*
Ga0137371_1049892813300012356Vadose Zone SoilMWTLAFGHHEDRTPTHGYEAVREAAMAAFAKSWRRE*
Ga0137384_1037226813300012357Vadose Zone SoilSWMWTLDFWHHEDRTPTHGYTATREDAMAAFARSWRRE*
Ga0137384_1038643123300012357Vadose Zone SoilWMWTLAFGHHEDRSPTHGYEATREAAMAAFAKSWRREMI*
Ga0137385_1061060423300012359Vadose Zone SoilMWTLAFGHHEERAPTRGYAATREAAMAAFAKRWRRE*
Ga0137375_1034111143300012360Vadose Zone SoilVGASWMWTLDFWHHEDRTPTHGYAATRETAMAAFAKSWPVPLKAR*
Ga0137375_1113713013300012360Vadose Zone SoilIMKAAAVPVGMSWMWTLGYGYHEDRTPIHGYAATREDAMTAFVKSWRRE*
Ga0137360_1021762853300012361Vadose Zone SoilAAPVGTPWMWTLLFGQHEDRTPTHGHEATREAAMAAFAKSWRRE*
Ga0137360_1062766323300012361Vadose Zone SoilMWTLIFGYHEDRTRTHGYEATREAAMAAFAKSWRKD*
Ga0137361_1013360723300012362Vadose Zone SoilMTLACGHHEDRTPTQGYEATREAAMTAFAKRWRRE*
Ga0137361_1049556923300012362Vadose Zone SoilMWTLAFGQHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0137361_1052765313300012362Vadose Zone SoilVRTTDDWTLAFGHHEDRTPIHGYEPTREAAMAAFAKSWRRE*
Ga0137361_1076710913300012362Vadose Zone SoilMWALAFGHHEDRTPTHGYAPTREAAMAAFAKSSRRE*
Ga0150984_11615230813300012469Avena Fatua RhizosphereAPAETPWVWSLAYGQHEDRTPTHGREATREAAMQAFARSWHRET*
Ga0137373_1093189933300012532Vadose Zone SoilMWTLAYGYHEDRNPMHGYEPTREAAMAAPAWRGL*
Ga0137395_1047659323300012917Vadose Zone SoilTLAYGYHEDRTPTHGYEPTREAAMAAFAKSWRRE*
Ga0137396_1010540713300012918Vadose Zone SoilMKAAAAPVGTPWMWTLAFGQHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0137359_1059273423300012923Vadose Zone SoilMAWLWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0137359_1086888413300012923Vadose Zone SoilMLTFAFGHHEDRTPTHGYEPTREAAMAPFAKSWRRG*
Ga0137407_1090653623300012930Vadose Zone SoilAAPEGTPWMWTLAFGHHEDRTQTHGYTATRVAAVAAFAKSWRRE*
Ga0126375_1014087533300012948Tropical Forest SoilMWTLAFGHYEDRTPMHGYAATREAAMTAFAKSWRRE*
Ga0126375_1041112033300012948Tropical Forest SoilGSPWFWTLAFGYHRDRRPTHGYAATREAAMAAFAKSWRRE*
Ga0126375_1079547723300012948Tropical Forest SoilMWTLAFGQHEDRMPTHGYAAPREAAMAAFAKSWRRE*
Ga0164300_1071981013300012951SoilMWTLAFGHHEDRTPTHGYVATRETVMAALAKSWRRE*
Ga0164300_1100066123300012951SoilRTPWMWTLASGHHKDRTPTHGYEATREAAMAAFAKSWRRE*
Ga0164299_1055259013300012958SoilMWTFIFPHYESRSPTHGYAETREAAMAAFAKSWRWE*
Ga0164301_1107954923300012960SoilMKAAAVPVGMSWMWTLMFGHHEDRTPTHGYEATREAAMAAFAKRWRRE*
Ga0126369_1008413013300012971Tropical Forest SoilMDKAFGYHEDPTPTHGYEPTRKAAMAAFAKSWRREQ*
Ga0126369_1015870233300012971Tropical Forest SoilMPWLWTLAFGHHEDRTPTHGYEPTREAAMVAFAKSRRRE*
Ga0126369_1035782443300012971Tropical Forest SoilMWTLAFGYHEDGTPSHGYAATREAAMAAFAKSWRRE*
Ga0126369_1092924213300012971Tropical Forest SoilMWTLMFGHHEDRTPTHGYAATRKAAMAAFAKSWRRE*
Ga0126369_1104881323300012971Tropical Forest SoilWLWALAFGHYEGRHPTRGYAATREAAMVALAKSWRRE*
Ga0126369_1154138733300012971Tropical Forest SoilVRMSWMWTLAFGHHDDRTPAHGYAATREAAMAAFAKSWRHE*
Ga0126369_1159285813300012971Tropical Forest SoilPRMWTLAFGHHEDRTPTHGYESTREAAMAAFAKSWRRE*
Ga0126369_1192368323300012971Tropical Forest SoilWLWTLAFGHHEDRWPTHGYEPTREAAMATFAKSWRREEF*
Ga0126369_1361674513300012971Tropical Forest SoilMWTLAFGHHEDRTPTHGYAATREAAMAGLAKSWRRA*
Ga0126369_1366969723300012971Tropical Forest SoilWLWTLAYGHHEDRTPTHDYAVTREDAMTAFAKSWRRE*
Ga0134087_1038216813300012977Grasslands SoilMWTLAFGHHEDRAPTHGYAATREDAMAAFAKTWRRE*
Ga0164309_1080793913300012984SoilMKAAAVPVGRSWMWTLAFDHDEDRRPTHGYEPTREAAMAAFA
Ga0164308_1126299813300012985SoilKVNASPVGTPWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE*
Ga0164307_1076045223300012987SoilWTPAFDYHDDRTPTHGYEPTREGAMAAFAKSWRRG*
Ga0164305_1097305123300012989SoilAIRWTLIFLHHEGRSPTHGYEATREATMTAFAKSWRRE*
Ga0164305_1216399813300012989SoilMWTLGIEYHKDRTPTHGYAATRLAAMAAFAKSWRRES*
Ga0157371_1071468223300013102Corn RhizosphereGSPWLWTLAYGHHEDRTPTHGYEATREGAMAAFARSWRRE*
Ga0157378_1233367513300013297Miscanthus RhizospherePWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRG*
Ga0163162_1246161423300013306Switchgrass RhizosphereAASPWVWALSYDYHEDRTPTHGYAATRDAALHAFARSWNRET*
Ga0157375_1278023923300013308Miscanthus RhizosphereMMFADTPAGKPWMWTLAYGQDEGRTPTHGYEPTREAAMEAFARSWNRE*
Ga0182000_1021326513300014487SoilRLAWMWTLAFGHHGDRTPTHRYAASREAAMAAFAKSWRRE*
Ga0157377_1128697413300014745Miscanthus RhizosphereKANTSPVGTPWMWTVSYGFHEDHTPTHGYEATLEAAMAAFAKSWRRE*
Ga0132258_1121907513300015371Arabidopsis RhizosphereRSKEVAPSYGYHEDRTPAHGYGPTREAAMAAFAKSWRRE*
Ga0132258_1340234223300015371Arabidopsis RhizosphereMWTLAFGHHEDRTPTHGYESTRKAAMAAFAKSWRRE*
Ga0132255_10536052423300015374Arabidopsis RhizosphereMAPRLATGDHDDRTPAHGYAATREAAMAAFANSWRRE*
Ga0182036_1024768113300016270SoilGSPWIWTLAFGHHEDRTPPRGYAAARETAISAFAKSWRRE
Ga0182036_1043511213300016270SoilAPLGTPWMWTLAFGHHEDRWPTHGYEPTREAAMTAFAKSWRRQWPR
Ga0182036_1053601423300016270SoilLKSAAAPVGMPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFANSWRRE
Ga0182036_1059889233300016270SoilQPWLWTLAYGYREDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0182036_1147292213300016270SoilAAPVGTPWMWTLAFGHHEDRWPTHGYEPTREAAMATFAKSWRRQWPR
Ga0182036_1151336423300016270SoilMWTLAFGYHEDRTPTHGYEPTREAAMAAFAKSWRTG
Ga0182036_1181693513300016270SoilQLSEIAARVGTPWLWTLAFSQHEDRTPTHGYEPTREAAMTAFAKSWRRE
Ga0182041_1011379413300016294SoilMWTLAFGHHEDRAPSHGYEPTREAAMAAFAKSWRR
Ga0182041_1107839213300016294SoilAAPVGTPWMWTLAFGQHEDRTPTHGYAATREAAMAGFVKNWRRE
Ga0182041_1155601833300016294SoilWTLAFGHHEHRTPTHGYAATREAAMAAFAKSWRREQTS
Ga0182041_1204330213300016294SoilMWTLAFGHHEDRRPTHCYKPTREAAMAAFGKRWRR
Ga0182033_1007020313300016319SoilPEGSPWMWTLAFGHHEDRTPTHGYEATREAAMAAFAKSWRRGSSKIGR
Ga0182033_1037405633300016319SoilSSRSTPVGTPWLWTLAFGQHEDRMPTHGYEPTREAAMAAFAKSWRRT
Ga0182033_1080864813300016319SoilANAAPVDEPWLWTLAFGHHEDRTPTHGYAATREATMAASAKSWRRE
Ga0182035_1007385543300016341SoilGSPWMWTLAFGHREDRTPTHGDEPTREAAMAAFAKRWRRE
Ga0182035_1032143233300016341SoilWMWKLAFGYHEDRTPTHGYAATREATMAAFAKSWRRESF
Ga0182035_1085129913300016341SoilWMWTLAFGHQKDRTPTHGYAATREAAMTAFAKSWRRE
Ga0182035_1117828313300016341SoilWMWTLAFGHHEDRKPTQGCEPTREAAMAAFAKSWRRE
Ga0182032_1012564733300016357SoilMWTLVFGEHENRTPTHGYEATREAAMAAFAKSWRRD
Ga0182032_1025030933300016357SoilGSPWMWTLAFGHHEDRTPTHGYEATRDAAMAAFAKNWRRE
Ga0182032_1119083913300016357SoilAAPEGSPWMWTLAFGHREDRTPTHGYEPTREAAMAAFAKRWRREEF
Ga0182032_1164548623300016357SoilVGMPWLWTLAYGHHEDRTPIYGYEPTREAAMAPFAESWRRE
Ga0182032_1175450023300016357SoilVGMPWLWTLAYGHHEDRTPIYGYEPTRDAAMAAFAKSWRRE
Ga0182034_1019171113300016371SoilMWTLAFGHHEDRTPTHGYEATRESAMAAFAKSWRREEKRRAR
Ga0182034_1033935933300016371SoilMWTLAFGHREDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0182034_1084094323300016371SoilMWMLVFGHHEDRTPTHGYEPTREGAMAAFAKSWRGNKLQ
Ga0182034_1170291913300016371SoilSPWMWTLAFGQHEDRTPTHGYAATREAAMTAFAKSWRRG
Ga0182034_1170531913300016371SoilTPWFWTLAYAHLEDRTPTHGYESTREHAMATFAKSWRRE
Ga0182040_1023852913300016387SoilLAFGYHEDRTPTHGYAATREATMAAFAKSWRRESF
Ga0182040_1025608533300016387SoilAPVAAPWMWTLAFGHHEDRTPIYGNEPTREAAMAAFAKSWRRE
Ga0182040_1064366043300016387SoilSPVDAPWLWTLAFGHHEDRTPTHGYAETREAAMAAFAKSWRRG
Ga0182040_1101634023300016387SoilAPVGQPWIWTVAFGHHEDRTPTHGYAATREDAMAAFSRSWRRE
Ga0182040_1117785133300016387SoilGQPRLWRLAFWQHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0182040_1124824423300016387SoilMRTLAFEHHEDRAPTYSHAATREAAMPAFAKSWRRE
Ga0182037_1013265143300016404SoilAAGPVGMPWLWTLAYGHHEDRTPIYGHEPTREAAMEAFAKSWRRG
Ga0182037_1076655513300016404SoilPWLWTLAFGHHEDRTPTHGYAETREAAMAAFAKSWRRG
Ga0182037_1079640623300016404SoilWMWTLAFGQHEDRTPTHGYAATREAAMTAFAKSWRRE
Ga0182037_1105942413300016404SoilSAAAPVGMPWLWTLAYGHHEDRTPIYGYEPTREAAMAPFAESWRRE
Ga0182037_1120645423300016404SoilEPWLWTLAFGQHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0182037_1128868623300016404SoilMSWLWTLAFGYHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0182039_1024310033300016422SoilPVGMSWMWKLAFGYHEDRTPTHGYAATREATMAAFAKSWRRESF
Ga0182039_1053729913300016422SoilMKVHAAPEGSPWMWTLAFGHHEDRTPTHGYEATREAAMAAFAKSWR
Ga0182039_1064156613300016422SoilMPWLWTLAYGHHEDRTPIYGYEPTRDAAMAAFAKSWRRE
Ga0182039_1192420613300016422SoilKVHAAPAGSPWMWTLAFGHHEDRTPTHGYAATREEAMAAFAKSWRRE
Ga0182038_1009977433300016445SoilPVGTPWFWTLAYAHLEDRTPTHGYEATREAAMAAFAKSWRRE
Ga0182038_1112151923300016445SoilWTLAFGHHEDRTPAHGYAATREAAMAAFAKSWRRR
Ga0184604_1034389423300018000Groundwater SedimentPADGGQWMWTLAYGQYEDPRGFEPTREDAMKAFARSWHRETSRLL
Ga0184617_116135723300018066Groundwater SedimentPWVWTLTYGYHEDRTPTHGYEPTREAAMQAFAKSWHRET
Ga0184611_128544723300018067Groundwater SedimentMWTVSYGFHEDHTPTHGYKPTREAAMVAFAKSWRRE
Ga0184618_1020530623300018071Groundwater SedimentPADGGQWMWTLAYGQYEDRTPTRGFEPTREDAMKAFARSWHRETSRLL
Ga0184624_1028506523300018073Groundwater SedimentMWTVSYGFHEDHTPTHGYKPTREAAMAAFAKSWRRK
Ga0066655_1002637853300018431Grasslands SoilMWTLAFGHHEDRTPIHGYEPTRKAAMAAFAKSWRRE
Ga0066667_1026812213300018433Grasslands SoilMWTLAFGHHEDRTPTRGYAESREAAMAAFAKSWRRE
Ga0066667_1160804413300018433Grasslands SoilPVGMSWMWTLAFGHHEDRAKTHGYAATREAAMAAFAKSWRHE
Ga0066667_1173474323300018433Grasslands SoilMKAAVVPVGQSWMWTLAFGHHEDRTPTHGHAATREAAMAAFAKS
Ga0190270_1203924723300018469SoilWTLTYGYHEDRTPTHGYEPTREAAMLAFAKSWHRDT
Ga0066669_1010951033300018482Grasslands SoilMWTLAFGHHEDRTPIHGYEPTREAAMAAFAKSWRRE
Ga0210407_1016429033300020579SoilPWMWTLAFGYHRDRAPNHGYTATREAAMAAFAKSWRRE
Ga0210403_1003848323300020580SoilMWTLAFGYHRDRAPNHGYTATREAAMAAFAKSWRRE
Ga0210403_1096944323300020580SoilNANAAPVGSPWMWTLAFGHHEDRTPTHGYAATREAAMAEFAKSWRRE
Ga0210403_1130795813300020580SoilMWTLAFGHHEDRAPTHGYAASREAAMAEFAKSWRREMY
Ga0210403_1151276313300020580SoilMIAAGVAFGHHEDRTPTHGYEPTREAAMAAFAKSWRLE
Ga0210404_1041969313300021088SoilSPWMWTLAFGYHRDRAPNHGYTATREAAMAAFAKSWRRE
Ga0210404_1056062623300021088SoilMLTLAFGHHEDRTPTHGYEPTREAAMAAFAKSWRLE
Ga0210406_1016698323300021168SoilMWTLAFGHHEDRTPTHGYAATREAAMEAFAKSWRRK
Ga0210406_1030112513300021168SoilAAAVPLGTPRLWTLVCGQHEDRTPTHGYEATREAAMAGFAKSWRRE
Ga0210406_1134202923300021168SoilRVGGRTPWMWTLASGHHKDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0210408_1031285223300021178SoilMWTLAFGQHEDRTPTHGYAAAREAAMTAFAKSWRRE
Ga0210384_1075790813300021432SoilMLALAFGYHEDRTPTHGYAATREGVMAAFAKSWGRK
Ga0210384_1077641323300021432SoilTPWMWTLAFGQHEDRTPTHGYAAAREAAMTAFAKSWRRE
Ga0210392_1127115413300021475SoilMWTLGIEYHKDRTPTHGYAATRLAAMAAFAKSCRR
Ga0210392_1143275613300021475SoilPVGTPWMWTFIFPHYESRSPTHGYAETREAAMAAFAKSWRWE
Ga0210402_1084931713300021478SoilWTLAFGHHEDRTPTHGYAESREAAMAAFAKSWRRE
Ga0210402_1095451233300021478SoilGHHEDRTPTHGYEATREAAMAAFATAMAAFAKSWRRE
Ga0210402_1111075023300021478SoilMWMLAFGYHEDRTPTHGYEATREAAMAAFAKSWRRE
Ga0210409_1132931013300021559SoilMLTLAFGHHEDRTPMHGYEPTREAAMAAFAKSWRLE
Ga0126371_1023995023300021560Tropical Forest SoilMWTLAVGYHEDRTPTHGYEPTREAAMAAFVKPWRRE
Ga0126371_1033132913300021560Tropical Forest SoilMWTLIFPHREGRSPTHGYEASREAAIAAFAKSWRRE
Ga0126371_1059865223300021560Tropical Forest SoilMWTLGFGHHEDRTPTHGYAETREAAMAAFAKSWRGE
Ga0126371_1092673113300021560Tropical Forest SoilMKSAAAPVGMPWLWTLAYGHHEDRTPIHGYAATRKAAMAAFAKSWRRE
Ga0126371_1099609213300021560Tropical Forest SoilQPWLWTLASGHHEDRSPIYGYAATREAAMAAFAKSWRRE
Ga0126371_1146703123300021560Tropical Forest SoilWMWTLIFPHQEGRTPTHGYAATRDAAMAAFAKSWRRA
Ga0126371_1157475823300021560Tropical Forest SoilAAPVGQPWLWTLAYGHHEDRTPTHGYVATRGAAMAAFAKS
Ga0126371_1185847913300021560Tropical Forest SoilMWTLAFGQHEDRTPTHGYTASREDAMAAFAKSWRRE
Ga0126371_1363499213300021560Tropical Forest SoilTLIFEHHEDRTPTHGYAATREAAMAAFAKSWRRELGPGGAG
Ga0126371_1372135513300021560Tropical Forest SoilMWTMAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0193698_105376123300021968SoilRVARWTLTYGYHEDRTPTHGYEPTREAAMQAFAKSWHRET
Ga0242662_1026760923300022533SoilMWTLALWGHEDRTPTQGYEATREAAMQAFVRSWHRET
Ga0207692_1005383213300025898Corn, Switchgrass And Miscanthus RhizosphereKANAAPVGSPWMWTLAFGHHEDRTPTHGYVATRETVMAALAKSWRRE
Ga0207692_1055426713300025898Corn, Switchgrass And Miscanthus RhizosphereWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0207685_1011363013300025905Corn, Switchgrass And Miscanthus RhizospherePWMWTLASGHHKDRTPTHGYEATREAAMAAFAKSWRRE
Ga0207684_1000446773300025910Corn, Switchgrass And Miscanthus RhizosphereMWTLGFGHHEDRTPTHGYEATREAAMAAFAKTWRKE
Ga0207684_1010551823300025910Corn, Switchgrass And Miscanthus RhizosphereMWSLDFWHHEDRTPTHGYEPTREAAMAAFAKSWRRQ
Ga0207684_1092703213300025910Corn, Switchgrass And Miscanthus RhizosphereMRTLAFGHHEDRTPTYGYAVSREAAMAAFSKSWRRE
Ga0207684_1121342713300025910Corn, Switchgrass And Miscanthus RhizosphereMWTLAFGYHEDRTPTHGYAESREAAMGAFAKSWRRE
Ga0207693_1001891523300025915Corn, Switchgrass And Miscanthus RhizosphereMWAHAFLHHEDRTPTHGYEATREAAMAAFAKSWRRK
Ga0207693_1040437123300025915Corn, Switchgrass And Miscanthus RhizosphereCRKPWMWALAFGYHRDRAPNHGYTATREAAMAAFAKSWRRE
Ga0207693_1069565623300025915Corn, Switchgrass And Miscanthus RhizosphereTPWMWTLAFGHHEDRTPTHGYAATREAAMSAFAKSWRRE
Ga0207663_1054740823300025916Corn, Switchgrass And Miscanthus RhizosphereMWTLSFGHHEDRTPTHGYAATRETAMAAFAKSWRRE
Ga0207663_1110882623300025916Corn, Switchgrass And Miscanthus RhizosphereVGTSWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0207646_1010159733300025922Corn, Switchgrass And Miscanthus RhizosphereMWTLAFGHHEDRAPTRGYAATREDAMAAFAKSWQRE
Ga0207646_1096068113300025922Corn, Switchgrass And Miscanthus RhizosphereVPVGMSWMWTLAFGHHEDRAKTHGYAATREAAMAAFAKSWRHE
Ga0207700_1076306213300025928Corn, Switchgrass And Miscanthus RhizospherePWMWTLAFGHHEDRTPTHGYAESREAAMAAFAKSWRRE
Ga0207704_1151721013300025938Miscanthus RhizosphereWMWTLASGHHKDRTPTHGYEATREAAMAAFAKSWRRE
Ga0209438_118800513300026285Grasslands SoilKSLAAPVGMPWLWALAFEHYKDHHPTHGYAATREAAMQAFARSWHRET
Ga0209240_105138623300026304Grasslands SoilMWALAFGHHEDRTPTHGYAPTREAAMAAFAKSSRRE
Ga0209688_106315223300026305SoilPWMWTLAFGHHEDRTATHGYAATREAAMAAFAKSWRRY
Ga0209154_121244223300026317SoilAAPVESPWMWTLAFGYHETARRRTATRQRGEAAMAAFAKSWQRE
Ga0209647_1004395123300026319Grasslands SoilMWTLAYEHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0209647_102520363300026319Grasslands SoilMWTLAYGQHEDRTPSYGHEPTREAAMVAFAKSWRRQ
Ga0209473_116342713300026330SoilGSPWMWTLIFPHHESRSPTHGYAESREAAMAAFAKSWRRE
Ga0257153_109052123300026490SoilMWTLAYGFHEDRTPTHGYEATREAAMAAFAKGWRRE
Ga0257156_102906923300026498SoilMWTLAFGHHEDRTPAHGYAATREAAMAAFAKSWRHE
Ga0209056_1014467943300026538SoilKVHAAPVGSPWMWTLAFGHHEDRAPTHGYAATREDAMAAFANSWRRE
Ga0209056_1047639123300026538SoilMWTLAFGHHEDRAPTHGYAATREDAMAAFAKSWRRE
Ga0209156_1032230913300026547SoilAAPVESPWMWTLIFPHHEDRTPTHGYAESRETAMAAFARSWRRE
Ga0209648_1034375513300026551Grasslands SoilGASWMWTLALGHHEDRTPTHGYAATREDAMAAFAKSWRRE
Ga0209577_1016710353300026552SoilPWMWTLDIGYHEHRSPTHGYAATREAAMAAFAKSWRHE
Ga0209577_1055352923300026552SoilMWTLIFPHQEGRSPTHGYEVTGENAMAAFAKSWRREF
Ga0209214_103133223300027071Forest SoilWMWTLAFGHHEDRTPTHGYAESREAAMAAFAKSWRRKKIA
Ga0209622_104947923300027502Forest SoilGSMLILKRALAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0209622_109041923300027502Forest SoilAVPVGMSWLWTLAFGYHEDRTPTHDGYEATREAAMAAFAKSWRRE
Ga0209684_105513023300027527Tropical Forest SoilWMWTLMFGYHEDRTPTHGYAETHEAAMAAFAKSWRRE
Ga0209523_109471533300027548Forest SoilRAAASPVDAPWLWTLAFGHHEDRTPTHGCEATREAAMAAFAKSWRRE
Ga0209180_1052590713300027846Vadose Zone SoilVGTPWMWTLAFGQHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0209465_1003038223300027874Tropical Forest SoilMWMLVFGHHEDRTPTHGYEPTREGAMAAFAKSWRRE
Ga0209382_1229877513300027909Populus RhizosphereNAAPVGSPWMWTLIFPHHEGHSPTHGYEGTREAAMAVFAKSWQRE
Ga0209526_1001838453300028047Forest SoilMWTLAFGHHEDRTPTHGYAATREAAMGAFAKSWRRE
Ga0209526_1003301353300028047Forest SoilMWTLAFEHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0209526_1029925823300028047Forest SoilLTRIFRALLFGQHEDRTPTHGHEATREAAMAAFAKSWRRE
Ga0209526_1081673613300028047Forest SoilMWTLAFGYHEDRTPTHGYGPTREAAMAAFAKSWRRE
Ga0307295_1010518523300028708SoilMWTLAYGYHKDRTPTHGYEPTREAAMAAFAKSWRM
Ga0307303_1008000113300028713SoilTLTYGYHEDRTPTHGYEPTREAAMQAFAKSWHRET
Ga0307309_1003573723300028714SoilVGTLTYGYHEDRTPTHGYEPTREAAMQAFAKSWHRET
Ga0307301_1001392813300028719SoilAPVEPPRMWTLAFGHHEDRTPTHGYEATREAAMQAFAKSWHRET
Ga0307317_1009701413300028720SoilWVWTVSYGYHEGRTPTHGYAESREAAMQAFAKGWHRE
Ga0307297_1019474413300028754SoilARWTLTYGYHEDRTPTHGYEPTREAAMQAFAKSWHRET
Ga0307280_1016743013300028768SoilPVGTPWMWTVSYGDHEDRTPTHGYEATREAAMAAFAKSWRRE
Ga0307290_1038975513300028791SoilLRPRVARWTLTYGYHEDRTPTHGYEPTREAAMQAFAKSWHRET
Ga0307305_1041072013300028807SoilPRVARWTLTYGYHEDRTPTHGYEPTREAAMQAFAKSWHRET
Ga0307310_1016231113300028824SoilVPVGLDLTYGYHEDRTPTHGYEPTREAAMQAFARSWHRET
Ga0307310_1039646713300028824SoilWMWTLAYGQYEEQTPNRGFEPTREDAMKAFARSWHRETSRLL
Ga0307278_1003523823300028878SoilMKAAARTPWLWTLGFRHHEDRAPTDDYEATREAAMAAFTTGWRRE
Ga0307278_1032502933300028878SoilMWTLIFDYHEGRSPTHGYEATREAAMAAFARSSRVTGGGAPT
Ga0307278_1034814023300028878SoilMAGTTRMHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0307278_1048521513300028878SoilWLWTLAFGQHEDRTPTHGYKATREDAMAAFAKSWRRELTHWGR
Ga0307304_1038462013300028885SoilWVWMLSYGHHEDRTPTHGYEATREAASHAFAKSWHRET
Ga0308200_115998023300030905SoilTLAYGFHEDRTPTHGYEATREAAMAAFAKGWRPEL
Ga0308196_103068123300030989SoilVGLDLTYGYHEDRTPTHGYEPTREAAMLAFAKSWHR
Ga0170824_11224895413300031231Forest SoilWTLAFGHHEDRTPTHGYTATREAAMAVFAKSWRRE
Ga0170824_11379171213300031231Forest SoilETPADGGQWMWTLAYGQDEDRTPTRGFEPTREDAMKAFARSWHRE
Ga0308194_1007579713300031421SoilGSPWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0318516_1000924143300031543SoilMWTLDFGHREGRTLTHGYEATREAAMAAFTKSWRQE
Ga0318516_1005692633300031543SoilLKSAAAPVGMPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0318516_1010376023300031543SoilMWTLAFGHHEDGTPTHGYAATREAAMTAFAKSWRRQ
Ga0318516_1010546123300031543SoilMWTLAFEYHEDRTPTHDYEATREAAMAAFAKSWRRE
Ga0318516_1011098333300031543SoilMWTLMFGHHDNRTPTHGYEPTREAAMAAFAKSWRRE
Ga0318516_1012777223300031543SoilMAVDADLYGYHEDRTPTHGYEATREAAMAAFAKSWRRQ
Ga0318516_1033601923300031543SoilMPWLWTLAYGHHEDRWPIYGYEPTCDAAMAAFAKSWRREMRNEPRRR
Ga0318516_1035813923300031543SoilRVSGPNMDKAFGYHEDPTPTHGYEPTRKAAMAAFAKSWRRE
Ga0318516_1081071233300031543SoilMWTLAFGYHEDRTPTHSHKPMREAAMAAFAKSWRRE
Ga0318534_1007385223300031544SoilMAVDADLYGYHEDRTPTHGSEATREAAMAAFAKSWRRQ
Ga0318534_1014088733300031544SoilMSWMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0318534_1032029613300031544SoilDTPWMWTLAFEHHENRTPTHGYEPTREAAMAAFAKSWRRES
Ga0318534_1056819023300031544SoilPVGSPWMWTLAFGYHEDRTPTHGYAETREAAMAAFAKSWRRD
Ga0318534_1088499813300031544SoilPLGMSWMWTLAFGYHEDRTPTHGYEPTCEAAMAAFAKSWRRE
Ga0318541_1000789743300031545SoilMWTLAFGHHEDRTPTHGYEATREAAMAAFAKSCGGS
Ga0318541_1002272233300031545SoilMWTLAFGQHEDRTPTHGYAETREAAMAAFAKSWRRE
Ga0318541_1003778713300031545SoilMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0318541_1004914023300031545SoilVPVGMSWMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0318541_1007662733300031545SoilMWTLVFGYYEDRTPTHGYAATREAAMSSFAKSWRRE
Ga0318541_1015797333300031545SoilMWTLAFGHHEDRTPTHGYQPTREAAMAAFAKSWRRE
Ga0318541_1020958113300031545SoilMWTLAVEHHEDRTPTHGYEPTREAAMAAFAESWRRE
Ga0318541_1027884613300031545SoilVGTPWFWTLAYAHLEDRTPTHGYESTREHAMATFAKSWRRE
Ga0318541_1030589833300031545SoilMWTLGFGHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0318541_1042862213300031545SoilIFDRTTLAYGHHEDRSPTHGYEPTREAAMAAFAKSWRND
Ga0318541_1056045513300031545SoilMLAKGNRMPAPVGSPWMWTLAFGQREYRTPRHGYAATREAAMAAFAKSWRRE
Ga0318541_1059589023300031545SoilVEVSWLWTLAFGHHEDRTPTHGYKPTREAAMAAFAKSWRRE
Ga0318541_1064587323300031545SoilMWTLMFGYHEDRTPTHGYAAMREDAMAAFAKSWRRE
Ga0318541_1073341813300031545SoilAVPVGMPWMWTLAYDYHEDRTLTHGYAATREDAMAAFAKSWRRE
Ga0318541_1074638113300031545SoilVLAMLLSPRVWTLAFGQHEDRSPTHGYAATREAAMAAFAKSWRRE
Ga0318538_1006629213300031546SoilMWTLAFGHHEDRWPIYGYEPTREAAMAAFARSWRRE
Ga0318538_1021545613300031546SoilMKAADVPVGMSWMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0318538_1032588413300031546SoilMWTLDFGYHEDRRPSHGYAATREAAMAAFAKSWRRE
Ga0318538_1042923223300031546SoilPWLWTLAYGHHEDRSPIYGYEATREAAMAAFAKSWRRE
Ga0318538_1059790413300031546SoilGGATAAPIGQPRLWRLAFWQHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0318528_1006255413300031561SoilPWMWTLAVGHHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318528_1015981223300031561SoilMWTLAFGHHENRTPTHGYEPTREAAMAAFAKSWRRES
Ga0318528_1020586513300031561SoilMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0318528_1020915313300031561SoilMWTLAFGHHEDRAPTDGYAATREAAMAAFAKSWRPE
Ga0318528_1023038133300031561SoilGHRGPVSQPWLWTLAYGYREDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0318528_1037538433300031561SoilMWTLAFEYHEDRTPTHDYEATREAAMAAFAKNWRRE
Ga0318528_1043361313300031561SoilMWKLAFGYHEDRTPTHGYAATREATMAAFAKSWRRESF
Ga0318528_1065752713300031561SoilSWMWALAFGYHEDRTPTHGYAATREAALVAFGRSWRRE
Ga0318573_1002749463300031564SoilMKVHAAPEGSPWMWTLGFGHHEDRTPTHGYEPTREAAMAAFAKSWRHE
Ga0318573_1024389023300031564SoilVDLAFGQHEDRTLTHGYAETREAAMAAFAKSWRREEF
Ga0318573_1030887723300031564SoilWLWTMAYGHHEDRSPIYGYEATREAAMAAFAKSWRRE
Ga0318573_1055510323300031564SoilVPLGMSWMWTLAFGYHEDRTPTHGYEPTCEAAMAAFAKSWRRE
Ga0318573_1075024123300031564SoilMWMLAFGHHEDRTPTHGYAATREDAMAAFAKSWASSDL
Ga0318515_1007101823300031572SoilMPWLWTLAYGHHEDRWPIYGYEPTCDAAMAAFAKSWRRQWPR
Ga0318515_1012214023300031572SoilLVVGRIMKAVAVPAGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWQRE
Ga0318515_1068780623300031572SoilVGITWMWTLAYGHHEDRTPIYGYEPTREAARAAFAKSWRRQ
Ga0310915_1001930843300031573SoilMSWMWTLAFGYYEDRTPTHGYAATREAAMSSFAKSWRRE
Ga0310915_1007617213300031573SoilSPWMWTLAFGYHEDRTPTHGNAATREAAMTAFAKSWRRE
Ga0310915_1007746613300031573SoilVSVAAPVGAPWLWTLAFGYHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0310915_1040918323300031573SoilMWTLAFGHREDRTPTHGYEPTREAAMAAFAKRWRREEF
Ga0310915_1051088723300031573SoilMWTLMFGYHEDRTPTRGYAAMREDAMAAFAKSWRRE
Ga0310915_1073498213300031573SoilAASVGSPWMWTLAFGHHEDCTPTHGYEAAREAAMAASAKSWRRES
Ga0310915_1076340113300031573SoilAAPVGSPWMWTLAFGYHQDRTPTHGYAATREDAMAAFAKGWRWE
Ga0310915_1119725823300031573SoilMWTLAFGHHEDRKPTHGYEPTREAAMAAFAKSWRRE
Ga0318555_1023635833300031640SoilGGATAAPIGQPWLWTLAFWQHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0318555_1052355113300031640SoilSWMWTLAFGYHEDRTPTHGYEATREAAMAAFAKSWRRG
Ga0318555_1081483623300031640SoilPWMWTLIFDYHEDHTPTHDYEATREAEMAAFAKSWRRE
Ga0318542_1027286423300031668SoilILKSAAGPVGMPWLWTLAYGHHEDRTPIYGHEPTREAAMEAFAKSWRRG
Ga0318542_1063517033300031668SoilAAPEGSPWMWTLAFGHHEDRTPTHGYDPTREAAMAAFAKSWRREQTS
Ga0318561_1005258623300031679SoilMWMLAFGHHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0318561_1021014613300031679SoilMQTLAFWHHEDQTPTHGYAATREAAMAAFAKSWRREWSFHP
Ga0318561_1028124923300031679SoilMWALAFGYHEDRTPTHGYAATREAALVAFGRSWRRE
Ga0318561_1065912623300031679SoilMWTLAFGHHEDRTPTHGYEPTREAAMAAFAKSWRR
Ga0318561_1075492713300031679SoilHAAPVGSPWMWTLAFGHHEDRTPTHGYEATRDAAMAAFAKNWRRE
Ga0318561_1079859013300031679SoilALVGQPWLWTLAYGYHEDRTPTHGYEATREAAMAAFAKSWRQE
Ga0318561_1083809613300031679SoilAAPIGQPWLWTLAYGHHEDRWPIYGYEPTREIVMAAFTKSWRREQF
Ga0318574_1017238023300031680SoilPVGTPWLWTLAYGHHEDRTPIYGYGATREAAMAAFARSWRRE
Ga0318574_1062767713300031680SoilMSRMWTLAFGHHEDRTPTHVYEPTREAAMAAFAAF
Ga0318572_1002466813300031681SoilKVHAAPEGSPWMWTLGFGHHEDRTPTHGYEPTREAAMAAFAKSWRHE
Ga0318572_1005540613300031681SoilAPVGTPWMWTLAFGHHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318572_1017387413300031681SoilVSVAAPVEAPWLWTLAFGYHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0318572_1062344023300031681SoilLWTLAYGYHEDRAPTHGYEATREAAMAAFAKSWRRK
Ga0318572_1077649723300031681SoilKGTPWMSTLAYGYHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0318560_1003446813300031682SoilMSWLWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0318560_1004942613300031682SoilARSSPWMWTLAFGYHEDRAPMHGYAETREAAMAAFAKSWRRK
Ga0318560_1006456033300031682SoilSWMWTLAYNYHEDRTPTHGHEPTREAAMAAFAKSWRRE
Ga0318560_1011091713300031682SoilMPWLWTLAYGHHEDRWPTYGYEPTRGAAMAAFAKSWRRE
Ga0318560_1058541513300031682SoilSWMWTLAFGYHEDRTPTHGYEPTCEAAMAAFAKSWRRE
Ga0318496_1006618013300031713SoilKANAAPLGSPWMWTLAFGQHEDRTPTHGYAETREAAMAAFAKSWRRE
Ga0318496_1027451913300031713SoilWMWTLMFGYHEDRMPTHGYAAAREAAMTAFAKSWRRE
Ga0318496_1054467613300031713SoilIKVHAAPVGSPWMWTLAFGHHEDRTPTHGYEPTREAAMAEFAKSWRRE
Ga0318496_1078075823300031713SoilLSARAASALWRAAAAPIGQPWLWTLAYGHHEGRWPIYCYEPTREAAMAAFAKSWRRE
Ga0306917_1006695423300031719SoilMRRPVPVGMSWLWTLAFGYHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0306917_1022252023300031719SoilPRQSGLAWTLTFGQPEDRTPTHGYEATRDAAMAAFAKSWRRE
Ga0306917_1028005733300031719SoilTWTLAYGHHEDRSPTHGYEPTREAAMAAFAKSWRND
Ga0306917_1104059013300031719SoilPAGSPWMWTLAFGHHEDRTPTHGYAATREEAMAAFAKSWRRE
Ga0306917_1114520913300031719SoilPWLWTLAFGHHEDRTPTHGYAATREATMAAFAKSWRRE
Ga0306917_1117819413300031719SoilMWTLAFGHHEDRTPTHGYKPTREAEMAAFAKSWRRE
Ga0306917_1141317013300031719SoilMWTLAFGHHEDRTPTAGYEPTREDAAVAFAKSWRR
Ga0318493_1083785513300031723SoilPPTPLAFGHHEDCTPTHGYEATREAAMAAFARSWRRE
Ga0318500_1057420913300031724SoilIYKSNAGTLAFWHHEGRNPTHGYAATREAAMAAFAKSWRRE
Ga0318500_1069120913300031724SoilVGMSWMWTLAFGHHEDRTPTHDHEQAREAAMAAFAKSWRRK
Ga0318500_1074434913300031724SoilGSPWMWTLMFGYHGDRTPTHGYAATREDAMAAFAKSWASSDL
Ga0307468_10256159913300031740Hardwood Forest SoilMWTLAYGQREDHTPTHGYELTREAAMAALAKSWRRS
Ga0306918_1016459863300031744SoilMSWMWTLAFGYHEDRTPTHGYEATREAAMAAFAKSWRRG
Ga0306918_1033512623300031744SoilMWTLAFGHHEDRTPTHGYAETRKAAMAAFAKSWRRE
Ga0306918_1040134813300031744SoilPVGQSWMWALAFGYHEDRTPTHGYAATREAALVAFGRSWRRE
Ga0306918_1075151123300031744SoilPWLWTLAFGQHEDRWPTHGYEPTREAAMAAFAKRWRREHAE
Ga0306918_1082516413300031744SoilWMWTLAFWHHEDRSPTHGYAATREAAMEAFAKSWRQE
Ga0306918_1155483413300031744SoilLWTLAFGHHEDRTPTHGYAETREAAMAAFAKSWRRG
Ga0318502_1036498223300031747SoilGRRAMALASGHHEDRMPTHGYTATREAAMVAFAKSWRRE
Ga0318502_1076979613300031747SoilMWTVLFGYHEDRTPTHGYAASREAAMAAFAKSWRRE
Ga0318492_1040742013300031748SoilTIWPSSQHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318494_1053726713300031751SoilLWTLAFGHHEDRTSTHRYTATREAAMAAFAKSWRRE
Ga0318494_1071716413300031751SoilWTLVYGYHYDCTPIHGYEARREAAMAAFAKSWRRE
Ga0318537_1006448933300031763SoilPVGMSWMWTLAFGYHEDRTPTHGYEATREAAMAAFAKSWRRG
Ga0318537_1012017033300031763SoilAPVGSPWMWTLMFGYHEDRSPTHGYAATREAAMAAFAKSWRRE
Ga0318537_1028247613300031763SoilVGTPWIWTLAFGHHEDHTPTHRYEATREAAMAAFAKSWRRE
Ga0318535_1007351543300031764SoilPWMWTLAFGHHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318535_1011957113300031764SoilFWTLAYGYHYDCTPIHGYEATREAAMAAFAKSWRRE
Ga0318535_1024685233300031764SoilVHAAPAGSPWMWTLMFGYHEDRMPTQGYAAAREAAMTAFAKSWRRE
Ga0318554_1005777813300031765SoilPVGSPWMWTLAFGHHEDRTPTHGYEATRESAMAAFAKSWRREEKRRAR
Ga0318554_1006892433300031765SoilAPLGSPWMWTLAFGQHEDRTPTHGYAETREAAMAAFAKSWRRE
Ga0318554_1047450033300031765SoilMWTLAFGQHEDRTLTHGYKATREDAMAAFATSWRR
Ga0318554_1064898713300031765SoilVSEPWLWTLAFGQHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318509_1023735613300031768SoilMKAAAAPVGAPWLWTLAYGQHEDRSPIYDYEATREAAMAAFAKSWRQE
Ga0318509_1035257513300031768SoilMWTLAFEYHEDRTPTHDYEATREAAIAAFAKSWRGSSS
Ga0318509_1077915913300031768SoilMWTLAFGQHEDRTPTRGFAATREAAMSSFAKSWRREEF
Ga0318509_1082929713300031768SoilHRGPAPVGTPWMWTLAFGHHEDRTPTHGYAATREAAMVAFAKSWRRV
Ga0318509_1085901013300031768SoilGTPWLWTLAYGHHEDRSPTHGYEPTREAAMAAFAKSWRND
Ga0318526_1023377513300031769SoilMWTLAFWHHEDRSPTHGYAATREAAMEAFAKSWRQE
Ga0318521_1020438123300031770SoilMKAAAVPAGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWQRE
Ga0318521_1034970623300031770SoilMAMGLGSPWMWTLAFGQHEDRTPTHGYAATREAAMAAFAK
Ga0318546_1003380323300031771SoilMWTLAFGHHEDRTPTHGYEPTREAAMAAFAKNWRRE
Ga0318546_1016713133300031771SoilTKASPVGTPWMWTLAFGHHEDRTPTHGYAETRKAAMAAFAKSWRRE
Ga0318546_1020484923300031771SoilASHGCGTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0318546_1044951713300031771SoilMGTLALDHHEDRTPRHGYESTREAAMAAFANSWRRE
Ga0318546_1075573913300031771SoilPWMWKLAFGYHEDRTPTHGYAATREATMAAFAKSWRRESF
Ga0318546_1088146023300031771SoilMWTLGFGHHEDRTPTHGYTATREAAMAAFAKSWRRE
Ga0318546_1126909913300031771SoilWTLAFGYHEDRTPSHGYAATREAAMAAFAKSWRRE
Ga0318543_1025968113300031777SoilVHAAPVGSPWMWTLAFGHHEDRTPTHGYAATREAATTAFAKSWRPE
Ga0318543_1037997813300031777SoilMWTLAFGHHEDRTPTHGYAATREAAMVAFAKSWRRV
Ga0318498_1010266233300031778SoilMWTLAFGYYEDRTPTHGYAATREAAMSSFAKSWRRE
Ga0318498_1044370913300031778SoilPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0318498_1045926123300031778SoilAFGHHEDRWPAHGYEASREAAMAAFAKSWRRQWPR
Ga0318566_1001668913300031779SoilMWTLDFGQHEDRTPTHGYAATREAAMAAFAKSWRREEF
Ga0318566_1051357423300031779SoilSYPWVGHHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318566_1066719833300031779SoilPWFWTLAYGYHYDCTPIHGYEATREAAMAAFAKSWRRE
Ga0318508_123848813300031780SoilASPVGASWMWMLAFGHHEDRTPTHGYAATREDAMAAFAKSWASSDL
Ga0318508_123878323300031780SoilAGGCAVMWTLMFGHHDDRTPTHGYEPTREAAMTAFAKS
Ga0318547_1022571413300031781SoilVGMSWMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0318547_1086471713300031781SoilMKAAAVPTGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWRRE
Ga0318552_1036028023300031782SoilPWMWTLAFGHHEDRTPTHGYAESREAATGAFARSWRRE
Ga0318552_1074368013300031782SoilPWLWTLAFGQHEDRWPTHGYAPTREAAMAAFAKSWRRE
Ga0318529_1019354313300031792SoilLSPWLWTLAYGHHEDRTPIYGYEATREAAMVAFAKSWRRE
Ga0318529_1030160413300031792SoilAVPVGMSWMWTLAYDYHEDRTLTHGYAATCEDATAAFAKSWRRE
Ga0318529_1039779713300031792SoilANAAPVDEPWLRTLAFGHHEDRTPTHGYEATREEAMAAFAKSWRRE
Ga0318548_1005848363300031793SoilAPEGSPWMWTLGFGHHEDRTPTHGYEPTREAAMAAFAKSWRHE
Ga0318548_1008587833300031793SoilLWTLAFGQHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318548_1045001613300031793SoilPVGMPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0318503_1014796213300031794SoilPVGMSWMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0318503_1027425513300031794SoilGPAPVGTPWMWTLAFGHHEDRTPTHGYAATREAAMVAFAKSWRRV
Ga0318557_1013700933300031795SoilTTLAYGHHEDRSPTHGYEPTREAAMAAFAKSWRND
Ga0318557_1051533313300031795SoilWMWTLAFGQHEDRTPTHGYAATREAAMATFAKSWRRE
Ga0318576_1036676223300031796SoilWTLAYGHHEDRSPTHGYEPTREAAMAAFAKSWRND
Ga0318576_1046538123300031796SoilAVDLAFGQHEDRTLTHGYAATRGAAMAAFAKSWPCTH
Ga0318576_1049405823300031796SoilVWTLAFGQPEDRTPTHGYEPTREVAMAAFAKSWRREL
Ga0318576_1056268013300031796SoilMWTLAFGHHEDRTPTHGYEATREAAMAAFAKSWRRDNEKKAPE
Ga0318550_1028431013300031797SoilVGEWTLILGQHAHRRTGYEPTREDAMAAFAKSWRRE
Ga0318550_1032103623300031797SoilTPWFWTLAYAHLEDRTPTHGYEATREAAMAGFAKSWRRE
Ga0318550_1049987313300031797SoilVGRLALGHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0318523_1024891723300031798SoilMSWMWTLGYGYHEDRTPIHGYAATREDATTAFAKSWRRE
Ga0318523_1042966733300031798SoilAVPAGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWQRE
Ga0318523_1058633513300031798SoilVFGAAVGTPWLWTLAYGHHEDRTPIHGYAATREDAMAAFAKSWRRE
Ga0318497_1014292413300031805SoilPWMWTLAFDHHQDRTPTDGHEPTREAAMAAFAKSWRRCS
Ga0318497_1053396613300031805SoilAGPVGSPWMWTFAFGHHEDRTPTHGYAATREAAMSAFAKSWRRE
Ga0318497_1078799013300031805SoilWMWTLAFGHHEDCTPTHGYAESREAAMSAFAKSWRRE
Ga0318568_1051952313300031819SoilPWMSTAYGYHEDRTPTHGYETTREAAMAAFAKSWRRE
Ga0318568_1062123713300031819SoilPVGMSWMWTLAYDYHEDRTLTHGYAATCEDATAAFAKSWRRE
Ga0318567_1070456313300031821SoilMWTLAFGHHEDRTRTHGYAETRKAAMAAFAKSWRRE
Ga0318567_1071453213300031821SoilPVGMSWMWTLAFGQHEDRTPTRGFAATREAAMSSFAKSWRREEF
Ga0318567_1088736223300031821SoilYALPVGASWMWTLALGHHEDRTPTHGYAATREDAIAAFAKSWRRE
Ga0318499_1005083813300031832SoilAAVPVGMPWMWTLAYDYHEDRTLTHGYAATREDAMAAFAKSWRRE
Ga0318499_1023735413300031832SoilIRPTPRRVGSPWMWTLAFWHHEDRSPTHGYAATREAAMEAFAKSWRQE
Ga0318499_1041532413300031832SoilANAGPVGSPWMWTFAFGHHEDRTPTHGYAATREAAMSAFAKSWRRE
Ga0310917_1001894393300031833SoilPEGSPWMWTLGFGHHEDRTPTHGYEPTREAAMAAFAKSWRHE
Ga0310917_1010876253300031833SoilMWTLAFGHHEDRTPTHGYAVTREAGMAAFAKSWRRK
Ga0310917_1016386623300031833SoilGQPWLWTLAYGHHEDRMPAHGYEATRETAMAAFARSWRQE
Ga0310917_1029668413300031833SoilPWLWTLAYGHHEDRTPIYDYEPTREAAMAAFAKSWRRD
Ga0310917_1039403033300031833SoilAPAGTPWFWTLAYAHLEDRTPTHGYEATREAAMAGFAKSWRRE
Ga0310917_1098533713300031833SoilMSWMWSLAFGYEDRAPTHGYEPTRMGAMAAFARSWRRK
Ga0318517_1011086333300031835SoilRAGRRAMALASGHHEDRMPTHGYTATREAAMVAFAKSWRRE
Ga0318517_1012499113300031835SoilLWTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRR
Ga0318517_1056334713300031835SoilSWMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0318511_1011963613300031845SoilWTLLFGQHEDGTPTHGHEATREAAMAAFAKSWRRE
Ga0318512_1004821643300031846SoilATAAPIGQPWLWTLAFWQHEDRTPTHGYEPTREAAMAAFAKSWRREWF
Ga0318512_1033822813300031846SoilHAAPVGSPWMWTLAFGHHEDRTPTHSYAATREAATTAFAKSWRPE
Ga0318512_1050279113300031846SoilAPEGSPWMWTLAFGHHEDRTPTHGYDPTREAAMAAFAKSWRREQTS
Ga0318527_1025641223300031859SoilRIYKANAGPVGSPWMWTFAFGHHEDRTPTHGYAATREAAMSAFAKSWRRE
Ga0306919_1000578113300031879SoilWMWTLAFGHHEDRWPTHGYEASREAAMAAFAKSWRRQWPR
Ga0306919_1000596693300031879SoilMWTLAFGYHEDRTPTHGYEATREAAMAAFAKSWRRE
Ga0306919_1010735213300031879SoilMWTLAFGHHEDRTPTAGYEPTREDAAVAFAKSWRRE
Ga0306919_1042449633300031879SoilMPWLWTLAYGHHEDRWPIYGYEPTGDAAMAAFAKSWRREMRNEPRRR
Ga0306919_1051916723300031879SoilMWTLAFGHHEDRTPTHGYEPRRDAAMAAFAKSWRRE
Ga0306919_1065802133300031879SoilMWTLAFGYHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0306919_1066711013300031879SoilMWTLAFGYHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0306919_1104113133300031879SoilRNTLAFGYHDDRTPTHGYVSTREAAMAAFAKSWRRE
Ga0306919_1114047513300031879SoilMWTLAYDYHEGRTLTHGYAATREAAMAAFAKSWRRE
Ga0306919_1133441523300031879SoilMATPWLWTLAFGQHEDRWPTHGYGPTREAAMAAFAKSRRRE
Ga0306919_1135163223300031879SoilMPWLWTLAYGHHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0306919_1138480123300031879SoilVAATLTFGHHEDHTPTQGYEATREAAMAAFAKSWRRE
Ga0306919_1139681023300031879SoilMWTLAFGHREDRTPTHGDEPTREAAMAAFAKRWRRE
Ga0318544_1004778523300031880SoilMWTLAFGHHEDRRPTHCYKPTREAAMAAFGKRWRRE
Ga0318544_1008148913300031880SoilVVGRIMKAAAVPAGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWQRE
Ga0318544_1015604333300031880SoilMQTLAFWHHEDQTPTHGYAATREAAMAAFAKSWRREW
Ga0318544_1040291113300031880SoilMATPWLWTLAFGQHEDRWPTHGYGPTREAAMAAFAK
Ga0306925_1024932743300031890SoilMWTLAFGHREDRTPTHGYEPTREAAMAALAKSRRRE
Ga0306925_1027325043300031890SoilATAAPIGQPWPWTLAFGHHEDRTPTHGYAATREAAVAAFAKSWRRE
Ga0306925_1054754113300031890SoilAAVPAGMSWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRHE
Ga0306925_1076721923300031890SoilMWTLAFDHHEDRTPTHGYTATREAAMAAFAKSWRRE
Ga0306925_1111500723300031890SoilMPWLWTLAYGHHENRTPIYGYEPTREAAMAAFAKSWRRQWPR
Ga0306925_1120427223300031890SoilMWTLLFDFHEDRTQTHRYEPTREAAMAAFAKSWRRE
Ga0306925_1169841923300031890SoilMWTLAVGHHEDRTPTHGYAETREAAMMAFTKSWRQE
Ga0306925_1174177523300031890SoilATAAPVGQPWLWTLAFGYHEDPRPTHSYEPTREAAMAAFAKSWRWE
Ga0318536_1007534633300031893SoilLKSAAAPVGMPWLWTLAYGHHEDRWPIYGYEPTCDAAMAAFAKSWRREMRNEPRRR
Ga0318536_1009532613300031893SoilANAAPLGSPWMWTLAFGQHEDRTPTHGYAETREAAMAAFAKSWRRE
Ga0318536_1012855033300031893SoilMSWMWTLVFGYYEDRTPTHGYAATREAAMSSFAKSWRRE
Ga0318536_1046110113300031893SoilVDEPWMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0318536_1055556113300031893SoilPVGQPWLWTLAYGHHEDRTPIYGYEATREAAMAAFAKSWRRASP
Ga0318536_1059288613300031893SoilVHAAPEGSPWMWTLAFGHHEDRTPTHGYDPTREAAMAAFAKSWRREQTS
Ga0318522_1017198533300031894SoilCGQLAFGQHQDRTPTHGYAATREAAMAAFAKSWRWE
Ga0318522_1023838823300031894SoilMQAAAVPVGMSWMWTLAFGHHEDRTPAHGYAATREAAMAAFAKSWRRR
Ga0318551_1040058923300031896SoilMWMLAFGHHEDRTPTHRYEPTREGAMAAFAKSWRRE
Ga0318520_1012344213300031897SoilSGHYPWMWKLAFGYHEDRTPTHGYAATREATMAAFAKSWRRESF
Ga0318520_1088317813300031897SoilMRTLAFGHHKDCTPTHGYEPTREAAMAAFAKSWRRE
Ga0318520_1105915913300031897SoilSTASPVGTRWMWTLAFGHHEDRTPTHGYDPTREAAMAAFAKSWRRE
Ga0306923_1012469763300031910SoilMRAAASLSYGHPEDRTSTHGYEATREAAMAAFAKSWRRE
Ga0306923_1035101013300031910SoilLKSAAAPVGMPWLWTLAYGHHEDRTPIYGYEPTRDAAMTAFAKSWRRQWPR
Ga0306923_1061241523300031910SoilVSWLWTLAFGHHEDRTPTHGYKPTREAAMAAFAKSWRRE
Ga0306923_1103694723300031910SoilLAMLLSPRVWTLAFGQHEDRSPTHGYAATREAAMAAFAKSWRRE
Ga0306923_1119216813300031910SoilAPVGMPWLWTLAYGHHEDRTPIYGYEPTREEAMTAFAKSWRRK
Ga0306923_1142798013300031910SoilAAPIGQPRLWRLAFWQHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0306923_1199233313300031910SoilMWTLAFGHHEDRTPTHGYAATREDAMGAFAKSWRQE
Ga0306923_1207589313300031910SoilMWTLAFGHHEDRTPTHGYAETREAAMAAFAKSWRRE
Ga0306921_1004009283300031912SoilMWTLAFGQHEDWTTTHGYAESRETAMATFAKSWRRE
Ga0306921_1006074023300031912SoilMRAAASLSYGHPEDRTPTHGYEATREAAMAVFAKSWRRE
Ga0306921_1040207423300031912SoilMWAPAFGHHEDRTPTHDYEPTRAAAMAAFAKGWRREQF
Ga0306921_1115375423300031912SoilMWTLAFGQHEDRTPTHGYEPTREAAMKAFAKSWRRE
Ga0306921_1135479123300031912SoilIGSPWMRTLAFGQHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0306921_1207533413300031912SoilAAAPVGMPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFAESWRRE
Ga0306921_1246973713300031912SoilMWTLAFGHHEDRMPTHGYGPTREAAMAAFAKSWRRE
Ga0310912_1001803763300031941SoilWLWMLAFGQHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0310912_1007202533300031941SoilAPEGTPWLWTLAFGHHEDRTPTRDYGSTREAAMAAFAKSWRRE
Ga0310912_1017389813300031941SoilGQPWLWTLAFWQHEDRTPTHGYYEATREAAMAAFAKSWRREWF
Ga0310912_1039310733300031941SoilVDEPWLWTLAFGHHEDRTPTHGYAATREATMAAFAKSWRRE
Ga0310912_1047899313300031941SoilSPWMWTLGFGHHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0310912_1069082523300031941SoilGEDVLRTLAFWYHEDRTPTHGYAATREAAMAAFAKSWRRG
Ga0310912_1071627013300031941SoilMWTLIFGHHDDRTPTHGYEPTREAAMAAFAKNWAEGIR
Ga0310912_1072883613300031941SoilAWTLAYGHHENRTPIYGYEPTRDAAMAAFAKSWRRQWPR
Ga0310912_1096085613300031941SoilMWTLAFGHHEDRWPIYGYEPTREAAMAAFAKSWRREQCS
Ga0310916_1003940053300031942SoilTPWLWTLALGHHEDRTPTHGYEPTRETAMAAFAKSWRRD
Ga0310916_1015389243300031942SoilAGTPWMWTLAFGHHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0310916_1029599913300031942SoilWMWTLAFGHHEDRTPTHGYDPTREAAMAAFAKSWRRE
Ga0310916_1098366623300031942SoilWTLAFGQREYRTPRHGYAATREAAMAAFAKSWRRE
Ga0310913_1103105013300031945SoilLGSPWMWTLAFGQHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0310913_1104870333300031945SoilLKSAAAPVGMPWLWTLAYGHHEDRTPIYGYEPTREEAMTAFAKSWRRK
Ga0310910_1004817963300031946SoilVSVAAPVGAPWLWTLAFRYHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0310910_1025032523300031946SoilPIGQPWLWTLAFWQHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0310910_1064935713300031946SoilIWTLAFGHHEDHTPTHGHEPTREAAMAAFTESWRRE
Ga0310910_1071347323300031946SoilMSWMWTLAVGYHEDRAPSHGYAATREAAMAAFAKSWRRE
Ga0310910_1085811723300031946SoilYPWMWKLAFGYHEDRTPTHGYAATREATMAAFAKSWRRESF
Ga0310910_1108652113300031946SoilLWTLAYGQHEDRTPTHGHEPTREAAMQAFARSWHRET
Ga0310909_1002794253300031947SoilMWTLLFEHHQNRMPTHGYAETREAAMAAFAKSWRAGKD
Ga0310909_1012707213300031947SoilPWMWTLAFGHHEDRTPTHSYAATREAATTAFAKSWRPE
Ga0310909_1077004113300031947SoilMSWMWTLAFGYHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0310909_1081525113300031947SoilSPWMWTLAFGYHEDRTPTHSHKPMREAAMAAFAKSWRRE
Ga0310909_1090116923300031947SoilMPWMWTLAFGRHDDRTPTHGYAATREAAMAAFAKSWRRE
Ga0310909_1110459833300031947SoilSPWMWTLACGHHKDRTPTHGYEATREAAMAAFGWRRE
Ga0310909_1133197813300031947SoilPWMWTLAFGHHEDRTPTHGYDPTREAAMAAFAKSWRREQTS
Ga0310909_1157135823300031947SoilTPWFWTLAYAHLEDRTPTHGYEATCEAAMAAFAKSWRQK
Ga0306926_1009211163300031954SoilMWTLAFGHHEDRTPTHGYAESREDAMAAFAKSWRRE
Ga0306926_1014290813300031954SoilMRAAASLSYGHPEDRTPTHGYEATREAAMAAFAKSWRRE
Ga0306926_1150186933300031954SoilVGTPWFWTLAYAHLEDRTPTHGYEATCEVAMAAFAKSWRQK
Ga0306926_1155607013300031954SoilMWTLASGHQDRTPTHGYAATREAAMAAFAKSWRRE
Ga0306926_1165866023300031954SoilMSWMWTLAFGYHEDRTPTHGYAATREAAMSSFAKSWRRE
Ga0306926_1177818613300031954SoilMSWLWTIAFGQREDRTPTHRYEATREAAMAAFAKSWRRE
Ga0306926_1205704413300031954SoilMWTLAFGHHEDRTPTHGYAATREAAMAAFAKSWRLE
Ga0318530_1007662113300031959SoilPVGMPWLWTLAYGHHEDRWPIYGYEPTGDAAMAAFAKSWRREMRNEPRRR
Ga0318530_1012192643300031959SoilWTLMFGYHENRMPTHGYAAAREAAMTAFAKSWRRE
Ga0318530_1029905223300031959SoilPEGSPWMWTLAFGHREDRTPTHGYEPTREAAMAAFAKRWRREEF
Ga0318531_1015229913300031981SoilPSSTKANASPVGASWMWMLAFGHHEDRTPTHGYAATREDAMAAFAKSWASSDL
Ga0318531_1028760713300031981SoilGTPWLWTLALGHHEDRTPTHGYEPTRETAMAAFAKSWRRD
Ga0318531_1031981423300031981SoilWMWTLAFGYHEDRTPTHGYAATREAAIEAFAKSWRRE
Ga0318531_1034005413300031981SoilPVGMPWLWTLAYGHHEDRTPIYGYAPTREAPMAAFAKSWRRE
Ga0318531_1050031523300031981SoilLAYGHHENRTPIYGYEPTRDAAMAAFAKSWRRQWPR
Ga0306922_1001378863300032001SoilMALAFGHHEDRMPTHGYTATREAAMVAFAKSWRRE
Ga0306922_1009470013300032001SoilVHAAPEGSPWMWTLAVGHHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0306922_1211255913300032001SoilWMWTLAFGHHDDRTPTHGYEGTRESAMAAFATGWRRE
Ga0306922_1230625713300032001SoilMWTPMFGHHDYRTPTHGYEPTRGAAMAAFAKSWRRE
Ga0318569_1030790823300032010SoilPWMWTFAFGHHEDRTPTHGYAATREAAMSAFAKSWRRE
Ga0318507_1010057943300032025SoilVCMSWMWTLAFGHHEDRTPTHGYAATREAAMSAFAKSWRRQWPR
Ga0318507_1010099343300032025SoilSWMWTLVFGYYEDRTPTHGYAATREAAMSSFAKSWRRE
Ga0318507_1010202313300032025SoilPWLWTLAYGHHEGRWPIYCYEPTREAAMAAFAKSWRRE
Ga0318507_1012966143300032025SoilLWTLAFGQHEDRWPTHGYAPTREAAMAAFAKSWRRE
Ga0318507_1013077523300032025SoilMWTLAFDHHQDRTPTDGHEPTREAAMAAFAKSWRRCS
Ga0318507_1030284123300032025SoilVHAAPVGSPWMWTLAFGYHEDRTPTHGYAETREAAMAAFAKSWRRD
Ga0318507_1052299623300032025SoilRRAGGMSWMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0310911_1018521023300032035SoilLAYGRHEDRTPIYGYEPTREAAMAAFAKIWRRQWPR
Ga0310911_1047896713300032035SoilWMWTLAFGYHEDRTPTHGYEPTREAAMAASAKSWRRE
Ga0310911_1062765613300032035SoilMWTLAFGYHEDRTPTHGYAETREAAMAPFAKSWRCA
Ga0310911_1080211913300032035SoilVDVTLAFGHYEGHTPTYGYEPTREAAMAAFAKSWRRE
Ga0310911_1086327023300032035SoilRGLFGHHEDRTPTHGYEPTREAAMAAFAKSWRRESF
Ga0318549_1000234153300032041SoilMTMWTLAFGYHEDRTPTHGYGPTREAAMAAFATSWRRE
Ga0318549_1030219113300032041SoilPWLWTLAFGQHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318545_1005869813300032042SoilPAGTPWLWTLAYGQHEDRTPTHGHEPTREAAMQAFARSWHRE
Ga0318545_1037231113300032042SoilMAMGLGSPWMWTLAFGQHEDRTPTHGYAATREAAMAAFAKSWRRE
Ga0318556_1064752513300032043SoilFWTLAYGYHYDCTPIHGYEARREAAMAAFAKSWRRE
Ga0318556_1072157013300032043SoilMVSKRWMWTLAVGHHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318558_1002227513300032044SoilRRARSSPWMWTLAFGYHEDRAPMHGYAETREAAMAAFAKSWRRK
Ga0318558_1009120413300032044SoilVHAAPAGSPWMWTLMFGYHEDRMPTHGYAAAREAAMTAFAKSWRRE
Ga0318558_1013802833300032044SoilMPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0318558_1069207913300032044SoilAAVPVGMSWMWTLAFGYHEDRTPTHGYAATREAAMAAFAKSWRQE
Ga0318532_1005721023300032051SoilMILALAYGYHYDCTPIHGYEARREAAMAAFAKSWRRE
Ga0318506_1001402873300032052SoilHAAPAGSPWMWTLMFGYHEDRMPTHGYAAAREAAMTAFAKSWRRE
Ga0318506_1013972333300032052SoilSTSPVGTPWLWTLAYGHHEDRSPTHGYEPTREAAMAAFAKSWRND
Ga0318506_1032665523300032052SoilTLMFGYHGDRTPTHGYAATREDAMAAFAKSWASSDL
Ga0318506_1043733413300032052SoilEGSPWMWTLAFGYHEDRTPTHGYEPTREAAMAAFAKSWRTG
Ga0318570_1000684913300032054SoilSWMWTLAFGHHEDRTPTHGYAATREAAMSAFAKSWRRQWPR
Ga0318570_1001893813300032054SoilVHAAPAGSPWMWTLAFGHHEDRTPTHGYAATREAAMSAFAKSWRRE
Ga0318570_1024236713300032054SoilAPVVQPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRR
Ga0318570_1029107713300032054SoilVPVGMSWMWTLAFGHHEDRTPAHGYAATREAAMAAFAKSWRH
Ga0318570_1031584213300032054SoilVHAAPVGSPWMWTLAFGHHEDRTPTHGYEATRDAAMAAFAKNWRRE
Ga0318570_1039940113300032054SoilPVGSPWMWTLAFGHHEDRTPTHGYEPTREAAMAEFAKSWRRE
Ga0318570_1040249423300032054SoilGTPWMWTLAFGHHEDRTPTHGNETMREAAMAAFAKSWRRE
Ga0318570_1054276313300032054SoilGTPWMSTAYGYHEDRTPTHGYETTREAAMAAFAKSWRRE
Ga0318575_1010425143300032055SoilCAVMWTLMFGHHDNRTPTHGYEPTREAAMAAFAKSWRRE
Ga0318575_1054795823300032055SoilSVGAPWLWTLAYGQHEDRSPIYDYEATREAAMAAFAKSWRQE
Ga0318533_1027299033300032059SoilWMWTLGYGYHEDRTPIHGYAATREDAMTAFAKSWRRE
Ga0318533_1034661733300032059SoilWTLAFGHHEDRTPTHGYEPTREAAMAAFAKNWRRE
Ga0318533_1045012323300032059SoilANAAPVDEPWLWTLAFGHHEDRTPTHGYAATREATMAAFAKSWRRE
Ga0318533_1086193313300032059SoilMWTLAYDYHENRTLTHGYAATREDAMAAFAKSWRRE
Ga0318533_1095349923300032059SoilMSTLAFGHREDRTPTHGDEPTREAAMAAFAKRWRRE
Ga0318505_1001289753300032060SoilMWTLAFGYHEDRTPTHGYAETREAAMAAFAKSWRR
Ga0318505_1008240253300032060SoilILKVHAAPEGSPWMWTLGFGHHEDRTPTHGYEPTREAAMAAFAKSWRHE
Ga0318505_1013339833300032060SoilWTLAVGHHEDRWPTHGYEPTREAAMAAFAKSWRRE
Ga0318504_1009757613300032063SoilAFGHHEDRTPTHGYEATRESAMAAFAKSWRREEKRRAR
Ga0318510_1003542313300032064SoilAPWMWTLAFGHHEDRTPIYGNEPTREAAMAAFAKSWRRE
Ga0318510_1024108513300032064SoilCGQLAFGQHEDRTPTQGYAATREATMAAFAKSWRRE
Ga0318510_1044772023300032064SoilGTWTLAYGHHEDRSPTHGYEPTREAAMAAFAKSWRND
Ga0318510_1053079533300032064SoilAVPVGMSWMWTLAFGYHEDRTPTHGYEATREEAMAAFAKSWRRE
Ga0318513_1014870023300032065SoilMKAVAVPAGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWQRE
Ga0318514_1010859613300032066SoilAAPAGSPWMWTLAFGHHEDRTPTHGYAATREAAMSAFAKSWRRE
Ga0318514_1014439713300032066SoilPVGEPWLWTLAYGHHEDRTAIYGYEPTREAAMAAFAKSWRRE
Ga0318514_1076338323300032066SoilGMPWMWTLAFEYHEDRTPTHGYEATREAAMAALANSWRRE
Ga0306924_1092998423300032076SoilHAAPEGSPWMWTLGFGHHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0306924_1237633113300032076SoilPVSSPWMWTLAFGQREDRTPRHGYAATRDAAMAAFAKSWRRE
Ga0306924_1247434523300032076SoilSPWMWTLMFGYHEDRTPTHGYAATRDAAMAAFAKS
Ga0318518_1007269633300032090SoilLKSAAARVGMPWLWTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0318518_1020412423300032090SoilGVAWTLTFGQPEDRTPTHGYEATRDAAMAAFAKSWRRE
Ga0318518_1020868113300032090SoilWTLAYSHLEDRTPTHGYEATREAAMAAFAKSWRRE
Ga0318577_1008270733300032091SoilHAAPVGSPWMWTLAFGYHEDRTPTHGYAETREAAMAAFAKSWRRD
Ga0318577_1013618513300032091SoilDAPWLWTLAFGYHEDRTPTHGYEATREAAMAAFAKSWRRE
Ga0318577_1026839213300032091SoilLWTLAYGYREDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0318540_1010348833300032094SoilIWTLAFGHHEDRTPTHGYAATREAAMAAFAKNWRRE
Ga0318540_1021871213300032094SoilAPVGSPWMWTLAFGHHEDRTPTHSYAATREAATTAFAKSWRPE
Ga0318540_1028886613300032094SoilAFGHHEDRTPTHGYDPTREAAMAAFAKSWRREQTS
Ga0318540_1030797723300032094SoilPQPRLAYRPHEDRSPIYGYEATREAAMDAFARSWRRQ
Ga0318540_1041053223300032094SoilMKVHAAPEGSPWMWTLGFGHHEDRTPTHGYEPTREAAMAAFAKS
Ga0318540_1057698513300032094SoilVPVGMSWMWTLAFGYHENRTPTHGYEPTCEAAMAAFAKSWRRE
Ga0268251_1057779813300032159AgaveMALDRVDLPWLWTLAFGHREDRTPSHGYEATREDAMAAFAKSWRRE
Ga0307471_10034677623300032180Hardwood Forest SoilMWTLAFGHHKDRTPTHGYEPPREAAMAAFAKSWRRE
Ga0307471_10235408313300032180Hardwood Forest SoilTPWMWTFIFPHYESRSPTHGYAETREAAMAAFAKSWRWE
Ga0307472_10015424433300032205Hardwood Forest SoilMWTLGIEYHKDRTATHGYAATREAAMAAFAKSWRPE
Ga0306920_10008053263300032261SoilVPVGMSWMWTLAFEHHEDRTLPHRYESTRESAMAAFTKSWLRE
Ga0306920_10027033943300032261SoilMWTLAFGHHEDRTPTHDYEPTREAAMAAFTKSWRRE
Ga0306920_10123296513300032261SoilPVDSPWLWTLAYGYHEDRAPTHGYEATREAAMAAFAKSWRRE
Ga0306920_10171203233300032261SoilWTLAYGQHEDRSPIYDYEATREAAMAAFAKSWRQE
Ga0306920_10188357113300032261SoilVSGPNMDKAFGYHEDPTPTHGYEPTRKAAMAAFAKSWRRE
Ga0306920_10202696633300032261SoilPWLWTLAYGQHEDRTPTHGHEPTREAAMQAFARSWHRET
Ga0306920_10237578723300032261SoilMWTPAFGHHEDRTPTHGHEPRREAAMAAFAKSWRRE
Ga0306920_10293186923300032261SoilMWTLAFGHHEDRAPTHGYEPTREEAMAAFAKGWRRE
Ga0306920_10309364113300032261SoilMSWMWTLAFGHHEDRTPAHGYAATREAAMAAFAKSWRRE
Ga0306920_10439395513300032261SoilAAPVGMSWMWTLAFGHHEDRTPTHDHEQAREAAMAAFAKSWRRK
Ga0310914_1054898513300033289SoilWTLAYGYHEDRAPTHGYEATREAAMAAFAKSWRRE
Ga0310914_1059450023300033289SoilMDKAFGYHEDPTPTHGYEPTRKAAMAAFAKSWRRE
Ga0310914_1060794333300033289SoilMWTLAFGHHEDRTPTAGYEPTREDAAVAFAKSWRRK
Ga0310914_1063944123300033289SoilAAPEGSPWMWTLGFGHHEDRTPTHGYEPTREAAMAAFAKSWRRE
Ga0310914_1115331813300033289SoilDSPWLWTLAYGYHEDRAPTHGYEATREAAMAAFAKSWRRK
Ga0310914_1117041813300033289SoilAAVPVGMSWMWTLAYDYHEDRTLTHGYAATCEDATAAFAKSWRRE
Ga0318519_1001393613300033290SoilPAGSPWMWTLMFGYHEDRTPTHGYAAMREDAMAAFAKSWRRE
Ga0318519_1002657013300033290SoilPAAVPAGMSWMWTLGYGYHENRTPIHGYAATREDAMTAFAKSWQRE
Ga0318519_1002681113300033290SoilMWTLAFGHYEDRTPTHGYAATREAAMAAFAKSYRREQF
Ga0318519_1006114753300033290SoilLWTLAYGHHEDRTPIYGYEPTREAAMAAFAKSWRRE
Ga0318519_1046311623300033290SoilMKANAAPVDEPWLWTLAFGHHEDRTPTHGYAATRETTMAAFAKSL
Ga0318519_1048731113300033290SoilVPLGRSWMWTLAFGYHEDRTPTHGYEPTCEAAMAAFAKSWRRE
Ga0318519_1054139223300033290SoilWMWTLAFGHHEDRTPTHGYEPTREAAMTVFARSWWQE
Ga0318519_1056358213300033290SoilMAVTLAFGHHADRTPTHGYEPTREAAMAAFARSWRRGIG
Ga0318519_1085343223300033290SoilMPWLWTLAYGHHEDRWPTYGYEPTREAAMAAFAKSWRRE
Ga0318519_1089170113300033290SoilGTPWMWTLAFGHHEDRTPTHGYAATREAAMSSFAKSWRPE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.